IRIECOIRIDS
@l
TWIRUE
SOUTH
AUSTRALIAN
MUSEUM
VOLUME 36 PART 1
DECEMBER 2003
ORNAMENTAL DIAMOND PATTERNS IN ABORIGINAL BARK
PAINTINGS FROM N. E. ARNHEM LAND, AUSTRALIA
EMIL MAKOVICKY
Summary
This paper is a symmetrological study of the geometric art of Aboriginal bark paintings from
northeastern Arnhem Land, Australia. Ornamental diamond patterns in these paintings display
complex symmetries and the current study tests the feasibility of a symmetrological approach to the
description of these patterns and to the definition of the artistic canons of different clans of the
Yirritja moiety. This first attempt furnishes all the necessary methods and definitions for detailed
follow-up studies of the subject.
ORNAMENTAL DIAMOND PATTERNS IN ABORIGINAL BARK PAINTINGS
FROM N.E. ARNHEM LAND, AUSTRALIA
EMIL MAKOVICKY
MAKOVICKY, E. 2003. Ornamental diamond patterns in Aboriginal bark paintings from N.E.
Arnhem Land, Australia. Records of the South Australian Museum 36(1): 1-20.
This paper is a symmetrological study of the geometric art of Aboriginal bark paintings from
northeastern Arnhem Land, Australia. Ornamental diamond patterns in these paintings display
complex symmetries and the current study tests the feasibility of a symmetrological approach
to the description of these patterns and to the definition of the artistic canons of different clans
of the Yirritja moiety. This first attempt furnishes all the necessary methods and definitions for
detailed follow-up studies of the subject.
E Makovicky, Geological Institute, University of Copenhagen, @ster Voldgade 10, DK-1350
Copenhagen K, Denmark. Manuscript received 19 February 2001.
INTRODUCTION
The bark paintings of Armhem Land are perhaps
the finest creations of contemporary Aboriginal
art. Their technical excellence is combined with
considerable stylistic variation across the region
from east to west. In western Arnhem Land the
background to the figures tends to remain free of
infilling while the figurative representations are
infilled; the opposite is practised in northeastern
Amhem Land. Infilling is not practised elsewhere
in Australia (Morphy 1981: 56).
In general, bark paintings and other works of
art are representations of the ancestral past
(Dreamtime) when the world creators transformed
the earth through their actions, creating the entire
landscape as it is known to the Aborigines today
— landforms, skies, flora, fauna, geography and
social structures. The Ancestral Beings entrusted
distinct areas of northeastern Arnhem Land to
different clans for perpetuity (Morphy 1981: 59).
The paintings are in many cases believed to be
inherited from Ancestral Beings and they relate to
them and the stories about their deeds on a
number of levels with progressively deeper
meaning.
Via connections between particular Ancestral
Beings and distinct clans/moieties, a system of
ownership or distribution of rights in paintings
developed. In northeastern Arnhem Land these
rights are exercised by patrilineal clans or their
sections. A person also has some rights in the
paintings of his mother’s clan. Control over
paintings and propagation of knowledge about
them belongs to the senior male members of the
clan; learning the interpretation of designs is a
part of male initiation (Morphy 1981: 57).
Aboriginal artists employ four colours — red,
white, black and yellow — combining ochres,
manganese oxides, charcoal, kaolin and other
white materials with, originally, plant juice
fixative. A sheet of bark is flattened with the help
of fire and its surface smoothened. The surface
priming is done by means of red, rarely black or
yellow, ochre colour. Selected areas of the
sketched design are infilled with cross-hatching.
According to Caruana (1994: 26), cross-hatched
clan designs are called dhulang in northeastern
Arnhem Land. At first, the ground is covered with
parallel white lines. A second set of lines is
painted across it in white, red, yellow or black;
sometimes also in an alternating colour sequence.
Flat colouring is used as well; dotted patterns are
infrequent.
The cross-hatching in two or more colours adds
a radiating shimmer to the Aboriginal bark
paintings (Morphy 1992); this brilliance technique
is shared with the paintings of very few other
cultures. The difference between the cross-
hatched, shimmering areas and the flat-coloured
patches is the fundamental means of artistic
expression in the patterns treated in this study.
According to Morphy (1981: 64), the main
components of northeastern Arnhem Land
paintings are the ground colour, a border,
dividing lines (compartments) and the figurative
and geometric representations. The figures form
a narrative scene that is often understandable
2 E MAKOVICKY
only to the initiated men and has different
depths of meaning. The geometric elements are
not iconic and an element can have a host of
meanings depending on the context; its
decoding requires prior instruction. The
geometric patterns are owned by distinct clans;
their similarities and differences reflect those
between these social groups. The style of
northeastern Arnhem Land is a product of
combining two different (ie figurative and
geometric) systems of representation (meaning)
in one painting. Geometric elements are
especially important for paintings created in
closed context with a restricted, initiated
audience.
There are two principal categories of geometric
patterns in the bark paintings from northeastern
Arnhem Land: two-coloured or multicoloured
stripe patterns and similarly coloured diamond
patterns; they rarely combine in striped diamonds.
The diamond patterns (owned by the clans of
the Yirritja moiety) are the object of the present
study. The richness and_ unparalleled
sophistication of their colouring schemes appears
worthy of a symmetrological/crystallographic
study from at least two points of view. On the
basis of our observations, we believe that the
colouring is yet another, large-scale device to
enhance the brilliance (the shimmering effect) of
Yirritja bark paintings, and this unique artistic
device deserves a more detailed description. On
the other hand, this colouring might indicate the
kinship between different clans and moieties.
Thus far, only the overall pattern shapes have
been invoked in the latter context (Morphy 1981:
62).
The studied material is primarily based on
photographs collected by Prof. Howard Morphy
prior to 1980 and unselfishly made available for
the current project. This choice enabled the author
to concentrate upon an older period of Aboriginal
bark painting, preceding its present market
context. It has been supplemented by observations
made in the collections of the University of
Western Australia and several thematic
exhibitions as well as by published photographic
material.
The author is aware of the limited size of the
sample of material studied. However, the present
paper is an exploratory analysis of the problem:
its primary purpose is to investigate the feasibility
of a symmetrological approach to the complex
colouring schemes rather than producing
definitive answers on their applicability to the
kinship and inheritance problems.
SELECTED EXAMPLES
Figure 12, painted by a member of the
Dhalwangu clan in 1975, contains two black-
coloured long-necked tortoises in a 2-fold rotation
arrangement on the back of a yellow tortoise; the
high symmetry of the yellow tortoise body is
broken only by its long neck. Water courses
appear indicated by a cross-hatched striped pattern
and tracks from tortoise feet. All are two-coloured
on white background. Additional interpretations
can be found in Morphy (1979: 309).
Four quadrants of the painting contain a
diamond pattern outlined in yellow ochre and
white frames and occasionally degenerated into a
zig-zag. Investigating the periodicity of this
pattern, we observe that the diamonds at the
corners of a rectangular mesh are flat-coloured
whereas the central diamond is cross-hatched. The
flat-coloured diamonds are alternatively coloured
red and black. The cross-hatched pattern is three-
coloured, repeating the sequence white—red—
white—black— (repeat). The resulting repetition
period is a 4-fold of the basic one, a double of the
flat-coloured sequence. The black—red alternation,
occasionally also the red—yellow alternation on
white background, dominates the painting.
The painting by a member of the Madarrpa clan
(1975) in Figure 13 is compartmentalised
perpendicular to its length into alternating striped,
fish-populated ‘water’ portions and diamond-
covered portions without iconic element. A broad-
bodied crocodile occupies the entire long axis of
the painting with enough space to depict its scales
as a diamond pattern.
The black-red alternation dominates the
painting. With one possible exception of one-
coloured flat-coloured diamonds, the red—black
exchange takes place perpendicular to the picture
length. All cross-hatched patterns — those present
as stripes or those included in the diamond fields
— have a white-red—white—-black-— (repeat)
colouring periodicity, parallel to the previous
colour change. Diamond fields have non-diamond
‘tails’, giving the painting a forward thrust.
The two paintings by the Gumatj clan (1975) in
Figures 14 and 15 offer multiple complications of
the diamond scheme. Fig. 14 depicts a story of
birds tracking along the picture and a goanna. The
animals track across red and black striped fields
on white cross-hatched background. Fields of
diamonds occur in all four quarters, alone or as
integral parts of a presumed landscape through
which the birds track. The flat-coloured designs
are either one-coloured (red) or, in the majority of
DIAMOND PATTERNS IN ABORIGINAL BARK PAINTINGS 3
cases, show a red and black sequence. The cross-
hatched patterns are either yellow—black
sequences parallel to the previous ones or three-
colour sequences with periodicity faults.
Figure 15 consists of a kangaroo attacked by a
crocodile and, presumably, a large ray-fish, and
presents an array of diamond colouring schemes.
The attack itself takes place in a river, cross-
hatched red and black on white background. The
flat-coloured diamonds are mostly two-coloured,
red—black, red-ochre yellow, rarely only red. The
arrays of cross-hatched patterns are more
complicated: chessboard ochre and black or two-
coloured black and yellow rows separated by
white rows. The latter case again has two
variations, according to a parallel or a chessboard
scheme for the components of the coloured rows.
The Gumatj painting in Figure 1, produced in
1959-60, has one system of diamonds, changing
to zig-zagging paths, all flat-ochre coloured.
4 Vu
FIGURE 1. Bark painting by a member of the Gumatj clan (1959-60). Courtesy of H. Morphy.
Cross-hatched red and black striped areas with
white background surround the black and ochre
figures with spear throwers, separated from two
black trees by a narrow river. The cross-hatched
diamonds are one-coloured in the majority of
fields (finely ochre and red ruled). In the
uppermost main field, a unique sequence of
colour—colour—white repeats; in the central lower
panel three-coloured cross-hatched diamonds are
present, coloured either parallel or antiparallel to
each other.
E MAKOVICKY
The painting in Figure 2 (Gumatj clan 1975)
recounts the story of a freshwater crocodile and
fish in a red and white striped river. Three
transversal compartments contain six diamond
fields with rich ornamentation. All flat-coloured
diamonds are one-coloured, red with expressive
white frames. The cross-hatched diamond subset
oscillates, by way of errors in repetition, between
the three-coloured sequences black—red—white—
black—red—white- (repeat) and black-red—white—
red—black—white—black- (repeat), respectively;
tigen ae teehee mae '
a
HES,
*
&
DIAMOND PATTERNS IN ABORIGINAL BARK PAINTINGS b
both of these are present as a sufficiently long
pure sequence. A fragment of the sequence red—
black—-red—black— (repeat) and that of white—-red—
white—black-— (repeat) (as well as pure cross-
hatched white on the crocodile’s back) have been
employed as well. The former long colour
sequences and the ‘one-coloured’ river stripes
produce a colour impression very distinct from
the previous examples.
These examples show a _ need _ for
systematisation of coloured diamond patterns
from northeastern Arnhem Land if further study is
to be undertaken. The science of symmetry offers
the most efficient means for such systematisation.
FUNDAMENTAL LANGUAGE OF SYMMETRY
The Aboriginal diamond patterns are by their
nature two-dimensional periodic patterns. In such
patterns a single motif (eg an individual lozenge)
or motifs repeat infinitely. All repetitions of a
given motif are related to each other by one or
several exactly defined ways, called operations of
symmetry. All symmetry equivalent motifs have
the same shape and size and the same
a b
) &
% ¢
:
m g
surroundings from the point of view of symmetry
and geometry. The symmetry-equivalent motifs
can be related to each other by translation (pure
displacement without a change in orientation),
reflection (on a reflection axis in the plane of the
pattern or on the reflection ( = mirror) plane m
perpendicular to the plane of the pattern,
depending on the nomenclature used by the
particular author; see Fig. 3e) or rotation (by an
angle of n/360° around an n-fold rotation axis
perpendicular to the plane of the pattern; the
permitted values of n are 2, 3, 4 and 6; see Fig.
3a). A combination of reflection with translation
(by half of the full repetition period of the
periodic pattern) gives glide-reflection planes
(axes) g (Fig. 3f).
From the infinite number of translation vectors
between the periodically displaced copies of the
same motif that can be found in a two-
dimensionally periodic pattern, we usually select
the two shortest ones. For the symmetries
observed in the present work, these comprise an
angle of 90° or quite a general obtuse angle and
they are not equal in length and kind (eg Figs
3c,d; 4a; Sa,d). The two vectors define a
parallelogram, by the translation (displacement) of
Sf
0
io}
i
sS
>
FIGURE 3. Fundamental elements of symmetry in Aboriginal diamond designs. Unmarked symbols (eg m) are
colour-preserving elements whereas the primed symbols (eg m’) are elements of dichroic symmetry; p and c —
primitive and centred unit mesh with the a (vertical) and b (horizontal) axes indicated; 2 — twofold axis; m —
mirror plane; g — glide reflection plane.
E MAKOVICKY
\
4
W
be wwe cle enon denne
ween oo
FIGURE 4. Plane group cmm. a, reflection planes, glide-reflection planes and 2-fold axes in one unit mesh. In b to
f, unit mesh axes (full lines) and position of symmetry planes (stippled) are indicated: b and d show an asymmetric
motif in a general position and c, e and f show motifs in special positions (c, motif on reflection planes, e, motif on
2mm intersections, and f, motif on 2-fold axes; all motifs with appropriate own symmetry).
DIAMOND PATTERNS IN ABORIGINAL BARK PAINTINGS 7
which the entire pattern can be reconstructed. This
parallelogram is called a unit mesh (unit cell). The
unit mesh is primitive when the translation-
equivalent copies of the motif are only in its
comers (Fig. 3d), or centred when an additional
copy lies in its centre ( Fig. 3c).
Only five basic shapes of unit mesh exist in
planar patterns. All the patterns with a given type
of unit mesh belong to the same system. These
systems are as follows (a and b are the selected
vectors, Y is their angle):
i) Oblique (a # b, y # 90°); symmetry
represents pure translations or translations
and 2-fold axes
ii) Rectangular (a # b, y = 90°, Figs 3d, Se, 6a);
symmetry elements present: reflection planes
and glide-reflection planes that can be
combined with each other and with 2-fold
axes
iii) Diamond (rhombic, centred rectangular)
system which can either be described by a
diamond-shaped mesh (a = b, 120° # y # 90°)
or by a rectangular mesh with an additional
translation-equivalent point in its centre, a
so-called centred mesh (a # b, y = 90°, Figs
3c, 4a); relevant symmetry represents a
combination of reflection and glide-
reflection planes with or without 2-fold axes
iv) Square (a = b, y = 90°); 4-fold axes
combined with 2-fold axes with or without
reflection and glide-reflection planes
v) Hexagonal (equilateral triangular) (a = b,
y = 120°); 3-fold axes with or without
reflection and glide-reflection planes, or 6-,
3- and 2-fold axes with or without these
planes of symmetry.
The second and third systems are most relevant
for the present study; less frequent is the first one.
For our diamond patterns, the y angle of the
oblique unit mesh is determined by the position
and shape of the diamonds; if symmetry is
ignored, metrically they are still rectangular. The
hexagonal and square systems, so relevant for
Islamic patterns (Abas & Salman 1995: 138;
Makovicky & Makovicky 1977), are absent in
Aboriginal art.
The operations of symmetry in the plane form
unique combinations, the so-called plane (or two-
dimensional) symmetry groups. Within these
unique combinations of symmetry operations, any
operation can be replaced by a combination of
two or more other symmetry operations present in
the given symmetry group. When two or more
symmetry operations are combined, the result does
not depend on the sequence of operations chosen.
Finally, any operation in the group has its inverse
— a combination of a symmetry operation and its
inverse results in a transformed motif which is
identical to the original. Only 17 distinct plane
groups of symmetry can be found in all two-
dimensional patterns, from which four have been
encountered in the present study. From the above
listing of two-dimensional systems, the presence
of certain rotation axes and, for some cases, the
presence/absence of reflection planes in a plane
group determines the geometry of unit mesh and
the system to which the plane group belongs.
Books on symmetry written by mathematicians
often start with abstract mathematical groups, then
proceed to derive the two-dimensional groups of
symmetry and do not always get down to the
problems of their practical application. An
exception is the book by Abas & Salman (1995),
in which a profusion of examples with basic
symmetrological information attached are given.
A non-mathematical approach to plane groups is
taken by Washburn & Crowe (1998: 58) in a book
intended to teach anthropologists ‘the symmetries
of culture’.
Crystallographers are perhaps the most frequent
practical users of symmetry groups. The
approaches and notions used in the present paper
come partly from this experience. The chapters on
symmetry in crystallographic textbooks range
from highly mathematical (but always practical)
to almost purely geometric; the reader can find an
understandable/complete approach to plane
groups in Klein (2002).
The crystallographic notation of plane groups
used here consists of 4-place symbols. The first
letter p or c denotes primitive or centred mesh,
respectively (Figs 3c,d); the integer ‘n’ denotes
the highest order of rotation (2-fold rotation for
the present cases); the next letter denotes a mirror
plane m or a glide-reflection plane g perpendicular
to the a axis (which points downwards in each
figure); and the following letter indicates such
planes perpendicular to the b axis (which points
to the right) (Figs 4, 5, 6).
Thus, for example, cmm denotes a centred mesh
with mirror planes perpendicular to the mesh axes
a and b; p2 denotes a primitive mesh with a 2-
fold rotation axis; and pgg denotes a primitive
mesh with glide reflections perpendicular to axes
a and b (see Fig. 5).
The trivial factors (the directions to which no
perpendicular symmetry planes exist) are omitted
in the abbreviated symbols commonly used. They
would have been denoted by ‘1’ on the relevant
8 E MAKOVICKY
i
6
é
»
:
%
A
!
:
ay |
y
& Abd
6 Oooo
: ae
cmm
vy
Pgg
FIGURE 5S. a, uncoloured diamond pattern with unit mesh and the plane group cmm indicated. b and c, pattern of
halved and quartered diamonds, respectively (a and b contain special positions, ¢ general positions). d and e,
uncoloured diamond patterns with oblique partitioning: d, plane group p2, e, plane group pgg. In this and the
following figures, the a axis of the mesh points downwards, the b axis to the right.
position of a full symbol. Other rules of notation
are valid for the square and hexagonal systems,
with 4-, 3- and 6-fold axes, which were not
encountered in this study.
Application of plane groups of symmetry does
not require their (re)derivation, but depends
critically on their correct interpretation. In this
connection, division of elements of the motif into
those placed in general positions (not situated on
any element of symmetry) and in special positions
(situated on an element of symmetry or in an
intersection of several elements of symmetry) is
of the most fundamental importance although it is
rarely mentioned outside the field of
crystallography. An element (ie motif) in the
special position ought to have symmetry at least
equal to the symmetry elements on which it is
positioned. If its symmetry is lower, it reduces the
overall symmetry of the pattern; if it is higher, it
may result in stacking errors in the design. An
element in general position is asymmetric by
virtue of its position. If it has any other symmetry,
it again can lead to errors in pattern periodicity.
As an example, the elements of, and the general
and special positions in, the plane group cmm are
illustrated in Figure 4. This group has a centred
unit mesh and two sets of mirror planes,
respectively perpendicular to the a and b axes. As
can be seen in Fig. 4, these ‘principal symmetry
elements’, which form part of the plane group
symbol, are interleaved by glide-reflection planes.
Two-fold axes occur on intersections of all
symmetry planes of the same kind.
If the patterns encountered in the present study
are studied on the uncoloured level (as field-and-
line patterns) they are reduced to the patterns
shown schematically in Figure 5. In the
fundamental type, Fig. 5a, the framed diamonds
can occasionally become squares or be partitioned
into halves (Fig. Sb), but nearly all Aboriginal
artists use the simple diamond grids from Fig. 5a.
In this pattern, each diamond is in a special
position of the plane group cmm, on the
intersection of two mirror planes and a 2-fold
axis. Its shape (own symmetry) corresponds to this
site symmetry (Fig. 5a). When the diamond is
DIAMOND PATTERNS IN ABORIGINAL BARK PAINTINGS 9
symmetrically divided into two halves (Fig. 5b),
each of these is still in (another) special position,
straddling a mirror plane. When it is divided into
four quarters (Fig. 5c), these are in general
positions and, as a consequence, each of them is
asymmetric.
If two opposite edges of a diamond element
have been accentuated by a colour stripe (as done
by the Aboriginal artists in some instances), its
symmetry is reduced to 2-fold rotational only and
the mirror planes are lost. The two simplest
arrangements yield symmetry groups p2 and pgg
(Fig. 5d,e, in which the edge stripes were
enlarged to fill the entire halves of the diamond
field).
We shall see that in the process of colouring,
the Aboriginal artists often made consecutive rows
of diamonds non-equivalent and effectively
separated them from each other by giving them
different colour sequences, symmetries and
periodicities. Each subset of this kind has
symmetry pmm before colouring is applied (Fig.
6a). If two opposite edges of each diamond are
accentuated, subsets with symmetries cmm, pgm
(both with a larger unit mesh) and p2 (Fig. 6b)
result.
A simple extension of groups of symmetry can
be achieved when a change of colour of the
element (ie diamond) acted upon is assigned to
each step of a particular operation of symmetry. A
change of colour from ‘white’ to ‘black’ (and
back in the next step) can be assigned to
translations, centration, or 2-, 4- or 6-fold rotation,
as well as to the reflection and glide-reflection
planes. Such operations are called operations of
antisymmetry and the symmetry groups are called
dichroic or black-and-white, or groups of
antisymmetry. In the case of two-dimensional
404, 444:
(oo CO)
Vee 006
DOO ay
00 4
OO
pmm
FIGURE 6. Two examples on an uncoloured diamond
subset: a, plane group pmm, b, plane group p2.
periodic patterns in plane, 46 plane groups can be
discerned when the above 17 uncoloured plane
groups are not counted. In the symbols the colour-
changing symmetry operators are primed, the
colour-unchanging ones are left unprimed (Figs
3b,g,h).
The above discussed diamond patterns with
symmetries cmm, pmm, pgg, pgm and p2 can yield
a number of dichroic patterns. Examples are given
in Figs 7-9. Several of them will be discussed in
detail here.
Figures 1, 2 and 12-15 show dichroic patterns
in which the diamonds at the vertices of the unit
mesh are coloured in one way (flat colour)
whereas those in its centre are coloured in a
different way (cross-hatched). If these two styles
of colouring are interpreted as black and white,
respectively, this general colour scheme is
identical with that in Fig. 7b. Using the cmm
pattern in Figs 4a and 5a as reference, we can see
that the following symmetry operations became
colour-changing operations: the translation from
the origin to the centre of the unit mesh, the glide-
reflection planes and one half of 2-fold rotation
axes (ie those along the lozenge edges). On the
abe
eee
ane
Cc
eee
cm'm'
cm'm'
FIGURE 7. Dichroic plane groups for selected diamond patterns: a, the basic one-coloured pattern, b, p.mm2 with
special positions, c, cm’m’ with general positions, d, ditto with a special position only.
10 E MAKOVICKY
> 4
999
$99 999
$99 909
Pa2
> 999 Wd
HOY 000 9OO 009
999 999 909
000 999
pm'g
009
pmg cm'm
FIGURE 8. Dichroic colouring of a p2 diamond pattern: a, dichroic plane group p2’, b, p,.2, of the pmg pattern: c,
pm’g, d, pmg’; and of the cmm pattern: e, cm’m.
other hand, the ‘principal symmetry elements’
which enter the group symbol, ie the two systems
of reflection planes, the other half of rotation axes
and the translations along the unit-mesh edges,
remain colour-preserving. Thus, this dichroic
group can be described by the symbol p.mm2?,
where C’ denotes the colour-changing operation
of mesh centration.
On the other side of the spectrum is a cm’m’
pattern (Fig. 7c), in which both systems of mirror
planes and the associated glide-reflection planes
change colour on reflection, whereas the
centration vector and all 2-fold rotation axes (cf
Fig. 5c) preserve the colour of elements they act
upon. Pattern in Fig. 7c shows general positions
for this group; that is, each lozenge is cut up into
four parts which do not lie on any symmetry
elements and could even be moved apart as in
Fig. 4d of the uncoloured parent group. The
colour of special positions, on m’ planes or on
2m’m’ intersections, can be obtained by lumping
the appropriate two or four quarters together and
averaging their colour. They will be grey, with
both black and white components present at the
same time, and therefore will remain unchanged
even if subjected to colour-changing operations of
symmetry (Fig. 7d).
As a final example, the two simplest dichroic
colourings of the p2 pattern shown in Figs Se and
6b result in the patterns in Fig. 8a,b. In the first
644 406 60404 60406
90% 699
44 904 4
044
Ppamm
poe 0590
40% 40004
909 000% 99000
PpmmM
camm
FIGURE 9. a, monochroic and b-d, dichroic, colouring of the pmm diamond subset; b, p,.mm, ¢, p,mm and d,
c mm.
a
DIAMOND PATTERNS IN ABORIGINAL BARK PAINTINGS 11
case all 2-fold axes become colour-changing,
resulting in symmetry p2', whereas in the second
case only half of their set will represent colour-
changing operators. The latter case can be
conveniently described as a doubling of one of
the unit-mesh edges by a colour-changing
translation, in this case as p_.2. The cases based
on the plane groups pmg and cmm give a broader
spectrum of dichroic colouring (Fig. 8c-e).
A rectangular pmm example in Fig. 9a that can
be coloured by a two-coloured translation b’ or a’
as p,mm or p,mm (Fig. 9b,c) leads towards a
generalisation of this process for more than two
colours, and to the simplest type of coloured
groups of symmetry in which colours of all (or
selected) elements of a pattern change periodically
along one translation direction. Along this colour-
modulation direction the fundamental translation
of the pattern will change to its n-tuple for the
sequence of n colours involved.
Thus, trichroic modulation of the pmm pattern
of diamonds will result in a trichroic plane
symmetry group with a tripled b-translation (Fig.
10). If we study the chromaticity (colour action)
of mirror planes perpendicular to the colour-
modulated b direction as well as that of 2-fold
axes, we find that it is only partial for this case.
These symmetry elements alternate only two
colours, leaving the third one unchanged. The
resulting plane group symbol is correspondingly
complicated, p,°’mm?"2%". Superscripts in round
brackets indicate the number of permutated
colours and, following the comma, the number of
unchanged colours. When ignoring the symmetry
of the underlying pattern, this plane group can be
simplified to p,%m1; in this case the colour
scheme employed is presented as simple vertical
FIGURE 10. Trichroic modulation of the pmm diamond
subset; trichroic plane group p,9mm?)22.
6494904
9444044
4444444
4444404
Ppmm
FIGURE 11. Diamond pattern from a crocodile’s back.
Gumatj bark painting. Colouring of diamonds is
interpreted by a dichroic plane group.
colour stripes overlying the correspondingly
coloured diamonds. Extension of the dichroic
c,mm principle in Fig. 9d to more colours is much
more complicated; it can be seen, for example, on
the cross-hatched diamonds of the drawing in Fig.
17f.
CLASSIFICATION OF OBSERVED DIAMOND PATTERNS
The observed diamond patterns can be
classified according to the following properties of
the colouring schemes employed by Aboriginal
artists:
i) maximally two colours, black and red are
used for flat-coloured diamonds, plain white
being consistently avoided; the flat-coloured
diamonds are either all of one colour or they
are simply two-colour modulated
ii) one to three colours have been used for the
cross-hatched diamonds — either the vector
of the colour-modulation wave is parallel to
the b axis, or the wave is diagonal to the two
axes of the pattern; in rare cases, the colour
modulation vector is parallel to the a axis.
The resulting classification is given in Table 1.
THE OBSERVED SYMMETRY GROUPS
As remarked earlier, the entire body of coloured
diamond patterns suggests that, on the whole, the
flat-coloured and the cross-hatched subsets are
treated independently from each other. Their
12
E MAKOVICKY
TABLE 1. Colouring schemes observed for the two component subsets in the Aboriginal diamond patterns.
Colour type
Flat-coloured
Flat-coloured
Flat-coloured
Cross-
hatched
Notes:
a axis runs parallel to the long diagonals of diamonds.
Polychroism*
(colour index)
Mesh size*
& type
axb
P
ax 2b, p
ax 4b, p
ax3b
P
ax 6b
Pp
2a x b,p
2a x 2b, p
2a x 2b,c¢
2a x 4b, c
3a x 3b, p
Wave-vector of colour
modulation and coloured
plane group
wave-vector undefined
pmm
P,Omme220)
wave-vector undefined
pmm
P,Omm? )Q21)
b
Pypymm2
a
a
p,mm
diagonal
diagonal
Cc % mm
diagonal
(3) G)Q(21)
Py b 2
b axis runs parallel to the short axis of diamonds, at 90° to the a axis.
Colour index indicates the number of alternating colours. Mesh size is expressed in terms of the fundamental,
uncoloured periodicities. Wave-vector of a colour modulation wave is a vector perpendicular to the consecutive
coloured rows; its length is equal to that of a complete colour permutation. Coloured plane groups are explained in
the text.
Expansion by
intervening neutrally
coloured stripes of
diamonds parallel to a
yes
Expansion by intervening, neutrally coloured (in the observed cases white) stripes of lozenges parallel to the a
axis always expands the b parameter by two fundamental b lengths.
first colouring stage, see text.
pattern.
coloured plane groups are summarised in Table 1. a)
From the symmetrological viewpoint, only the
three simplest combinations of flat-coloured and
cross-hatched diamonds can be treated as one
whole; artists might have done it for these simple
cases as well:
For the special case of a sequentially dichroic sequence, with the a axis expanded by the white diamonds of the
One more (neutral) colour, which is not counted into the colour index of the colour group, is present in the
The simplest colouring of the diamond
pattern, in which both the flat-coloured and
the cross-hatched components have only one
colour each (Fig. 16a) can be described, as
was done in the section on symmetry, by
means of the dichroic plane group p.mm2.
i)
DIAMOND PATTERNS IN ABORIGINAL BARK PAINTINGS
~
“‘Aydioy “H JO ASOUNOD “SL61
‘ues eduepeyy oy) Jo Joquiou ev Aq Sunured yeg “¢] FUNOLA
Qo
Hwee
ay)
WAY WA
be
aes
_ aera
ML TA
ry
men
H (
foy {Ee Oa() On
“Kydioyy “H JO Asaqyinod “¢ 6] ‘Uejo Nsuemypeyg oy) Jo Joquiowi ve Aq Sunured yueg ‘7] FUNOIA
E MAKOVICKY
14
}
0 ASOUINOD “SL 6] ‘URIS HeUNH oy} Jo Joquiow e Aq ssunuied yIeg “S| FUNOI
“Ayo “H
Za
“Aydiop “H
‘uejo Heuuny oy} Jo Joquiow ev Aq ssunured yeg “pl FUNOIA
15
DIAMOND PATTERNS IN ABORIGINAL BARK PAINTINGS
‘(Heuny) (ysou yun ay} JO 10}99A
g- dy) JO pud ay} puke 10199A PB ay} Jo puda oy uLds syUOIJaARM aT) (O[[) BARA
POANOJOD-dOAY} B YM (Zio (gy @ pure ‘urur“d | s(Hewuny) (2) ut,,)'d pasnojoo
3 : 9 dnois sued
asqns poyorey-
vuiny ‘aouonbes aye e
SSOID OY] JO J[EY SYM-UOU DY} IOF W
‘2 (ns
Sjosqns poinojoo-jeyy ayy soy werd
09 SYM SurudsAsojul yi ‘ApIAyoodso1
WN)
\?
\ |
.
i
q
OQ
UY WY as A
Sy bo
OHO.
oo
e
“Ayoaroodsau ‘zur "d
pue quu'd Jf qxyZpqeuly."d usoned pny ‘Zwur“d sjasqns yloq ‘ea :(nuemjeyq
‘p puv fyeuny ‘o ‘eduuepeyy “q) cwur"d waned [pry :hjoanoodsas ‘sjasqns zur 'd
pue wud jo soourjsul JUdIayyIp ‘p-q ‘(nduemjpeyq) 7 owed ppny ‘wud
JOsqns poyorey-sso1d ‘wud sJasqns posNojOd-jeY “@ ‘puey] WOYUy Wayseoy}ou
dy} Wo sulayed puowrip JOJ suONRUIqUIOD SULINO[OD poAtlosqO “91 FAANOl
ry
HOOO4
Wy
AY
On)
Wi
INN
(
rence
HMO
OXY
ONY
OO
WA
4
0
eae
e
\)
q e
16 E MAKOVICKY
b) A monochromatic pattern (Fig. 16b,c,d) (a x
b) of the flat-coloured subset can be
described by the uncoloured plane group
pmm2. However, it can also be incorporated
into the dichroic cross-hatched component
(red- and white-hatched diamonds) of the
pattern as its special positions on colour-
changing mirror planes and 2-fold axes, The
single flat colour can then be understood as a
balanced mixture of two pure, hatched
colours from general positions and therefore
it does not change when translated by the
colour-changing translation 67/2.
Thus, this pattern taken as a whole has the
same dichroic symmetry, p,imm2, as its
cross-hatched portions. The colour-changing
operators are the b/2 translation and the
mirrors and 2-fold axes situated at b/4 and
3b/4.
c) The only other pattern still described by a
single unit mesh and symmetry group is the
dichroic pattern in Figure 16e. In this pattern
both components are colour-modulated, with
the wave vector of the modulation parallel to
the b axis. Each component taken alone
would have symmetry p,.mm2, but the entire
pattern (with the phase shift between the
modulation of the flat-coloured and the
cross-hatched components equal to 1/2 6 of
the underlying a x b lozenge pattern) has
symmetry p,7-’mm°'2"", None of the
components is in a special position in respect
to the coloured translation 6/2.
For all other cases, amalgamation of the two
components of the pattern into one whole either
leads either to a significant loss of the symmetry
information needed to describe the colouring
schemes devised by the Aboriginal artist
(especially the a x 2b modulation of the flat-
coloured component), or yields unrealistically
large repetition periods.
Therefore, separation of the two components of
the pattern is natural to, and the only proper
representation of, the colouring schemes designed
by the Aboriginal painters. The contradiction of
the two subsets creates a pleasant internal tension
(large-scale shimmer) in the pattern, arrests the
eye of the beholder and leads him to an intentional
or unintentional analysis of the not too overloaded
colouring scheme. The pleasure of the colour
contrasts and of the recognition process is similar
to that felt by beholders of good modern abstract
paintings.
The majority of complex patterns in which the
two-coloured subsets have unit cells of unequal
size nearly always display the same mesh and
symmetry for the flat-coloured red and black
subset (a x 2b) p,imm2; the rare exception p,.mm2
is in Fig. 16f. The mesh size and coloured plane
groups differ widely for the cross-hatched subset;
it is primarily the sequences with dichroic
symmetry that are observed. The dichroic plane
groups p,.mm2, p,mm2 (the colour change being
perpendicular to that in the flat-coloured
component in this case) or c,mm2 (eg Fig. 17b)
occur according to the direction of the colour-
modulation wave. Most of them occur in an
expanded version in which the b parameter of the
unit mesh is expanded by the width of two colour-
preserving (‘neutral’) white-hatched diamonds.
The latter represent special positions between
every consecutive, red—black and black—red pair
of lozenges situated in general positions (Fig.
17a,b in the above sequence).
The highest colour index (number of alternating
colours) observed for the cross-hatched
component is three (a white-red—black repetition),
with the colour modulation vector parallel to b. In
Fig. 17e this unit mesh (a x 3b), with the space
group p,°'mm2"" is combined with the
monochromatic flat-coloured mesh (a x b) pmm2.
More difficult is the case of white—black—red—
white-red—black—white—black— (repeat) cross-
hatched sequence attempted in the Gumatj
painting in Fig. 2. The resulting b axis is a
sextuple of the fundamental one: the b/2
parameter is three-coloured and the mirror plane
perpendicular to b at 0 and 1/2 b is uncoloured,
reflecting (ie reversing) the colour sequence.
Thus, the complete description is p,,,\°mm2.
In the already mentioned, rare, trichroic case
from the Gumatj clan (Fig. 17f), the colour
modulation wave is parallel to the diagonal of the
fundamental uncoloured mesh. Its oblique mesh
(a’ x 3b; a’ = a+ b of the fundamental
uncoloured mesh) has symmetry p,°)2", If, as an
alternative, the axes of the hatched pattern are
selected as three-coloured sequences parallel to
the axes of the flat-coloured mesh, the resulting
coloured mesh is rectangular p°),/2°). The
colour modulation vector, perpendicular to the
diagonal modulation wave, is equal to 3b - a of
the fundamental mesh.
THe Usep Versus UNUSED SYMMETRY
COMBINATIONS
Even being limited only to the rectangular and
oblique systems and ignoring, in agreement with
DIAMOND PATTERNS IN ABORIGINAL BARK PAINTINGS 17
the Aboriginal artists, the additional colouring
possibilities which arise in the case when
diamonds turn into squares and the underlying
pattern belongs to the square system, comparison
of the possible colouring schemes (plane groups)
with the actually used ones reveals the very
restricted choice the Aboriginal artists have made.
As we have seen, the fundamental uncoloured
(or one-coloured) lozenge sets have symmetries
cmm, pmm, pgg, pgm or p2. From the first two
plane groups, the following categories of dichroic
plane groups with unchanged basic translation
vectors can be derived: cm’m, cm’m’, p.g8,
P-mm and p..gm from cmm, and pm’m and pm'm’
from pmm. For a doubled a parameter, the plane
groups p,mm, p..mg (and their permutation for
the doubled b parameter), and for doubled a and b
parameters c,mm, can be added. Some of them
are illustrated in Figs 7-9, 16 and 17, and the
remaining ones can be found in Washburn &
Crowe (1998). Whereas c,,mm and p,.mm (or its
rotated version, p,.mm) can occur both with whole
diamonds of one colour or with diamond halves
coloured oppositely, some of the symmetry groups
require symmetric division of each diamond into
two or four oppositely coloured portions (Figs 7,
8). As a rule, such division (known, eg, from the
Acoma Pueblo pottery (New Mexico), Mehinaku
and other tribes in Brazil, and Turkoman carpets
of Central Asia) was almost never attempted by
the Aboriginal artists. Thus, all groups with
colour-changing mirror planes (which may not
transpire from the group symbol because it only
shows the colour-preserving g planes parallel to
them) fall out and we are left with just the three
rectangular plane groups of symmetry described
from bark paintings, ie p mm (p,.mm), p..mm and
c,mm (Figs 7, 9). The only exception, which has
colour-changing mirror planes, is the occurrence
of the overall dichroic group p,%mm®?2°) (Fig.
16e) mentioned above. It is based on the
uncoloured group pmm, and the lozenges in the
central horizontal row of its mesh are non-
equivalent to those situated on the a and b vectors.
It might be better to divide this pattern into two
independent components, both with symmetry
p,mm, in line with the other patterns of the series
and, perhaps, in agreement with the understanding
of its structure by the artist himself.
The trichroic plane groups used by Aboriginal
artists are only of the simplest type. They are
based on a juxtaposition of colour stripes that
results in a unidirectional colour modulation (ie
periodic colouring) of the underlying geometric
pattern. Beside the cases when the modulation
vector is parallel to the axes of the fundamental
mesh (Fig. 17e), the above mentioned more
complicated case of diagonal waves has been
worked out by the Gumatj artist (Fig. 17f).
However, the corpus of potential, but unused,
trichroic combinations is large.
DISCUSSION AND CONCLUSIONS
The present study has examined the
applicability of more exact crystallographic
methods to Aboriginal art studies. Its preliminary
results were summarised in the general paper by
Makovicky (1986) and presented in Perth in 1987.
Since then, some concepts have been revised and
new material added.
The advantages of using plane groups of
symmetry for analysis of larger bodies of
ornaments are indisputable today (Abas & Salman
1995; Makovicky 1989; Makovicky & Makovicky
1977; Makovicky & Fenoll 1997). The description
of coloured ornaments by means of dichroic or
polychromatic groups of symmetry is less
widespread but equally effective (Makovicky
1986; Makovicky & Fenoll 1999; Washburn &
Crowe 1998:63). On the one hand it gives a short-
hand notation for the colouring schemes applied,
and on the other it allows the identification of
colouring sequences built on the same principle,
notwithstanding the colour combinations or
element shapes used. For example, the Aboriginal
colour sequences red—white, black—red and red—
yellow are described by the same dichroic plane
group (Fig. 16e,f), expressing the same colouring
intention as well. Dichroic or polychromatic
groups of symmetry are the best tool for further
analysis of distinct sequences based on the same
underlying pattern, as in the present case.
Symmetrological analysis shows that black, red
and ochre yellow always play a role in colour
alternation/permutation in Aboriginal patterns,
whereas the role of white is varied. It is not used
as a flat colour; in its cross-hatched form it either
represents yet another regular colour (in sequences
such as red—white, black—red—white— (repeat) (Fig.
17e) or red—yellow—white-— (repeat)) or it is the
neutral colour interspaced in colour sequences, in
principle dichroic, such as white—red—white—
black—white-— (repeat), eg Fig. 17a. The latter case
can also be interpreted as a sequentially dichroic
sequence in which the cross-hatched subset is
divided into a white and a non-white subset; the
latter subset is further divided into two distinctly
coloured subsets of diamonds. The second
18 E MAKOVICKY
colouring step can take more fanciful forms — it
can be centred, as in Fig. 17b, or periodic at a
right angle to the first step, as in Fig. 17c. The
rare occurrence of these sequences in Aboriginal
paintings is in contrast to their common
occurrence elsewhere (Makovicky 1986;
Makovicky & Fenoll 1999).
Lack of green and blue earthy pigments
undoubtedly contributed to the four-colour palette
and colour sequences of Arnhem Land artists.
Another technical limitation which might have
played a role in the choice of colouring schemes/
sequences (coloured plane groups) is the size of
bark surfaces available and of the fields into
which they were traditionally divided.
The symmetrological results of the present
study are satisfactory: the artistic canon of the
Yirritja diamond patterns can be successfully and
exactly described by means of coloured symmetry
groups and colour modulation waves. However,
the number of bark paintings available for this
study does not allow us to reach the other goal of
this investigation, that of potentially associating
the distinct colouring schemes with different clans
of the Yirritja moiety. However, the present
investigation has defined all the necessary means
for such a follow-up study based on detailed
investigations in the field and in museum
collections.
What are the preliminary results obtained from
the limited material? At present, it appears that
the Dhalwangu clan uses preferably one- and two-
coloured sequences, resulting in the plane groups
shown in Fig. 16a,c-f; one suggestion of a pmm/
p,°mm®” combination (as in Fig. 17e) was seen.
The version in Fig. 17a with interspaced white
cross-hatch is important, both in the red—black and
red—yellow varieties.
The Madarrpa clan uses similar simple patterns,
such as those in Figs 16b,c,e and 17a. However,
in the work of Wakuthi Marawili in 1982, the
palette explodes into a spectrum of p,°mm®@2%)
sequences for both the flat-coloured and the cross-
hatched subsets. Placing the ‘starting’ block of
one subset next to that of the other subset and
running the colour permutations in the same
directions in both subsets, a very effective colour
scheme has been devised (Caruana 1994: Fig. 56).
A combination of the same flat-coloured 3-fold
sequence as above with a two-coloured white-
interspaced cross-hatched sequence p,.mm rims
this bark painting. The same artist created a panel
with patterns such as those in Figs 16e and 17d
for the Berndt Museum of the University of
Western Australia.
The Gumatj bark paintings contain the most
complicated examples of colouring. Starting with
a monochromatic flat-coloured subset, patterns in
Figs 16a,c and 17e (with stacking faults in the
colouring sequence) are observed. With a bi-
coloured flat-coloured subset, powerfully coloured
versions of Figs 16e and 17a were designed; well
used also is the pattern of Fig. 17c with the two
colour-modulation directions at right angles to
each other. The chessboard-based pattern of Fig.
17d is accompanied by imperfect versions of the
patterns of Fig. 17b,f. A particular type of pattern
reproducing that of a crocodile’s back is in Fig.
11. Faults in three-coloured cross-hatched
sequences are frequent, sometimes making the
interpretation of the depicted panels ambiguous.
Patterns with partitioned diamonds are
infrequent. A rare example with the black flat-
coloured subset possessing a longitudinal partition
and constructed according to the schemes in Fig.
16a,c, and a pattern similar to that of Fig. 17a, but
with one-coloured flat-coloured elements, comes
from the Munyuku clan (Morphy 1979: 304).
Only rare examples were seen of diamond
patterns with diagonally or parallel three-striped
diamonds. A faultless p2' pattern of this type was
painted by J. Wululu, central Arnhem Land
(Yirritja, in Caruana 1994); a mixture of p2' (even
P,,2), and pgm’ (due to faults in colour sequence)
from Gupapuyngu clan (Milingimbi, Arnhem
Land, 1963) is reproduced by Cooper et al (1981).
A similar mixture of p2' and p,.2 is found in a
Gumatj pattern (Fig. 1) from 1959-60; and a
faultless combination of flat-coloured (dotted)
pmm and cross-hatched p2' in a Gupapuyngu
(1948) pattern, both photographed by H. Morphy.
Apparently, these examples are fairly marginal to
the entirely cross-hatched striped sequences of
other clans, eg Marrakulu, Manggalili, Rirratjingu
(Morphy 1981: 63; Caruana 1994: 64-67), as well
as of those from central Arnhem Land.
Although the amount and breadth of material
studied limits severely the validity of our
conclusions, it appears that there exist observable
clan-specific differences in the latitude of designs
used. However, they are easily transcended in the
production of especially talented bark painters,
such as W. Marawili of the Madarrpa clan.
Without doubt, the largest frequency of complex
designs occurs in the paintings by members of the
Gumatj clan. To the contrary, the Dhalwangu
creators of exceptionally powerful turtle paintings
used their basic pattern language to a great
advantage without complicating it by more
complex colour schemes.
DIAMOND PATTERNS IN ABORIGINAL BARK PAINTINGS 19
How old are the diamond designs? Old
examples are rare; the Dhalwangu example from
1952 (Sutton 1990: 21) contains the same
colouring combinations (coloured plane groups)
as the new paintings (Figs 16a,c,e). Other
Dhalwangu examples from 1948 contain the same
patterns. Gumatj painting from 1959 to 1961
contains a pattern of the Fig. 16c type. The
assertion is that the coloured diamond patterns are
traditional (Morphy 1981: 62) and may have had
their origin in contacts with Macassan trepang
fishermen who brought Indonesian utilitarian art
(eg patterned fabrics) with them (Mulvaney 1981:
16). The symmetrological independence of the
northeastern Arnhem Land diamond patterns, and
of their colouring, from the original Macassan
examples is apparent from a perusal of Indonesian
textile patterns, which are largely based on
symmetries other than those used by Arnhem
Land artists.
From a symmetrological point of view, the
majority of studied Aboriginal coloured diamond
patterns have a unique character. In several
cultures a dichroic division of elements into a
white and a coloured subset was common, with
the former left intact and the latter again divided
into two differently coloured subsets. These
patterns were defined as sequentially dichroic by
Makovicky and Fenoll (1999); examples from
different cultures (especially Islamic and Old
Egyptian) are given in Makovicky (1986). The
Amhem Land Aborigines acted differently in most
instances. With the exception of the simplest
patterns, illustrated in Fig. 16b—d, both of the two
primary subsets (ie the flat-coloured and the cross-
hatched) are further dichroically or trichroically
subdivided. Only the cross-hatched sequences in
Fig. 17a—c, with rows of white ‘colour-neutral’
diamonds, were produced by the process of
sequentially dichroic colouring.
In conclusion, with powerful dichroic and
trichroic sequences, Aboriginal artists created a
unique dynamic whole in which the two different
periodicities produce a captivating internal tension
and a wonderfully shimmering colour effect. The
overall impression can be described as two quite
different colour waves transcending the same
complex pattern. They are in contrast to the
simple colouring of the animals, persons and
objects that supply the narrative of the painting.
ACKNOWLEDGMENTS
This contribution was made possible by the
generosity of Prof. Howard Morphy (Australian
National University, Canberra) who shared with the
author his photographic material on bark paintings from
Arnhem Land. Professional help by Mrs Britta Munch,
Mrs Camilla Sarantaris and Mr Ole B. Berthelsen
(University of Copenhagen) was highly appreciated. The
South Australian Museum kindly covered the
publication expenses; Dr Allan Pring and Dr Barry
Craig of that Museum were instrumental in organising
this publication.
REFERENCES
Abas, SJ & Salman, AS 1995. ‘Symmetries of Islamic
Geometrical Patterns’. World Scientific: Singapore.
Caruana, W. 1994. ‘Aboriginal Art’. Thames and
Hudson: London.
Cooper, C. (ed). 1981. ‘Aboriginal Australia’.
Australian Gallery Directors Council: Sydney.
Edwards, R & Guerin, B. 1972. ‘Aboriginal Bark
Paintings’. Rigby Ltd: Adelaide/Sydney.
Klein, C. 2002. ‘Mineral Science’, 22nd edn. John
Wiley & Sons, Inc: New York
Makovicky, E. 1986. Symmetrology of art. Coloured
and generalized symmetries. Computers &
Mathematics with Applications 12B: 949-980.
Makovicky, E. 1989. Ornamental brickwork.
Theoretical and applied symmetrology and
classification of patterns. Computers & Mathematics
with Applications 17: 955-999.
Makovicky, E & Fenoll Hach-Ali, P. 1997. Brick-and-
marble ornamental patterns from the Great Mosque,
and the Madinat-al-Zahra palace in Cordoba, Spain.
I. Symmetry, structural analysis and classification of
two-dimensional ornaments. Boletin Soc. Espanola
de Mineralogia 20: 140.
Makovicky, E & Fenoll Hach-Alf, P. 1999. Coloured
symmetry in the mosaics of Alhambra, Granada,
Spain. Boletin Soc. Espanola de Mineralogia 22:
143-183.
Makovicky, E & Makovicky, M. 1977. Arabic
geometrical patterns — treasury for crystallographic
teaching. Neues Jahrbuch fiir Mineralogie,
Monatshefte 2: 58-68.
Morphy, H. 1979. Yolngu art. Communicating in paint.
Australian Natural History 19: 304-309.
Morphy, H. 1981. The art of northern Australia. Jn C
Cooper (ed). ‘Aboriginal Australia’ pp. 52-65.
Australian Gallery Directors Council: Sydney.
Morphy, H. 1992. From dull to brilliant: The aesthetics
of spiritual power amongst the Yolngu. Jn J Coote &
20 E MAKOVICKY
A Shelton (eds). ‘Anthropology, Art and Aesthetics’. Aboriginal Australia’. George Braziller Publishers:
Clarendon Press: Oxford. New York.
Mulvaney, J. 1981. Origins. In C Cooper (ed). Washburn, D & Crowe, D. 1998. Symmetries of
‘Aboriginal Australia’ pp. 14-27. Australian Gallery Culture, 3rd edn. University of Washington Press:
Directors Council: Sydney. Seattle.
Sutton, P. (ed). 1990. ‘Dreamings: The Art of
SHALLOW-WATER CUMACEAN CRUSTACEA FROM AUSTRALIA AND
LOMBOK (INDONESIA): FAMILIES BODOTRIIDAE AND LEUCONIDAE
U. MUHLENHARDT-SIEGEL
Summary
Twenty species are identified from the families Bodotriidae and Leuconidae from 39 shallow-water
stations around Australia and one location in Indonesia. Of these 20 species, two are possibly
conspecific. One species of the genus Leptocuma has to stay in open nomenclature because of the
poor condition of the specimen. The genus with the most species is Cyclaspis with 11
representatives in the samples. Two of them, Cyclaspis ursulae sp.n. from the exsculpta-group and
Cyclaspis lissa sp.n., are new to science; Cyclaspis strumosa and C. cf. strumosa are also discussed.
A new species of the genus Mossambicuma is described. This genus has been monotypic since Day
(1978) described it from the western Indian Ocean. New species are also described for the genera
Leptocuma, Glyphocuma, Pocrocuma and Bodotria. Only one representative of the family
Leuconidae was found, in Tasmania, extending the distribution of that species, Ommatoleucon
ocularis.
SHALLOW-WATER CUMACEAN CRUSTACEA FROM AUSTRALIA AND LOMBOK
(INDONESIA): FAMILIES BODOTRIIDAE AND LEUCONIDAE
U MUHLENHARDT-SIEGEL
MUHLENHARDT-SIEGEL, U. 2003. Shallow-water cumacean Crustacea from Australia and
Lombok (Indonesia): families Bodotriidae and Leuconidae. Records of the South Australian
Museum 36(1): 21-57.
Twenty species are identified from the families Bodotriidae and Leuconidae from 39
shallow-water stations around Australia and one location in Indonesia. Of these 20 species, two
are possibly conspecific. One species of the genus Leptocuma has to stay in open nomenclature
because of the poor condition of the specimen. The genus with the most species is Cyclaspis
with 11 representatives in the samples. Two of them, Cyclaspis ursulae sp.n. from the
exsculpta-group and Cyclaspis lissa sp.n., are new to science; Cyclaspis strumosa and C. cf.
strumosa are also discussed. A new species of the genus Mossambicuma is described. This
genus has been monotypic since Day (1978) described it from the western Indian Ocean. New
species are also described for the genera Leptocuma, Glyphocuma, Picrocuma and Bodotria.
Only one representative of the family Leuconidae was found, in Tasmania, extending the
distribution of that species, Ommatoleucon ocularis.
U Miihlenhardt-Siegel, Deutsches Zentrum fiir Marine Biodiversitatsforschung, Zoologisches
Institut und Zoologisches Museum, Martin-Luther-King-Platz 3, D 20146 Hamburg.
Manuscript received 9 August 2001.
Following the comprehensive studies of Herbert
Hale from 1928 to 1952 (Hale 1928, 1936, 1937,
1944, 1945, 1948, 1952) on Cumacea from
Australia, very little work was done on these
Crustacea in this region until Tafe & Greenwood
(1996) did their investigations at Moreton Bay,
Queensland.
The family Bodotriidae comprises 31 genera,
five of them endemic to Australian waters. The
Bodotriidae genus with the most species is
Cyclaspis with 118 species, many (46%) of them
described from Australia. Despite the
comprehensive and intensive studies of the
authors mentioned above, even more undescribed
species remain. The descriptions of two of these
are given here. For detailed generic diagnosis and
subdivision of the genus see Tafe & Greenwood
(1996) and for synonyms see Bacescu (1988).
The other genera mentioned in this study are
Bodotria (Atlantic, Indian and Pacific oceans),
Leptocuma (Australia and West Atlantic),
Mossambicuma (Western Indian Ocean,
Mozambique), Glyphocuma_ (Australia),
Picrocuma (Australia) from the family
Bodotriidae and Ommatoleucon (Australia) from
the family Leuconidae.
MATERIAL AND METHODS
Material collected in shallow coastal waters
using a hand net by Prof. Dr. G. Hartmann and
Dr. G. Hartmann-Schréder during their expedition
to Australia September 1975 to February 1976:
Western Australia
WA sample 10, Broome, 10 September, fine
sandy eulitoral
WA samples 14+15, Broome, close to Willie
Creek
WA samples 17+18, Derby, 20 September, silty
lower eulitoral
WA sample 23, Broome, 24 September,
mangroves
WA sample 27, Port Hedland, 27 September,
close to low tide, fouling :
WA sample 28, Port Hedland, 27 September, fine
sand on reef top
WA sample 30, Port Hedland, 28 September, silty
clay, mangroves
WA sample 35, Port Samson, 30 September, sand
and algae, coarse sand and mud
WA sample 37, 7 km east of Dampier, Horsines
Cove, 2 October, shell hash — sand,
mangroves
WA sample 39, Dampier, 3 October, fine sand
eulitoral, in front of tidal flat edge
WA sample 46, 24 km south of Exmouth,
10 October, fine sand, eulitoral, between reefs
WA sample 66, Drummonds, close to Geraldton,
21 October, fine sand
22 U MUHLENHARDT-SIEGEL
WA samples 67+68, Jurien close to Cervantes,
24 October, sand
South Australia
SA sample 126, Port Lincoln, Proper Bay,
4 December, sand and seagrass
SA sample 129, Port Augusta, 6 December,
mangroves, silt and shell hash
Victoria
VIC sample 148, Foster, Port Welshpool,
28 December, mangroves, soft silty sand
VIC sample 165, southern dead end of Clarence
River, near Yamba, 18 January 1976,
brackish water and mangroves.
Additional unidentified material was available
from the South Australian Museum, Adelaide:
Various stations, Noosa R., 40 mesh tow net, June
1940, leg. ISR Munro;
Whiting Ground, Waterhouse Bay, east end
Thistle Island, 4 March 1931, 8 — 8.3
fathoms;
North end Herald Bight, Shark Bay, 3 fathoms,
sand, ‘Isobel’ W.H., 21 November 1945,
submarine light, temperature: 24.22° C;
Whalers Bay, Thistle Is., 3 February 1941,
submarine light, leg. K. Sheard;
Near Pt. Maclaren, Thorny Passage, Whiting
Ground, 3.5 fathoms, 8-8.30 pm, 2 March
1941, submarine light, leg. K. Sheard.
Material collected by Dr. V. Siegel and the
author, shallow subtidal water:
Tasmania
TAS Nubeena, 6 November 1995, soft silty sand
with detritus
TAS Marion Bay, 5 November 1995, fine sand
and sea grass
Queensland
QLD, Lizard Island 1992:
11 November, mangroves, 0.1 m, soft sand
12 November, Turtle Bay, 15 m, sand
13 November, sand, 10 m
14 November, Turtle Bay, 16 m, coarse sand
15 November, Turtle Bay, 15 m, soft sand
17 November, Mermaid Bay, 7-10 m
17 November, sand, 7 m
18 November, North Reef, 19 m, sand
19 November, Lagoon, 7 m, sand
19 November, Watson’s Bay, 17 m, sand
19 November, sand, 2 m
20 November, Pidgin Point, 12 m
20 November, Watson’s Bay, 16 m
21 November, South Reef, 12 m
Material collected by Dr. J. Martens and Dipl.
Biol. U. Heuer:
Indonesia, Lombok, Plankton/Neuston, 9 March
1996, 0-10 cm.
The material is deposited at the Zoological
Museum of the University of Hamburg (ZMH) or
in the South Australian Museum, Adelaide
(SAM).
SYSTEMATICS
Order CUMACEA Kroyer, 1846
Family BODOTRIIDAE T. Scott, 1901
Subfamily BODOTRIINAE T. Scott, 1901
Genus Bodotria Goodsir, 1843
Bodotria cf. biplicata Gam6, 1964
(Figure 1)
Material
Lombok: 1 juvenile male; ZMH K 39930.
Remarks
The juvenile male (1.5 mm in length) has
the pleopods barely developed; the total
length is about half as long as the holotype
(2.7 mm). Its two lateral carinae and the
dorsomedian carina are well marked in the
anterior half, the pitted structure of the
carapace makes the individual similar to B.
pulchella (Sars, 1878). It is differentiated
from B. pulchella by the unsegmented
uropod’s endopod, which makes it likely to
be conspecific with B. biplicata.
Distribution
Japan, Korea and Indonesia.
Bodotria cf. minuta Kurian, 1961
(Figure 1)
Material
Lombok: 1 juvenile female; ZMH K 39929.
Remarks
The juvenile female in the collection has the
uropods’ rami missing. It fits quite well with
Kurian’s (1961) description: carapace without
carinae, first free pereionite small, in the present
female not as free as in adult female, pigment
spots present, as figured by Kurian.
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 23
FIGURE 1: Bodotria cf. minuta juvenile female: habitus
(upper left); scale a: 1 mm. Bodotria cf. biplicata
juvenile male: habitus (lower left), same scale.
Cyclaspis supersculpta male: habitus (upper right);
scale a: 1 mm. Cyclaspis chaunosculpta ovigerous
female (lower centre): H: habitus, U: pleonite 6 and
uropods. Scale a: 1 mm (H), scale b: 0.1 mm (U). b
24 U MUHLENHARDT-SIEGEL
Distribution
Southern India and Indonesia.
Bodotria unacarina sp.n.
(Figures 2 and 3)
Material
WA: 35: 1 subadult male, 1 subadult female, 1
juvenile.
QLD: Lizard Island 1992: Turtle Bay
(15 November, 15 m): 2 juvenile females; Pidgin
Point: 1 subadult male, 1 juvenile female; ZMH K
39931; sand (2m): 3 ovigerous and 2 subadult
females, 1 male, 10 juveniles; SAM C 5996.
Holotype: ovigerous female SAM C 5995a,
SAM C 5995b: extremities of paratype
Paratypes: 2 ovigerous females, 2 subadult
females, 1 male (dissected), SAM C 5996
Leg.: V. Siegel & U. Miihlenhardt-Siegel
Date: 19 November 1992
Locus typicus: Australia, Great Barrier Reef,
Lizard Island, sand (2 m).
Diagnosis
Bodotria with one lateral carina in female,
uropod’s endopod unsegmented, 11 and one
terminal setae on endopod in male, two median
and one terminal setae in female, no scaly
structure on carapace, uropod’s peduncle longer
than endopod in male.
Description
Based on holotype, ovigerous female, 2.2 mm
length in total:
Carapace with a dorsomedian carina and one
lateral carina on each side, proportion length to
height 1.6, length to width 1.2. Pseudorostrum
shorter than length of ocular lobe; siphonal tube
moderately long; dorsomedian line straight;
antennal notch narrow; anterolateral margin
smooth.
Integument granulose; eyes with six lenses. First
free thoracic segment not visible, the second
pedigerous segment longer than following, free
segments combined shorter than carapace, lateral
carina continued on second pedigerous segment,
third to fifth segment with lateral plates.
Abdomen 1 mm in length, a little shorter than
carapace and free thoracic segments combined,
pleonite 6 proportion length to width 1.2.
Description of extremities is based on paratype,
ovigerous female:
First antenna geniculated, basal article longest,
middle article shortest, main flagellum two-
segmented, distally with two aesthetascs and one
seta, accessory flagellum rudimentary, only three
setae visible; mandible pars incisiva with three
teeth, between pars incisiva and pars molaris 11
setae.
Maxilliped 2 long basis, merus outer margin
dilated, carpus and propodus equal in length,
longer than merus, dactylus with stout terminal
seta; maxilliped 3 basis longest article, with short
distal prolongation, not reaching articulation
between ischium and merus; ischium longer than
merus, merus with short terminal prolongation,
carpus distally geniculated, propodus and dactylus
subequal in length, terminal seta stout, exopod
present (not figured).
Pereiopod 1 basis longer than rest of extremity,
carpus second longest article, propodus and
dactylus subequal in length, dactylus half as wide
as propodus, exopod present; pereiopod 2 basis
longer than rest of extremity, covered with hair-
like setae, ischium missing, merus and carpus
equal in length, propodus short, dactylus tapering
with one terminal and two subterminal setae;
pereiopods 3 to 5 similar in shape, the hinder
extremities getting shorter due to diminishing
length of basis; uropod’s endopod unsegmented,
one long and one short seta at inner margin, one
terminal seta, peduncle longer than pleonite 6
(length proportion 1.7) and endopod (length
proportion 1.6), exopod a little shorter than
endopod.
Male with five pairs of well developed
pleopods, 2.8 mm in length, abdomen longer than
carapace and free thoracic segments combined,
pseudorostral lobes meeting in a point in front of
ocular lobe, abdominal segments larger than in
female; proportions of peduncle to pleonite 6 is
1.1, peduncle to endopod 1.2, pleonite 6 length to
width 1.4. Bases of first two pedigerous
extremities longer than in female, uropod’s
peduncle with ten long and seven shorter setae,
endopod with nine spine at inner margin,
additional one terminal and one subterminal spine,
exopod with 11 long plumose setae at inner
margin and one strong terminal seta.
Etymology
The new species is named after its most striking
morphological character, the single lateral carina.
Remarks
Bodotria species with unsegmented uropod’s
endopod, one lateral carina, and proportion of
pleonite 6 length to width close to 1.2, as in the
new species are: B. arenosa (Goodsir, 1843) from
the northeastern Atlantic; B. armata Tafe &
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 25
FIGURE 2: Bodotria unacarina sp.n. ovigerous female: H: habitus female, A1: first antenna, Md: mandible, Mxp2:
maxilliped 2, Mxp3: maxilliped 3, Pl: pereiopod 1, P2: pereiopod 2, P3: pereiopod 3, P4: pereiopod 4, PS:
pereiopod 5, U: pleonite 6 and uropods. Scale a: 1 mm (H), scale b: 0.1 mm (Al, Mxp2, Mxp3, P1, P2, P3, P4, PS,
U), scale c: 0.1 mm (Md).
26 U MUHLENHARDT-SIEGEL
FIGURE 3: Bodotria unacarina sp.n. adult male: H: habitus, subadult male A1: first antenna, Mxp3: maxilliped 3,
Pl: pereiopod 1, P2: pereiopod 2, P3: pereiopod 3, P4: pereiopod 4, P5: pereiopod 5, U: pleonite 6 and uropods.
Scale a: 1 mm (H), scale b: 0.1 mm (Al, Mxp3, P1, P2, P3, P4, PS, U enlarged), scale c: 0.1 mm (U).
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 27
TABLE 1: Comparison of some characters of selected Bodotria species with unsegmented uropod’s endopod,
n.d.: no data.
Bodotria Bodotria Bodotria Bodotria Bodotria
arenosa armata armata
sex male female male
lateral carina 1 1 1
Proportions
pleonite 6 length:width 13 12 1.2
peduncle:pleonite 6 1.7 1.5 1.6
peduncle:endopod 15 1.4 n.d.
pedigerous segment visible? — ? 2}
setae at endopod 4+1 ? 1141
Greenwood, 1996 from Moreton Bay,
Queensland; and B. rugosa Gamé, 1963 and B.
serrata Harada, 1967 from Japan (Table 1). The
new species resembles B. arenosa with respect to
the females’ length proportions of the uropod’s
peduncle to pleonite 6 and endopod, respectively.
It differs from that species in the number of setae
on the endopod. The new species differs from the
geographically close species B. armata in missing
the scaly structure of the integument, and the
length proportions peduncle to endopod and to
pleonite 6. The female’s length proportion of
peduncle to pleonite 6 is 1.5 in B. armata and 1.7
in B. unacarina sp.n., and the proportion of
peduncle to endopod is 1.4 in B. armata and 1.6
in B. unacarina sp.n. The male’s length
proportions of peduncle to pleonite 6 are 1.6 in B.
armata compared to 1.1 in B. unacarina sp.n. The
differences between females of the new species
and B. rugosa are the relatively longer uropod’s
peduncle relative to pleonite 6 and endopod in the
new species. The differences between males of
the new species and B. serrata is the relatively
shorter uropod’s peduncle.
Genus Cyclaspis Sars, 1865
Cyclaspis caprella Hale, 1936
(Figure 4)
Material
TAS: Nubeena: 1 subadult, 2 ovigerous
females; ZMH K 39917.
Remarks
Hale (1936) described the male of his new
species from Yorke Peninsula, South Australia,
and emended the description for the males from
Bodotria Bodotria
rugosa serrata wunacarina n.sp. unacarina n.sp.
female male female male
1 1 1 1
1.3 1.1 1.2
1.2 2S LF 1.1
1.2 1.6 1.6
+ ? - -
24+2 1342 2+1 1141
the same location (Hale, 1944). He mentioned the
females (Hale, 1944) and gave a short description
and a few figures of the females from Kettering,
Tasmania (Hale, 1948). Additional figures of the
females’ extremities are given herein. The species
is easily identified by the anterior ‘horns’ formed
by the acute anterolateral corners, narrow ocular
lobe with terminal eye, pseudorostral lobes not
meeting in front of the ocular lobe, strongly
elevated second pedigerous segment, fourth and
fifth pedigerous segments with a pair of triangular
teeth on dorsum, the first pleonite with a strong
procurved tooth on each side near the dorsal
posterior end. The uropod’s exopod has two
apical mucrones, as mentioned by Hale (1944).
Cyclaspis chaunosculpta Tafe & Greenwood,
1996
(Figure 1)
Material
QLD: Lizard Island 1992: Lagoon (7m): 1
female with developed oostegites; ZMH K 39920.
Remarks
The habitus of the specimen fits quite well
with the figure in Tafe & Greenwood (1996).
Additionally, pleonite 6 and uropods are
figured (Fig. 3). The carapace structure of the
Lizard Island specimens seems to have smaller
sponge-like pits than in the Moreton Bay
specimens.
Cyclaspis cottoni Hale, 1937
(Figure 5)
Material
TAS: Marion Bay: 3 ovigerous females, 4 adult
and 5 subadult males; SA: 126 (Port Lincoln): 1
28 U MUHLENHARDT-SIEGEL
FIGURE 4: Cyclaspis caprella, ovigerous female: H: habitus, Al: antenna 1, Mxp2: maxilliped 2, Mxp3: maxilliped
3, Pl to P4: pereiopod 1 to 4, U: pleonite 6 and uropods. Scale a: 1 mm (H), scale b: 0.1 mm (Al, Mxp2, P2, P3,
P4), scale c: 0.1 mm (Mxp3, P1, U).
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 29
FIGURE 5: Cyclaspis cottoni: H: habitus ovigerous female and adult male, Mxp3: maxilliped 3, Pl: pereiopod 1,
U: pleonite 6 and uropods. Scale a: 1 mm (H), scale b: 0.1 mm (Mxp3 male, Mxp3 female enlarged, male and
female uropods enlarged), scale c: 0.1 mm (female Mxp3, P1, U).
30 U MUHLENHARDT-SIEGEL
ovigerous and 3 non-ovigerous females, 1 male
(broken), 12 juveniles; SA: 129 (Port Augusta):
10 females, 4 males, 2 juveniles; VIC: 148: 1
ovigerous, 6 non-ovigerous and 7 juvenile
females; ZMH K 39918.
Remarks
Hale (1937) described an ovigerous female and
some years later (Hale, 1944) the male. The most
striking characters are impressions at the
termination of the anterior, clear-cut part of the
dorsal carina and waviness of the double posterior
portion of the carapace (Hale 1937; 1944). Hale
stated the close position to C. herdmani Calman,
1904. It differs from that species in uropods’
exopods distally being truncate with two terminal
spines rather than acute as in C. herdmani.
The specimens from Tasmania (Figure 5) show
the female’s uropods’ endopods proximal part
appearing slightly serrated due to the scaly
structure, and having two spines in the distal
part, the exopod with 11 plumose setae at inner
margin.
The male’s endopods’ proximal part has eight
moderate long setae, the distal part being serrated
with two distal spines, acute tip, the exopod with
at least 11 plumose setae at inner margin, and the
peduncle with 10 long plumose setae at proximal
part, and 12 serrated setae at distal part.
Distribution
Extended to Tasmania, South Australia and
Victoria.
Cyclaspis granulosa Hale, 1944
Material
Whiting Ground, Waterhouse Bay, east end
Thistle Island, 4 March 1931, 8.0-8.3 fathoms; 4
males; SAM C 5989.
Remarks
The specimens from the collection of the South
Australia Museum fit quite well the following
characters given for C. granulosa; namely the
roughened structure of the carapace, the shape of
pereiopod 1, and the proportions and armature of
the uropods.
Cyclaspis pura Hale, 1936
Material
Whalers Bay, Thistle Is., 3 February 1941,
submarine light, leg. K. Sheard, 1 large, non-
ovigerous, and 2 subadult females; SAM C 5990.
Remarks
The specimens belong to the ‘levis group’ and
resemble closely the description of C. pura given
in Hale (1936, 1944) in that the uropod’s peduncle
is only a little longer than the rami, without long
setae, and the exopod has two terminal mucrones;
the uropod’s endopod is acute and in the present
material has three marginal serrated spines distally,
proximal part serrated; reticulation of carapace as
figured in Hale’s description.
Cyclaspis supersculpta Zimmer, 1921
(Figure 1)
Material
WA: 46: 4 subadult females, 6 juvenile females,
2 adult males, 15 juveniles; ZMH K 39919.
Remarks
Tafe & Greenwood (1996) described C.
chaunosculpta (see below) as being very similar
to C. supersculpta Zimmer, 1921, only differing
in having (C. supersculpta) or not having (C.
chaunosculpta) lateral bulges on either side of the
median dorsal ridge of the carapace; C.
chaunosculpta with more strongly developed
transverse ridges than in C. supersculpta. Because
of their variability, structures of the carapace are
not reliable characters to separate species, “...since
the ornamentation does not correspond uniformly
with any other obvious distinguishing characters”
(Day, 1978). Nevertheless, the ornamentation of
the carapace is often used to separate species of
the genus Cyclaspis (Tafe & Greenwood, 1996).
To find out whether the two species C.
supersculpta and C. chaunosculpta are synonyms,
more detailed analyses, such as molecular studies,
are necessary.
The present material resembles closely the
figure in Zimmer (1921).
Cyclaspis strumosa Hale, 1948
(Figure 6)
Material
QLD: Lizard Island 1992: Turtle Bay (15 Nov.,
15 m): 1 juvenile female, 1 adult male, 1 juvenile;
Turtle Bay (12 Nov., 15 m): 1 juvenile female, 1
subadult male; sand (7 m): 1 subadult female, 2
juveniles; sand (10 m): 1 juvenile; Pidgin Point: 1
juvenile female; Mermaid Bay: 1 juvenile; ZMH
K 39924.
Remarks
There are only two species described for
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 31
FIGURE 6: Cyclaspis strumosa: H: subadult female (above) and male (below) habitus from lateral, and carapace
from dorsal; female extremities: Mxp3: maxilliped 3, Pl: pereiopod 1, P2: pereiopod 2, P4: pereiopod 4, PS:
pereiopod 5, U: pleonite 6 and uropods. Scale a: 1 mm (H, female and male), scale b: 0.1 mm (Mxp 3, P1, U), scale
c: 0.1 mm (P2, P4, P5).
32 U MUHLENHARDT-SIEGEL
Australian waters with an undulated dorsomedian
line in the frontal lobes region: Cyclaspis rudis
Hale, 1948 and C. strumosa Hale, 1948. Neither
species is included in the determination key
presented by Tafe and Greenwood (1996). C.
rudis is among others characterised by a scaly
structure of the carapace’s integument. The
specimens from Lizard Island resemble in most
respects C. strumosa. The juvenile female’s
outline (total length 2.7 mm) from dorsal view
with a swollen posterior part of the carapace given
in Hale (1948) is different from the outline of the
non-ovigerous female (total length 4.75 mm) from
Lizard Island. The female’s extremities are figured
herein. They resemble — aside of the sexual
differences typical for males like stouter basis in
first pereiopod, and more setae at uropod’s
peduncle and endopod’s inner margin — those of
the male given by Hale (1948). The inner and
outer margins of pereiopods 1 and 2 are not
serrated as in Hale’s figures.
Cyclaspis cf. strumosa Hale, 1948
(Figure 7)
Material
QLD: Lizard Island 1992: Mermaid Bay (7 m):
2 males; ZMH K 39925.
Description
Based on adult male, 4.3 mm in length.
Carapace 1.3 mm in length; ocular lobe wide,
reaching tip of pseudorostral lobes; pseudorostral
lobes not meeting in front of ocular lobe; siphonal
tube very short; antennal notch narrow, subrostral
tooth not acute; mediodorsal line a little
undulated; free thoracic segments short, combined
0.7 mm in length, the last two with dorsal hump;
abdomen 2mm in length, longer than carapace
and free thoracic segments combined; pleonite 6’s
proportion length to width 1.7.
First antenna basal article a little geniculated,
longer than following two articles combined;
accessory flagellum missing, main flagellum two-
segmented, its basal article more than twice as
long as distal, two terminal aesthetascs; second
antenna reaching end of body; mandible with four
teeth at pars incisiva, 12 long and strong setae
between pars incisiva and pars molaris.
Maxilliped 3 basis longer than rest of extremity,
distal prolongation over articulation merus to
carpus, ischium longer than body of merus, merus
with wide and long distal prolongation reaching
articulation carpus to propodus, carpus distally
widened, as wide as length of propodus, dactylus
short with stout terminal seta, exopod present;
pereiopod 1 basis longer than rest of extremity,
propodus second longest article, exopod present
(not figured); pereiopod 2 basis subequal to rest
of extremity, merus subequal in length to carpus,
carpus with three outer distal serrated setae,
propodus shorter than dactylus, the latter with two
short and one distal setae, which is longer than
dactylus; pereiopods 3 to 5 similar in shape, basis
shorter than rest of extremities, merus to propodus
subequal in length, dactylus short, distal seta at
propodus at least equal in length to dactylus and
its terminal seta combined; uropod’s peduncle
equal in length to pleonite 6, a little longer than
unsegmented endopod (length proportion 1.1), 13
plumose setae at inner margin of peduncle and
endopod as well, both rami with acute tip, no
terminal seta.
Female unknown.
Remarks
The specimens from Lizard Island resemble the
species described by Hale (1948), but differ from
the described adult male in basis, merus and
carpus of pereiopod 1 and 2, and uropods’
endopods having no serration.
Cyclaspis cf. agrenosculpta Tafe & Greenwood,
1996
(Figure 8)
Material
QLD: Lizard Island 1992: Turtle Bay (15 m,
sand): 1 subadult and 1 juvenile female; Watson’s
Bay (17 m): 1 female with developed oostegites;
ZMH K 39921.
Remarks
Female (subadult, total length 7.62 mm) from
Watson’s Bay, with right uropod’s endopod’s
subacute tip a little damaged, inner margin
serrated with nine hyaline ‘teeth’; exopod with 11
plumose setae, subacute tip, rami equal in length,
longer than peduncle, length proportion peduncle
to rami 0.78, length proportion peduncle to
pleonite 6 is 0.81; these specimens from Lizard
Island differ from those described by Tafe &
Greenwood (1996) in having uropod’s rami equal
in length instead of exopod longer, and peduncle
shorter instead of longer than rami and pleonite 6,
respectively, in Moreton Bay specimens. Habitus,
shape of first and second pereiopods, sculpturing
of carapace and structure of integument are the
same in Lizard Island and Moreton Bay females,
so they seem to be conspecific. Additional figures
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 33
FIGURE 7: Cyclaspis cf. strumosa male: H: habitus, Md: mandible, A1: first antenna, Mxp3: maxilliped 3, P1:
pereiopod 1, P2: pereiopod 2, P3: pereiopod 3, P4: pereiopod 4, PS: pereiopod 5, U: pleonite 6 and uropods, left
exopod and right endopod figured. Scale a: 1 mm (H), scale b: 0.1 mm (A1, Md, P2, P3, P4, P5), scale c: 0.1 mm
(Mxp 3, Pl, U).
34 U MUHLENHARDT-SIEGEL
FIGURE 8: Cyclaspis cf. agrenosculpta subadult female: H: habitus, Mxp2: maxilliped 2, Mxp3: maxilliped 3, P1:
pereiopod 1, P2: pereiopod 2, P3: pereiopod 3, P4: pereiopod 4, PS: pereiopod 5, U: pleonite 6 and uropods. Scale
a: 1 mm (H), scale b: 0.1 mm (Mxp2), scale c: 0.1 mm (Mxp 3, P1, P2, P3, P4, P5, U), scale d: 0.1 mm (uropod’s
endopod enlarged).
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 35
of maxilliped 2 and 3, and pereiopods | to 5 are
given herein (Fig. 8).
Cyclaspis lissa sp.n.
(Figures 9 and 10)
Material
1 juvenile male, 12 juveniles; WA-27: 1
subadult female, 1 subadult male, 4 juveniles;
WA-28: 2 juvenile specimens; WA-39: 2 subadult
males, 1 subadult female, 2 juveniles; WA-66:
holotype: 1 ovigerous female, paratypes: 1
ovigerous female, 2 males, additional specimens:
5 ovigerous and 20 subadult females, 2 adult and
6 subadult males, 24 juveniles; WA-67+68: 1
subadult female; ZMH K 39926. WA-10: 4
ovigerous females, 3 subadult and 5 juvenile
females; SAM C 6078.
Holotype: female ZMH K 39927, K 39928:
extremities of paratypes female and male
Leg.: G. Hartmann & G. Hartmann-Schréder
Date: 21 October 1975
Locus typicus: Western Australia, Drummonds,
close to Geraldton, fine sand
Paratypes: 1 female used for dissection, 1 male,
1 male used for dissection.
Diagnosis
Cyclaspis with no ridges, pits or tubercles on
the carapace in female, in male no distinct humps
near the dorsal end of carapace, no granular
structure on the carapace; very short pseudorostral
lobes hardly meeting in a point in front of the
ocular lobe; basis of pereiopod 1 without distal
tooth and longer than the rest of extremities;
uropod’s peduncle longer than pleonite 6, and
longer than exopod; uropod’s exopod slightly
longer than endopod; uropods’ rami ending with
acute tips, no terminal setae or mucrones.
Description
Based on holotype, ovigerous female, total
length 3.4 mm.
Carapace smooth, dorsomedian carina present,
not pronounced; pseudorostrum very short,
meeting in a point in front of ocular lobe; siphonal
tube short; antennal notch very small, small
subrostral tooth acute; integument calcified;
ocular lobe present. Four thoracic segments visible
from above, first segment visible in ovigerous
female only from lateral, free thoracic segments
nearly half as long as carapace; abdomen as long
as carapace and thoracic segments combined;
pleonite 6 is 1.4 times longer than wide, shorter
than uropod’s peduncle.
Description of extremities based on paratype,
ovigerous female.
Maxilliped 2 basis longer than rest of extremity;
merus, carpus and propodus of similar length,
dactylus shorter, with stout terminal seta;
maxilliped 3 with exopod, geniculated basis
longest article, with distal process reaching joint
merus to carpus, ischium short, merus with distal
process reaching joint carpus to propodus, carpus
widened, propodus stout, shorter than carpus, with
two terminal setae, dactylus short and stout with
stout terminal seta, two subterminal setae.
Pereiopod 1 basis slender, longer than rest of
extremity, merus a little longer than ischium,
carpus and propodus subequal in length, both a
little longer than merus, dactylus slender with one
terminal and two subterminal slender setae,
exopod present; pereiopod 2 basis shorter than
rest of extremity, ischium short, merus second
longest article, dactylus subequal in length to
merus, with one terminal and two subterminal
setae; pereiopod 3 basis about as long as rest of
extremity, ischium a little shorter than merus, both
articles combined a little shorter than carpus,
propodus as long as merus, dactylus slender,
similar to terminal seta of propodus; pereiopod 4
basis shorter than rest of extremity, carpus second
longest article, dactylus half as long as terminal
seta, both combined as long as terminal seta of
propodus; pereiopod 5 carpus second longest
article after basis, dactylus as long as terminal seta
of propodus. Uropod’s peduncle without spines at
inner margin, longer than exopod, unsegmented
endopod shorter than exopod; both rami with
acute terminal ending; endopod with 6 serrated
spines, exopod with 6 setae at inner margin.
Male: Pseudorostral lobes hardly meeting in a
point in front of ocular lobe. Male has developed
pleopods of same length as holotype; carapace
shorter than in female, abdomen longer than
carapace and free thoracic segments combined,
four pedigerous thoracic segments visible.
Male’s extremities differ from female’s —
extremities are longer and basis of pereiopod 1
stouter. Uropod’s peduncle 1.7 times longer than
pleonite 6, inner margin with 18 plumose setae,
exopod longer than endopod, the latter with 11
short and proximally with two long setae.
Etymology
The new species is named after the smooth
structure of the carapace.
Remarks
Many species of the genus Cyclaspis have no
36 U MUHLENHARDT-SIEGEL
aa
FIGURE 9: Cyclaspis lissa sp.n. ovigerous female: Mxp2: maxilliped 2, Mxp3: maxilliped 3, Pl: pereiopod 1, P2:
pereiopod 2, P3: pereiopod 3, P4: pereiopod 4, P5: pereiopod 5, U: pleonite 6 and uropods. Scale a: 1 mm (H),
scale b: 0.1 mm (Mxp2, Mxp3, P1, P2, P3, P4, PS, U).
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 37
FIGURE 10: Cyclaspis lissa sp.n. adult male: H: habitus, Mxp3: maxilliped 3, P1: pereiopod 1, P2: pereiopod 2,
P3: pereiopod 3, P4: pereiopod 4, P5: pereiopod 5, U: pleonite 6 and uropods (the two long ‘setae’ between the
uropods peduncles belong to the antenna’s flagella). Scale a: 1 mm (H), scale b: 0.1 mm (Mxp3, P1, U), scale c:
0.1 mm (P2, P3, P4, PS).
38 U MUHLENHARDT-SIEGEL
ridges, pits or tubercles on the carapace, Hale
(1944) erected a key to these species in his
section 1. In this section he separated the ‘picta
group’ with eyes developed and_ the
pseudorostral lobes meeting for an appreciable
distance in front of the ocular lobe, and the ‘levis
group’ with pseudorostral lobes barely or not
meeting in front of the ocular lobe. Tafe &
Greenwood (1996) followed him in their
emended key. Thirty-five Cyclaspis species with
a smooth carapace are currently known. Only
two species out of these have the following
character combination as in the species described
above:
1) uropods’ rami ending with acute tips, no setae
or mucrones
2) very short pseudorostrum or pseudorostral
lobes hardly meeting in front of ocular lobe
3) uropod’s peduncle longer than pleonite 6
4) uropod’s peduncle longer than exopod
5) uropod’s exopod longer than endopod
6) basis of pereiopod | without distal tooth and
longer than the rest of extremities.
The combination of these characters is given in
Cyclaspis sheardi Hale, 1944. The new species is
close to C. sheardi because of the terminal seta of
pereiopod 2 being longer than dactylus in both
species. It differs from C. sheardi in not having
distinct humps near the dorsal end of carapace in
males, and in the absence of a granular structure
on the carapace. The pseudorostral lobes in males
in C. sheardi are very short but clearly meet in
front of carapace, whereas they hardly do in C.
lissa sp.n.
Cyclaspis ursulae sp.n.
(Figures 11 and 12)
Material
WA: 23: 2 subadult females, 1 adult and 1
subadult male, 8 juveniles; WA-30: 28 juveniles;
WA-37: 1 ovigerous and 1 subadult female, 1
adult and 7 subadult males, 17 juveniles; ZMH K
39923. WA- 4415: 2 subadult females, 1 subadult
male, 4 juveniles; SAM C 6079.
Habitus: ovigerous female holotype, subadult
and adult male
Extremities: WA-23 adult male total length
5.4mm, pleon damaged; WA-14+15 female with
developing oostegites, only carapace to first
pleonite, carapace length 1.6 mm.
Holotype: ovigerous female ZMH K 39922a,
ZMH K 39922b: extremities of paratypes
Leg.: G. Hartmann & G. Hartmann-Schroder
Date: 2 October 1975
Locus typicus: 7 km east of Dampier, Horsines
Cove
Diagnosis
Cyclaspis with quadrilateral area on each side
of the carapace defined by ridges, the anterior
transversal ridge not crossing the frontal lobe of
the carapace of the female, pitted carapace
structure in female, unsegmented uropod’s
endopod acute, uropod’s exopod with two distal
spines.
Description
Based on the holotype, 5.6 mm length in total.
Carapace seen from lateral with two transverse
ridges, the anterior not crossing the frontal lobe,
but turning backwards to meet the two ‘horns’
reaching forwards, formed by posterior ridge; seen
from dorsal transverse ridges do not cross
dorsomedian ridge but run parallel to it in
posterior part; pseudorostral lobes do not meet in
front of elongated ocular lobe; siphonal tube
short; dorsomedian line a little pronounced;
antennal notch small, anterolateral margin smooth,
anteroventral margin of carapace smooth,
integument reticulate, well calcified; eyes present;
four free thoracic segments visible, the first of
them (second pedigerous segment) with dorsal
prolongation, carapace and free thoracic segments
combined 2.81 mm in length.
Abdomen about same length as carapace and
free thoracic segments combined, with lateral
articular processes and dorsally a faint ridge
reaching the fifth pleonite; pleonite 6 shorter than
peduncle of uropod, length proportion of peduncle
to pleonite 6 is 1.38.
Description of extremities based on paratype
(WA-14+15) subadult female, carapace and free
thoracic segments combined 2.53 mm in length,
abdomen missing.
First antenna basis only a little geniculated,
longer than two following articles, outer margin
hairy, distal article second longest; main flagellum
two-segmented with four aesthetascs and two
short setae, accessory flagellum short, less than
half as long as main flagellum’s basal article, with
two short setae. Maxilliped 2 basis longer than
rest of extremity, distal inner part with one strong
spine, merus distal inner part with one long
plumose seta reaching distal end of carpus; this
article second longest, at inner margin four strong
plumose setae; propodus with four pairs of
plumose (only one row figured) setae at inner
margin, dactylus short with strong terminal spine;
maxilliped 3 basis a little geniculated, distal outer
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 39
FIGURE 11: Cyclaspis ursulae sp.n. ovigerous female: H: habitus, subadult female Al: antenna 1, Mxp2:
maxilliped 2, Mxp3: maxilliped 3, Pl: pereiopod 1, P2: pereiopod 2, P3: pereiopod 3, P4: pereiopod 4, PS:
pereiopod 5, U: pleonite 6 and uropods. Scale a: 1 mm (H), scale b: 0.1 mm (Mxp3, P1, P2, P3, P4, U), scale c:
0.1 mm (Al, Mxp 2, Mxp 3 distal part, PS).
40 U MUHLENHARDT-SIEGEL
FIGURE 12: Cyclaspis ursulae sp.n. male: H: habitus subadult (left) and adult (right) male, subadult male A1:
antenna 1, Mxp2: maxilliped 2, Mxp3: maxilliped 3, Pl: pereiopod 1, P2: pereiopod 2, P3: pereiopod 3, P4:
pereiopod 4, PS: pereiopod 5, U: pleonite 6 and uropods. Scale a: 1 mm (H), scale b: 0.1 mm (Mxp3, P1, P2, P3,
P4, U), scale c: 0.1 mm (Al, Mxp 2, Mxp 3 distal part, P5).
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 4)
prolongation reaching distal third of merus,
prolongation with ten plumose setae; merus outer
distal prolongation reaching articulation carpus to
propodus; carpus second longest article with
strong simple spine at outer and plumose seta at
inner distal margin, propodus a little longer than
dactylus, dactylus with four terminal spines, one
of them strong; exopod present.
Pereiopod 1 basis subequal in length to distal
articles combined, ischium equal in length to
merus, propodus second longest article, slender
dactylus a little shorter than carpus, with three
terminal setae, one of them stronger; exopod
present. Pereiopod 2 basis longer than rest of
extremity, ischium missing, merus second longest
article, carpus with one strong distal seta, dactylus
longer than carpus, with one strong terminal seta
more than twice as long as dactylus, and two
subterminal setae.
Pereiopod 3 basis shorter than rest of extremity,
ischium with two distal setae, one of them
reaching beyond articulation carpus to propodus,
metus and carpus equal in length, carpus with two
distal setae, two of them reaching to tip of
dactylus’ strong terminal seta. Pereiopod 4 similar
to pereiopod 3. Pereiopod 5 basis shorter than rest
of extremity, ischium with two long distal setae,
merus with one strong distal spine, carpus with
three distal setae, two of them reaching further
than dactylus’ strong terminal seta.
Uropod’s peduncle longer than pleonite 6, and
1.4 times longer than endopod, inner margin with
seven or eight simple setae, endopod with three
setae at proximal part of inner margin, distal part
serrated and with five or seven spines, tip
subacute; exopod longer than endopod, inner
margin appearing serrated due to scaly structure,
one long and one shorter terminal seta.
Adult (5.1 mm in length) and subadult (4.6 mm
in length) males (WA-37).
Carapace smooth in adult, sculptured in female
as in subadult male, pleonite 6 shorter than
uropod’s peduncle.
Description of extremities based on male
paratype (WA-23). First antenna as in female but
first article of peduncle longer and more slender,
accessory flagellum minute with three
aesthetascs.
Maxilliped 2 as in female, basis with one,
propodus with additional two strong plumose
setae, carpus with plumose setae at outer margin;
maxilliped 3 as in female; pereiopod 1 as in
female, basis with 5 spines; pereiopod 2 as in
female, basis longer and more slender; pereiopods
3 to 5 as in female; uropods, aside from sexual
differences (numerous setae at inner margins of
peduncle and rami), as in female.
Etymology
The species is named in memory of Ursula
Heuer, the co-collector of the material from
Indonesia.
Remarks
The new species and the three species
mentioned before belong to the exsculpta-group
of section 2 (Hale, 1944; Tafe & Greenwood,
1996). This group contains 18 species with a
quadrilateral area on each side of the carapace
defined by ridges or tubercles, distinct and
depressed in females, often indistinct in males
(Tafe & Greenwood, 1996). This group can be
extended by two species, C. strumosa and C.
rudis. From these species only males or young
females are known; the females might show the
typical transverse folds while the males have
carapace structures like males of other species of
the exsculpta-group. Within the exsculpta-group
there is a species subgroup with very similar
characters: C. chaunosculpta Tafe & Greenwood,
1996, C. persculpta Calman, 1905, C.
supersculpta Zimmer, 1921, C. tribulis Hale,
1928, C. exsculpta Sars, 1887, C. usitata Hale,
1932, and C. alveosculpta Tafe & Greenwood,
1996.
A comparison of characters of selected species
within the exsculpta-group is given in Table 2,
not including species with big lateral horns as in
C. aspera Hale, 1944 and C. bovis Hale, 1928,
and species with aberrant ridges at carapace like
C. australis Sars, 1887, C. indoaustralica
Bacescu, 1992 and C. similis Calman, 1907.
The new species resembles C. ornosculpta Tafe
& Greenwood, 1996 from Moreton Bay,
Queensland. The main character differing between
the two species is the anterior transverse ridge not
crossing the frontal lobe of the carapace of the
female in C. ursulae sp.n.
Genus Mossambicuma Day, 1978
Mossambicuma victoriae sp.n.
(Figures 13 and 14)
Material
VIC: 165: 2 females, 2 males, 1 exuvia; ZMH
K 39934. 1 male; SAM C 6080.
Holotype: ovigerous female; ZMH K 39932,
ZMH K 39933: extremities of paratypes
42
U MUHLENHARDT-SIEGEL
TABLE 2: Character comparison of the exsculpta-group of the genus Cyclaspis. C: carpus, M: merus.
Exsculpta-group C. C. C3 C. C. C.
agrenosculpta alveosculpta candida chaunosculpta ursulae n.sp ursulae n.sp
female and adult male
subad. male
uropod’s endopod bluntly pointed acute acute acute acute acute
uropod’s exopod acute acute or acute acute spine 2 spines
tiny mucro
longest ramus exopod equal exopod equal exopod exopod
Length proportion
peduncle:pleonite 6, male 1.3 0.9 1.2 0.8 1.3 1.4
peduncle:pleonite 6, female 1.0 0.7 - - 1.4 -
peduncle:endopod, male 1.1 0.8 about | 0.8 1.2 1.2
peduncle:endopod, female 1.1 0.7 - - 1.4 -
setae at endopod, male 11 short, 21 13 spines, plumose 9 spines, 4 long, 4 long,
long plumose 27 long setae 12 plumose 15 short 17 serrated
setae at endopod, female 1 stout, 11 short - - 3 long, -
7 short 7 spines
pereiopod | C longer M C longer M - C longer M C longer M C longer M
no. of spines at basis, male 18 27 0? 21 - 5
long setae at pereionites 3 to 5 no 3to5 3 and 4 3 and 4 3 to5
structure of carapace reticulate reticulate 2 pitted, sponge pitted reticulate
like
Carapace ridges
transverse in female 2 2: - 2, first not 2, not meeting 2 lateral, |
pronounced on frontal lobe from dorsal
transverse in male 2 - 2? - - no
longitudinal - humps in - one hump in - 1 pair
female both sexes
dorsomedian carina present present o present present present
Exsculpta-group C. supersculpta C. Cc. Cc. Cc: C.
WA 46 supersculpta exsculpta mawsonae tribulis usitata
uropod’s endopod acute acute acute acute acute acute
uropod’s exopod acute acute mucro acute acute acute
longest ramus subequal equal equal exopod equal equal
Length proportion
peduncle:pleonite 6, male 1 - 0.6 1.2 - -
peduncle:pleonite 6, female 0.8 0.4 ~ - 1 0.8
peduncle:endopod, male 0.9 - 0.6 1.1 - -
peduncle:endopod, female 0.8 0.6 - - 1 0.9
setae at endopod, male 7 spines, 7 teeth, - 4 short, 7 short, 22 ~ -
28 plumose 13 long long plumose
setae at endopod, female 5-6 hairy setae serrated margin - - 14 short spines? 7 short spines
pereiopod | C longer M C equal to M C longer M C longer M C longer M C longer M
no. of spines at basis, male ¥5 M 0 0 0 0
long setae at pereionites 3 and 4 3 and 4 3 and 4 3.00 no no
structure of carapace - reticulate reticulate reticulate reticulate reticulate
Carapace ridges
transverse in female - 2 - - 2 2
transverse in male - - 2 1? > -
longitudinal - - 2 pairs 1 pair 1 pair -
dorsomedian carina =; present present present present present
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 43
TABLE 2: (continued)
Exsculpta-group C. C: G CG: C; C.
elegans ornosculpta prolifica persculpta rudis strumosa
uropod’s endopod acute acute acute acute acute acute
uropod’s exopod spine with spine ? acute acute acute
longest ramus subequal exopod exopod? equal equal endopod
Length proportion
peduncle:pleonite 6, male 1.0 1.1 - - 1 1.1
peduncle:pleonite 6, female 0.8 1.1 - 0.8 - -
peduncle:endopod, male 1. 1:3 - - 0.67 0.9
peduncle:endopod, female 0.9 1.4 1.0 0.8 - -
setae at endopod, male 18 plumose 7 spines, ? - 4 setae, 12 2 stout, 10
12 plumose long setae _ slender, serrated
setae at endopod, female serrated, 5 2 plumose, 4 short, 3 spines, - -
plumose setae serrated margin serrated serrated
pereiopod | C longer M C longer M C longer M ? C longer M C shorter M
no. of spines at basis, male 0 0 ? ? 0) 0
long setae at pereionites no no no 3 and 4 2 no
structure of carapace ? reticulate reticulate pitted scaly pitted
Carapace ridges
transverse in female 2 2 2 2 - -
transverse in male 2 - ? - no slightly 2 pairs
longitudinal 2 pairs 1 lateral pair - 2 pairs 1 pair no
dorsomedian carina present present, pronounced present present present
pronounced
Remarks - -
- 2 horns at middle - -
Leg.: G. Hartmann & G. Hartmann-Schréder
Date: 18. January 1976
Locus typicus: Australia, Victoria, southern
dead end of Clarence River, near Yamba, brackish
water and mangroves
Paratypes: female and male for dissection of
extremities.
Diagnosis
Mossambicuma with long siphonal tubes
separated but close together; no abrupt border
between carapace and second pereionite in female;
uropods’ peduncles shorter than pleonite 6 and
rami; third maxilliped basis and merus with long
distal prolongations; basis of pereiopod 1
geniculated; pereiopod 2 distal seta longer than
dactylus.
Compared to the other species of this genus, in
M. elongatum the basis of third maxilliped is
shorter and more geniculated, both basis and
merus of third maxilliped having a longer distal
prolongation in the new species.
Description
Based on the holotype, an ovigerous female,
length 2.7 mm.
Carapace compressed, longer than free thoracic
segments, first segment fused, lateral ridge
running from below frontal lobe dorsoposterior to
dorsomedian line; pseudorostrum long, siphonal
tubes long, separated but close together.
Dorsomedian line pronounced in anterior half,
less pronounced in posterior part where lateral
ridge runs parallel to dorsomedian line, very last
part of carapace without ridge or pronounced
dorsomedian line; antennal notch shallow;
anterolateral margin smooth; anteroventral margin
of carapace smooth; integument weakly pitted;
eyes present.
Four thoracic segments visible; abdomen 1.1
times longer than carapace and thoracic segments
combined; pleonite 6 is 1.5 times longer than
uropods’ peduncles and 1.4 times longer than
wide.
Description of extremities, based on paratype,
ovigerous female, length 3 mm. First antenna
long, mid article 1.1 times longer than basal one,
both combined 1.1 times longer than distal one;
main flagellum two-segmented, terminal with one
aesthetasc and one short, two long setae, accessory
flagellum reduced, replaced by one seta;
maxilliped 3 basis geniculated, with long and
44 U MUHLENHARDT-SIEGEL
FIGURE 13: Mossambicuma victoriae sp.n. ovigerous female: H: habitus, Al: first antenna, Mxp3: maxilliped 3,
Pl: pereiopod 1, P2: pereiopod 2, P3: pereiopod 3, P4: pereiopod 4, P5: pereiopod 5, U: pleonite 6 and uropods.
Scale a: 1 mm (H), scale b: 0.1 mm (Al, Mxp3, P1, P2, P3, P4, P5, U).
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 45
FIGURE 14: Mossambicuma victoriae sp.n. male: Mxp2: maxilliped 2, Mxp3: maxilliped 3, Pl: pereiopod 1, P2:
pereiopod 2, P4: pereiopod 4, P5: pereiopod 5, U: pleonite 6 and uropods. Scale a: 0.1 mm (Mxp2, Mxp3, P1, P2,
P4, PS, U).
46 U MUHLENHARDT-SIEGEL
wide outer distal prolongation carrying eight
plumose setae at inner margin, the two distal ones
very long, prolongation almost reaching
articulation carpus to propodus; ischium longer
than merus, the latter with long and wide outer
distal prolongation reaching articulation carpus to
propodus, propodus egg shaped, dactylus slender
with terminal claw-like seta, exopod present (not
figured); pereiopod 1 basis shorter than rest of
extremity, slightly geniculated, ischium shorter
than merus, both articles combined shorter than
carpus, propodus second longest article, dactylus
with three terminal setae, exopod present;
pereiopod 2 basis shorter than rest of extremity,
ischium missing, merus equal in length to
dactylus, longer than propodus but shorter than
carpus, terminal seta longer than dactylus;
pereiopod 3 basis equal in length to rest of
extremity, distal seta of carpus reaching tip of
terminal seta which is longer than dactylus;
pereiopod 4 basis equal in length to rest of
extremity, distal seta longer than dactylus;
pereiopod 5 similar in shape to pereiopod 4;
uropod’s peduncle short compared with pleonite 6
and rami, exopod two-segmented, longer than
endopod; dorsal ridge with double row of scales,
distal tip with two serrated spines; endopod
unsegmented with four strong and short spines at
inner margin; outer margin scaly, terminal tip with
acute plumose seta.
Males dorsomedian line and lateral ridge less
pronounced than in female; extremities dissected
from male paratype, length 2.5 mm; second
antenna reaching articulation of pleomers 3 to 4,
pereiopod 1 basis more stout but rest of extremity
more slender, pereiopod 2 shorter than in female,
uropods’ peduncles with 11 setae at distal part of
inner margins, endopod with 20 spines at
proximal part, distal part with scales, one terminal
plumose seta as in female, exopod with two
serrated terminal spines.
Etymology
The new species is named after the type
locality.
Remarks
Day (1978) described a new genus,
Mossambicuma, with the striking characters:
ischium of maxilliped 3 larger than merus, basis
of pereiopod 1 without distal projection, second
pereiopod without ischium, uropods’ peduncles
shorter than pleonite 6 and rami, pleonite 6 shorter
than fifth abdominal somite. She mentioned the
resemblance to the genus Eocuma Marcusen, 1894
but she also stressed the differences from this
genus, such as the form of the carapace and the
first pereiopod not having the distal projection of
basis typical for Eocuma. The genus
Mossambicuma seemed to be monotypic, with the
type species M. elongatum Day, 1978 found only
at the type locality, the Morrumbene estuary
(Miihlenhardt-Siegel, 1996). The Australian new
species clearly belongs to this genus. It differs
from the known species in the female’s habitus as
there is no abrupt border between carapace and
second pereionite, the siphonal tubes are longer,
the basis of third maxilliped is shorter and more
geniculated, both basis and merus of the third
maxilliped have a longer distal prolongation, the
basis of pereiopod 1 is geniculated, pereiopod 2
has a distal seta that is longer than the dactylus in
the new species but shorter in M. elongatum.
Subfamily VAUNTHOMPSONIINAE Sars, 1878
Genus Glyphocuma Hale, 1944
Glyphocuma oculodentata sp.n.
(Figure 15)
Material
QLD: Lizard Island 1992: Turtle Bay (15
November, 15m): 3 subadult females; sand
(10 m): 1 subadult female, 2 juveniles; Mermaid
Bay (7m): | juvenile; Lagoon (7 m): 1 juvenile;
ZMH K 39936.
Holotype: adult but non-ovigerous female;
SAM C 5997a, SAM C 5997b: extremities of
paratype
Leg.: V. Siegel, U. Miihlenhardt-Siegel
Date: 20 November 1992
Locus typicus: Australia, Queensland, Lizard
Island, Watson’s Bay, 16m
Paratypes: Watson’s Bay (16m): 2 adult
females, 3 juvenile females; SAM C 5998.
Diagnosis
Glyphocuma with six dorsomedian teeth in
anterior half of carapace and one strong tooth at
anterior end of ocular lobe reaching the tip of
pseudorostrum, accessory flagellum of antenna 1
half as long as basal article of main flagellum,
uropod’s endopod distal article a little longer than
basal.
Description
Based on holotype, a subadult female, 7.6 mm
in length.
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 47
FIGURE 15: Glyphocuma oculodentata sp.n. female: H: habitus, Al: first antenna, Md: mandible, Mxp2:
maxilliped 2, Mxp3: maxilliped 3, Pl: pereiopod 1, P2: pereiopod 2, P3: pereiopod 3, P4: pereiopod 4, PS:
pereiopod 5, U: pleonite 6 and uropod. Scale a: 1 mm (H), scale b: 0.5 mm (anterior part of carapace enlarged),
scale c: 0.1 mm (Al, Md, Mxp2, P5), scale d: 0.1 mm (Mxp3, P1, P2, P3, P4, U).
48 U MUHLENHARDT-SIEGEL
Carapace slender, as long as free thoracic
segments, straight to posterior part of frontal lobe,
the dentated line ascending, the undentated
posterior half straight; pseudorostrum and
siphonal tube short; dorsomedian line dentated in
anterior half with six teeth; antennal notch
reaching the posterior end of ocular lobe;
subrostral tooth not pronounced; anterolateral
margin serrated; anteroventral margin of carapace
smooth; integument with fine reticulate structure
as figured in Figure 17; eyes present.
Five free thoracic segments visible from above,
the first one short, laterally covered by carapace
and second free thoracic segment, third and fourth
segments laterally produced backwards; abdomen
longer than carapace and thoracic segments
combined; pleonite 6 shorter than uropod’s
peduncle.
The description of the extremities is based on
paratype, a female. First antenna basal article
geniculated with many hair-like setae, both
following articles equal in length, main flagellum
two-segmented, distally with two aesthetascs and
one annulated long seta, accessory flagellum two-
segmented, half as long as basal article of main
flagellum, with three terminally plumose setae and
one shorter simple seta. Mandible with 17 setae,
pars incisiva with four terminal ‘teeth’, pars
molaris short and stout. Maxilliped 2 straight,
basis longer than rest of extremity, ischium more
than half as long as merus, carpus second longest
article with 6 plumose setae at inner margin and
one at distal outer margin, dactylus short and
stout, ending with stout terminal seta; maxilliped
3 basis long and slender, distal prolongation with
11 plumose setae, two of them being twice as
long as the others; ischium a little shorter than
merus; carpus and propodus equal in length,
dactylus with stout terminal seta, exopod present;
pereiopod 1 basis shorter than rest of extremity,
propodus second longest article after basis,
exopod present; pereiopod 2 dactylus second
longest article after basis, terminal seta shorter
than dactylus, ischium not visible, propodus small,
exopod present; pereiopod 3 carpus second
longest article after basis, dactylus short with
longer terminal seta, exopod present; pereiopod 4
carpus second longest article after basis, terminal
seta longer than dactylus; pereiopod 5 carpus
second longest article after basis, with two long
distal setae reaching beyond tip of dactylus’
terminal seta; uropod’s peduncle longer than rami
with 12 setae at inner margin, rami equal in
length, exopod with eight plumose setae at inner
and 13 stout setae at outer margin of distal article,
endopod two-segmented, basal article a little
shorter (factor 0.9) than distal, with seven setae at
inner and one at outer distal margin, distal article
with ten stout setae, the distal one being longer,
one long terminal and one shorter subterminal
seta.
Etymology
The new species is named after the tooth on the
ocular lobe.
Remarks
The new species resembles G. dentata Hale,
1944. In Jones’s (1984) species list, G. cf. dentata
(identified by J. Day) is mentioned for Lizard
Island. The specimens in the present collection
differ from G. dentata by: presence of the large
tooth at the distal tip of ocular lobe, which is
missing in G. dentata; accessory flagellum of
antenna 1 half as long as basal article of main
flagellum, being shorter in G. dentata; uropod’s
endopod distal article a little longer than basal,
but the distal being nearly half as long as basal
one in G. dentata.
Genus Leptocuma Sars, 1873
Leptocuma longidactylum sp.n.
(Figure 16)
Material
North end Herald Bight, Shark Bay, 3 fathoms,
sand, ‘Isobel’ W.H., 21 November 1945,
submarine light, temperature: 24.22°C ; 30 males;
SAM C 5992.
Holotype: male; SAM C 5991
Locus typicus: Australia, South Australia, north
end Herald Bight, Shark Bay, 3 fathoms, sand,
‘Isobel’ W.H., submarine light, temperature:
24.22°C
Date: 21 November 1945
Diagnosis
Leptocuma with two spines at distal end of first
pereiopod’s basis, ischium of second pereiopod
longer than carpus. Bases of the pereiopods in
males more slender and longer, compared to the
exopods’ bases.
Description
Based on the holotype, adult male, 3.6 mm in
length.
Carapace 0.9 mm in length, pseudorostral lobes
not meeting in front of ocular lobe, siphonal tube
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 49
FIGURE 16: Leptocuma longidactylum sp.n. adult male: H: habitus, Mxp3: maxilliped 3, Pl: pereiopod 1, P2:
pereiopod 2, P3: pereiopod 3, P4: pereiopod 4, U: pleonite 6 and uropods. Scale a: 1 mm (H), scale b: 0.1 mm (Mxp
3, P3, P4), scale c: 0.1 mm (P2), scale d: 0.1 mm (P1, U).
50 U MUHLENHARDT-SIEGEL
very short, dorsomedian line straight, not
pronounced; antennal notch wide and shallow,
anterolateral margin rounded, anteroventral
margin of carapace smooth; ocular lobe present,
no lenses visible; free thoracic segments 0.8 mm
in length, second thoracic segment longest;
abdomen 1.9 mm in length, longer than carapace
and free thoracic segments combined; pleonite 6
shorter than uropod’s peduncle.
The description of the extremities is based on
the paratype, adult male. Maxilliped 3 basis
much longer than rest of extremity, wider than
following articles, with four long, plumose
setae, inner margin with short plumose setae
and hair-like setae; merus a little wider than
ischium and carpus, subequal in length to
carpus and propodus, exopod present;
pereiopod 1 basis longest article but shorter
than rest of extremity, at distal inner margin a
serrated seta preceded by a longer serrated seta,
outer distal edge with hair-like setae; propodus
second longest article, exopod present;
pereiopod 2 basis longest article but shorter
than rest of extremity, proximal part wider than
distal, ischium longer than propodus, dactylus
second longest article, tapering, exopod present;
pereiopod 3 basis longer than rest of extremity,
ischium with three long and one shorter distally
annulated setae, merus with three annulated setae
in distal part; carpus distally with two long
simple setae, propodus and dactylus short,
exopod present; pereiopod 4 basis longest article
but shorter than rest of extremity, distally each
article with long simple setae: basis one, ischium
three, merus three, carpus two, propodus one
stout, dactylus one terminal stout, exopod
rudimentary; uropod’s peduncle longer than
pleonite 6 but shorter than rami, 9 to 19 setae at
inner margin; exopod equal in length to endopod,
inner margin with seven plumose setae, three
terminal long simple setae; endopod two-
segmented, proximal article 1.8 times longer than
distal, proximal article with 13, distal article with
six setae at inner margin, two long terminal and
one short hair-like setae at outer distal edge.
Etymology
The new species is named after the long
dactylus of the second pereiopod.
Remarks
Nine Australian Leptocuma species are
described for the genus. According to Tafe &
Greenwood (1996) they are divided into two
groups:
« Group 1 with smooth strong setae at
distomedial margin of first pereiopod’s basis,
propodus with well developed brush of setae
at distal end, uropod’s endopod proximal
article shorter or only a little longer than
distal. Only two of the Australian Leptocuma
species are in this group: L. pulleini Hale,
1928 and L. vicarium Hale, 1944.
¢ Group 2 with serrated seta at distal end of
first pereiopod’s basis preceded by another
serrated seta, distal end of propodus with few
setae, uropod’s endopod with distal article
longer than proximal. The new species
belongs to the second group. For South
Australia only two Leptocuma species are
described : L. pulleini Hale, 1928, belonging
to group 1, and L. sheardi, Hale 1936,
belonging to group 2.
The new species differs from L. sheardi in
having the bases of the pereiopods in males more
slender, and longer compared to the exopods’
bases; the distal articles of the new species’
pereiopods bear fewer long setae than those of L.
sheardi. The most striking characters of the new
species are the dactylus being longer than the
carpus and the long ischium, both of the second
pereiopod, which are unique within the genus.
Leptocuma sp.
(Figure 17)
Material
WA: 46, 1 ovigerous female; ZMH K 39935.
Description
Based on the strongly decalcified female, total
length 3.3 mm.
Carapace shorter than five free thoracic
segments, pseudorostral lobes not meeting in front
of rounded ocular lobe; abdomen subequal in
length to carapace and free thoracic segments
combined; pleonite 6 a little (1.2 times) longer
than wide, two anal valves visible, length
proportion of uropod’s peduncle to pleonite 6 is
1.5.
Maxilliped 3 basis longer than rest of extremity,
slightly geniculated, distal half of inner margin
with 14 plumose setae, distal outer margin sloping
backwards, with five long plumose setae, exopod
present; pereiopod 1 basis longest article, 0.77 as
long as rest of extremity, inner margin with seven
plumose setae, distal end of inner margin with
two stout serrated spines, outer distal end with
one short plumose seta, propodus second longest
article, 1.1 times longer than slender dactylus,
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 51
FIGURE 17: Leptocuma sp. female: Mxp3: maxilliped 3, Pl: pereiopod 1, P2: pereiopod 2, P3: pereiopod 3, P4:
pereiopod 4, P5: pereiopod 5, U: pleonite 6 and uropods. Scale a: 0.1 mm (Mxp3, Pl, P2, P3, P4, P5), scale b:
0.1 mm (U).
U MUHLENHARDT-SIEGEL
52
g[eWoJ :J ‘o[eu :U
v g 9 8 é é UIZICUL JajNO [eIsSIP
Ol Jey [easIp 72
[eISIP 18 pT yoys*xod
ye Suo] P/E ISP] é é UIs Ie! JOUUT
siseq 38 oejas ‘¢ padiypixey]
W6 J9 Jg “wg JIT Jg Wg w¢-y wg J6 “Wg aponze [eisip podopua
wey JTI J6 “Wh 381 JLT “Wg wyI-ol wg] JIT ‘WoT ajonue jeuntxosd podopue
wo] J7I Jp WL JST JOT “WeEz wig-¢ é JT West ajounpad
podo.n 3e avjas Jo 1aquinyy
90 L0 80 90 80 $0 el 90 snAjoep:snpodod ‘7q
[enba yenba [enbo yenbo yenbo oxa snurel \so3uo]
81 cl 07 oT JET Ll 97 cl [ejstp:[eseq podopus s,podoin
60 VT im 60 I 60 é 60 podopua :ajounpad s podosn
cl UT CT eT UT el TT TT snjAjoep:snpodoad ‘|g
suor10do0.1d-y}3ue']
‘uds wnjd4jovpisuo] ‘ds Ipapays undafissas undysqo 1Mpauuay umipausayul aDiDg4vq Jayaereyd
1 "1 "1 "7 "7 7 “1 1
"Xa$ Joyye ul siseq s,podorasad jsIJ JO pud [eysIp ye soutds payesas Om} YIM Sotoods nuNDo}daT Jo uOsIIedWOD :¢ ATAV.L
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 53
exopod present; pereiopod 2 basis as long as
merus, carpus and propodus combined, carpus
second longest article, about twice as long as
propodus, propodus with 12 hair-like setae at
distal end, 0.68 times as long as tapering dactylus,
dactylus with 11 terminal and subterminal hair-
like setae, exopod present; pereiopod 3 basis
longer than rest of extremity, carpus a little shorter
than merus, which is second longest article,
propodus and dactylus short, ischium, merus,
carpus, and propodus distally with long terminal
annulated setae, dactylus with one strong terminal
seta, exopod present; pereiopod 4 similar to
pereiopod 3, but basis shorter than rest of
extremity, exopod rudimentary; pereiopod 5 basis
much shorter than rest of extremity, carpus second
longest article, fewer setae than preceding
extremities, propodus with two long terminal
setae. Uropod’s peduncle with 12 unequal spiny
setae at inner margin, 1.1 times longer than
endopod; uropods’ rami: exopod with five setae at
inner, three at outer margin, and one seta each
terminally and subterminally, a little longer than
endopod; endopod two-segmented, basal article
1.2 times longer than distal, basal article with 11,
distal article with four unequal setae at inner
margin, one longer terminal seta.
Remarks
Five species of the genus Leptocuma are
described with two serrated spines located distally
at the basis of first pereiopod: L. obstipum Hale,
1944, L. intermedium Hale, 1944 both from New
South Wales; L. serriferum Hale, 1944 from West
Australia and New South Wales; L. barbarae Tafe
& Greenwood, 1996 and L. kennedyi Tafe &
Greenwood, 1996 both from Queensland. In L.
sheardi Hale, 1944 described from South Australia,
only males have two serrated spines at the basis of
first pereiopod, females have one. The female of
the Western Australian material is compared with
the other species mentioned (Table 3). It does not
fit with any of the described species, so it is
probably new. It is not named because of the poor
condition of the single specimen.
Genus Picrocuma Hale, 1936
Picrocuma poecilotum Hale, 1936
Material
Various stations, Noosa R., 40 mesh tow net,
June 1940, leg. ISR Munro; 6 ovigerous females,
SAM C 5993.
Remarks
The specimens from the collection of the South
Australian Museum fit the most striking characters
of P. poecilotum given in Hale (1936). These are
the large second pereionite, the pseudorostral
lobes meeting in front of ocular lobe, a dorsal
hump seen in lateral view behind the ocular lobe
in males and juveniles, and more posterior in
ovigerous females. A comparison of the characters
within the genus is given in Table 4.
TABLE 4: Comparison of Picrocuma species. |: length, w: width.
Picrocuma Picrocuma Picrocuma
poecilotum crudgingtoni rectangularis n.sp.
Carapace
male I:w 1.8 1.7 1.7
female l:w 1.5 ? 1.6
Dorsal humps behind ocular lobe pereionite 2 no
Uropods’ endopods’ setae
male 12 + 1 long 6+ 1 long 8+ 1 long
female 3 4+ 1 long
Uropods’ proportions
peduncle I:w, male 3? 2? 4.5
peduncle l:w, female 3.5
endopod I:w, male 3.4 3.9 5.8
endopod I:w, female 3.1
peduncle:pleonite 6, male 1.5 1.4 1.8
peduncle:pleonite 6, female 1.3 1.5
endopod:peduncle, male iy 0.9 0.7
1: length; w: width
54 U MUHLENHARDT-SIEGEL
Picrocuma rectangularis sp.n.
(Figure 18)
Material
WA: 17+18: 7 males, 10 females;
Holotype: non-ovigerous female; ZMH K
39938.
Leg.: G. Hartmann & G. Hartmann-Schréder
Date: 20 September 1975
Locus typicus: Derby, silty lower eulitoral zone
Paratypes: WA-28, Port Hedland, 27 September
1975, fine sand on reef top, 2 males, 3 females,
ZMH K 39939; 1 male, 2 females; SAM C 6081.
Diagnosis
Minute species of Picrocuma, uropod’s
peduncle slender, long compared to the other
known species, uropods’ rami with a rectangular
shape.
Description
Based on holotype, female 1.4 mm in length.
Carapace smooth, shorter than free thoracic
segments, proportion length to width 1.6;
pseudorostrum as long as ocular lobe, siphonal
tube not visible; dorsomedian line not
pronounced; antennal notch not present;
anterolateral margin smooth; anteroventral margin
of carapace rounded. Integument, although
decalcificated due to fixation in formalin, with a
reticulate pattern visible in higher magnification;
eye not pigmented.
Five free thoracic segments visible, the first
slender, second long; abdomen shorter than
carapace and free thoracic segments combined;
pleonite 6 shorter than wide (0.9), shorter than
uropods’ peduncles, length proportion peduncle to
pleonite 6 is 1.5.
Description of extremities based on paratype.
First antenna basal article geniculated, distal
article longest, accessory flagellum minute, main
flagellum short, two-segmented, three distal setae.
Maxilliped 3 basis slightly geniculated, shorter
than rest of extremity, carpus second longest
article, dactylus with strong terminal and three
hair-like subterminal setae, exopod present;
pereiopod 1 basis shorter than rest of extremity,
carpus second longest article, similar in shape to
maxilliped 3, exopod present; pereiopod 2 basis
shorter than rest of extremity, ischium missing,
dactylus second longest article after basis; merus,
carpus, and propodus decreasing in length,
exopod present; pereiopod 3 with exopod, similar
to pereiopods 4 and 5, basis shorter than rest of
extremities, carpus second longest article;
uropod’s peduncle longer than rectangular rami,
inner margin without armature, exopod longer
than unsegmented endopod, exopod with one long
and one short terminal spine, endopod with three
spines at inner margin, one terminal spine 0.6
times as long as endopod.
Male 1 mm in length, similar to female, except
for following characters: antenna 1 basal article
not geniculated, basis of maxilliped 3 more
slender, exopods’ basal article more rounded than
in female in all extremities, uropods’ peduncles
longer than in female, length proportion peduncle
to pleonite 6 is 1.8, rami equal in length, endopod
with eight spines at inner margin and one terminal
longer one.
Etymology
The new species is named after the rectangular
shape of its uropods’ rami.
Remarks
Only two species are currently known in the
genus Picrocuma: P. poecilotum Hale, 1936 from
Queensland, Tasmania and South Australia and P.
crudgingtoni Tafe & Greenwood, 1996 from
Queensland. The main characters given by Tafe &
Greenwood (1996) are compared in Table 4. The
most important difference of the new species
compared with the known ones is the uropods’
rami having a rectangular shape, being longer in
males than in females, the endopod having eight
lateral plus one terminal spine; and the uropod’s
peduncle being longer compared to pleonite 6
than in the other two species.
Genus Vaunthompsonia Bate, 1858
Vaunthompsonia cf. cristata Bate, 1858
Material
Near Pt. Maclaren, Thorney Passage, Whiting
Ground, 3.5 fathoms, 8-8.30 pm, 2 March 1941,
submarine light, leg. K. Sheard: three males, SAM
C 5994.
In this material the pereiopods are broken;
however, One can infer the specimens are close to
V. cristata based on the serrated margins of
carapace and pleonite 6, and the anal valves each
ending in a fine hair. All these characters are
typical for this species.
Family LEUCONIDAE Sars, 1878
Genus Ommatoleucon Watling, 1991
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 55
P2
P2
FIGURE 18: Picrocuma rectangularis sp.n. female (above): H: habitus, Al: first antenna, Mxp3: maxilliped 3, P1:
pereiopod 1, P2: pereiopod 2, P3: pereiopod 3, P4: pereiopod 4, PS: pereiopod 5, U: pleonite 6 and uropods. Scale
a: 0.5 mm (H), scale b: 0.1 mm (Al, Mxp3, Pl, P2, P3, P4, PS, U). Picrocuma rectangularis sp.n. male (below):
H: habitus, Al: first antenna, Mxp2: maxilliped 2, Mxp3: maxilliped 3, Pl: pereiopod 1, P2: pereiopod 2, P3:
pereiopod 3, P4: pereiopod 4, P5: pereiopod 5, U: pleonite 6 and uropods. Scale a: 0.5 mm (H), scale b: 0.1 mm
(Al, Mxp2, Mxp3, P1, P2, P3, P4, PS, U).
56 U MUHLENHARDT-SIEGEL
FIGURE 19: Ommatoleucon ocularis: H: habitus adult male (upper right) and subadult female (upper left), male’s
extremities: Mxp3: maxilliped 3, P2: pereiopod 2, P4: pereiopod 4, P5: pereiopod 5, U: pleonite 6 and uropods.
Scale a: 0.5 mm (H, U), scale b: 0.1 mm (Mxp3, P2, P4, P5).
CUMACEAN CRUSTACEA FROM AUSTRALIA AND INDONESIA 57
Ommatoleucon ocularis (Hale, 1945)
(Figure 19)
Material
TAS: Nubeena: 6 males, 2 subadult females;
ZMH K 39937.
Remarks
The first record for members of the family
Leuconidae from Tasmania fits well with the
characteristics Hale (1945) gave for his new
species, Leucon ocularis, which was transferred
by Watling (1991) into his new genus
Ommatoleucon. The diagnostic characters of this
genus are: uropods’ endopods unsegmented,
straight pseudorostrum in front fringed with setae,
ocular lobe not distinctly defined, eye present,
pedigerous segments depressed, uropods’ exopods
with three unequal distal spines, inner margin with
three plumose setae and a spine next to terminal
three, endopod with 11 short spines at inner
margin. The eye in the present specimens appears
to be submerged in the carapace.
Distribution
South Australia, St. Vincent Gulf, 19 m;
Tasmania, Nubeena, 0.5 m.
ACKNOWLEDGMENTS
The sampling in the years 1975-76 by Drs G.
Hartmann and G. Hartmann-Schréder was financially
supported by the DFG. Sampling at Lizard Island in
1992 was allowed by permit No. G92/375, Great Barrier
Reef Marine Park Regulations, Queensland.
Many thanks to:
the crew of Lizard Island Research Station for kind
logistic and personal help: Dr. Anne Hoggett, Dr.
Lyle Vail, Marianne and Lance Pearce;
the South Australian Museum for loaning cumacean
material for identification;
Dr. B. Hilbig for correcting the English text;
H.-D. Totzke for critical comments;
my husband Dr. V. Siegel for help with collecting
and financial support;
the Zoological Museum, Hamburg, for providing an
actual place where the work involved could be
undertaken.
REFERENCES
Bacescu, M. 1988: Cumacea I. Jn H-E Gruner & LB
Holthuis (eds). Crustaceorum Catalogus. Pars 7: 1—
173.
Day, J. 1978. Southern African Cumacea, part 2, Family
Bodotriidae, subfamily Bodotriinae. Annals of the
South African Museum 75(7): 159-290.
Gam6, S. 1964. On three new species of Cumacea from
the southern Sea of Japan. Crustaceana 7: 241-253.
Hale, HM. 1928. Australian Cumacea. Transactions of
the Royal Society South Australia 52: 3148.
Hale, HM. 1936. Three new Cumacea from South
Australia. Records of the South Australian Museum
5: 395-403.
Hale, HM. 1937. Further notes on the Cumacea of South
Australian reefs. Records of the South Australian
Museum 6: 61-74.
Hale, HM. 1944. Australian Cumacea, no. 7, The genus
Cyclaspis. Records of the South Australian Museum
8: 63-142.
Hale, HM. 1945. Australian Cumacea, no. 10, The
family Leuconidae. Transactions of the Royal
Society South Australia 69: 86-95.
Hale, HM. 1948. Australian Cumacea, no. 14, Further
notes on the genus Cyclaspis. Records of the South
Australian Museum 9: |-42.
Jones, AR. 1984. Sedimentary relationships and
community structure of benthic crustacean
assemblages of reef-associated sediments at Lizard
Island, Great Barrier Reef. Coral Reefs 3: 101-111.
Kurian, CV. 1961. Three species of Cumacea from the
Lakes of Kerala. Bulletin of the Central Research
Institute, University of Kerala, Trivandrum, 8: 55—
61.
Miihlenhardt-Siegel, U. 1996. Ein Beitrag zur Cumacea-
Fauna aus dem Ktistenflachwasser des siidlichen
Afrika, mit Beschreibung von Cumella hartmanni
sp.n. Mitteilungen aus dem hamburgischen
zoologischen Museum und Institut 93: 117-140.
Sars, GO. 1878. Nye Bidrag til Kundskaben om
Middelhavets Invertebratfauna. Archiv for
mathematic of naturvidenskab 3-4: 1-60.
Tafe, DJ & Greenwood, JG. 1996. The Bodotriidae
(Crustacea: Cumacea) of Moreton Bay, Queensland.
Memoirs of the Queensland Museum 39(2): 391-
482.
Watling, L. 1991. Revision of the cumacean family
Leuconidae. Journal of Crustacean Biology 11(4):
569-582.
Zimmer, C. 1921. Results of Dr. E. Mjéberg’s Swedish
Scientific Expeditions to Australia 1910-13. XXVI
Cumaceen. Kungligen Svenska
Vetenskapsakademiens Handlingar 61(7): 4-13.
AN ANNOTATED CHECKLIST OF THE AUSTRALIAN
ACANTHOCEPHALA FROM MAMMALIAN AND BIRD HOSTS
L. R. SMALES
Summary
A compilation of all the records of acanthocephalans parasiting Australian mammals and birds is
presented, firstly as a parasite-host list and then as a host-parasite list. Current and original parasite
and host names are given. References for and localities of each record are provided. Hosts from
Australian sub-Antarctic and Antarctic waters are included but Papua New Guinea records are
excluded.
AN ANNOTATED CHECKLIST OF THE AUSTRALIAN ACANTHOCEPHALA FROM
MAMMALIAN AND BIRD HOSTS
LR SMALES
SMALES, LR. 2003. An annotated checklist of the Australian Acanthocephala from
mammalian and bird hosts. Records of the South Australian Museum 36(1): 59-82.
A compilation of all the records of acanthocephalans parasitising Australian mammals and
birds is presented, firstly as a parasite—host list and then as a host—parasite list. Current and
original parasite and host names are given. References for and localities of each record are
provided. Hosts from Australian sub-Antarctic and Antarctic waters are included but Papua
New Guinea records are excluded.
LR Smales, School of Biological and Environmental Sciences, Central Queensland University,
Rockhampton, Queensland 4702. Manuscript received 5 July 2002.
A list of type specimens of the Acanthocephala
held in the South Australian Museum was
compiled by Smales (1983), followed by a
complete list of the Australian Acanthocephala by
Edmonds (1989), more than 10 years ago. Since
then new species have been described, additional
material has been collected and many host and
parasite taxa have been revised. It is, therefore,
timely to produce updated lists that treat all the
known acanthocephalans from Australian hosts.
This checklist is a compilation based on all
published records up to 2002, augmented by the
examination of all the specimens deposited in the
Queensland Museum, Brisbane (QM); South
Australian Museum, Adelaide (SAM); registration
numbers prefixed as AHC, Australian Museum,
Sydney (AM); the South Australian Research &
Development Institute, Adelaide (SARDI); and
the CSIRO Wildlife Collection, Canberra
(CSIRO). It is limited to data from mammalian
and bird hosts, including presumed paratenic hosts
and accidental hosts; fish hosts are presently being
reviewed (Pichelin, pers. comm.), amphibian hosts
were recently treated by Barton (1994) and
reptilian hosts by Pichelin et al (1999).
Although for the most part restricted to records
of parasites from the Australian states, records
from marine hosts collected from Australian sub-
Antarctic and Antarctic territories have also been
included. In these latter cases only material held
in Australia is listed although the known
distribution of such species may be circumpolar.
Parasite nomenclature is based on the system of
classification of Amin (1985, 1987) and Golvan’s
(1994) alphabetical list of genera and species.
Host nomenclature is based on Strahan (1995) for
the mammals, and Marchant and Higgins (1990-
2001) and Schodde and Mason (1999) for the
birds.
Each record is given using the current parasite
name followed by its synonyms. Because there
have been numerous changes to the taxonomy of
many species, all known synonyms of the parasite
are listed although some earlier records could not
be accessed directly. This is followed by each
host, with localities, specific references to
Australian material, and museum registration
numbers. If the current name of the host differs
from that used in the original reference it is given
as ‘host as ...’ after the reference in the host—
parasite list. The type host is designated by an
asterisk.
The following abbreviations are used for
localities: NSW (New South Wales), NT
(Northern Territory), Q (Queensland), V
(Victoria), T (Tasmania), SA (South Australia),
WA (Western Australia).
ParasiTE—Host List
CLASS ARCHIACANTHOCEPHALA
Gigantorhynchidae Hamman, 1892
1. Mediorhynchus alecturae (Johnston &
Edmonds, 1947)
Syns: Echinorhynchus (Gigantorhynchus) sp.
Johnston, 1912; Johnston & Deland, 1929
Empodius alecturae Johnston & Edmonds, 1947
Empodisma alecturae Yamaguti, 1963
Mediorhynchus alecturae Golvan, 1962; Byrd &
60 LR SMALES
Kellog, 1971; Schmidt & Kuntz, 1977;
Smales, 2002a
Host: Alectura lathami Gray,* Q, Johnston 1912a:
106, 1912b: 72; Johnston & Deland 1929:
148; Smales 2002a: 375; AHC 1186, 2930,
4128, 2250, 427470-78, 42918-23.
2. Mediorhynchus colluricinclae Smales, 2002
Hosts: Acanthochoera chrysoptera (Latham), SA,
Smales 2002a: 377-380; AHC 4627
Coluricincla harmonica (Latham)*, SA, Smales
2002a: 377-380; AHC 5081, 5102, 18796,
28396
Pomatostomus superciliosus (Vigors &
Horsfield), SA, Smales 2002a: 377-380; AHC
5118
Rhipidura leucophrys (Latham), SA, Smales
2002a: 377-380; AHC 5040.
3. Mediorhynchus corcoracis Johnston &
Edmonds, 1951
Syn: Echinorhynchus sp. Cleland, 1922; Johnston
& Deland, 1929a
Hosts: Corcorax melanoramphos (Vieillot),*
NSW, Q, SA, V, Cleland 1922: 108;
Johnston & Deland 1929: 151; Johnston &
Edmonds 1951:1-3; Smales 2002a: 375;
AHC 3365, 3366, 3426, 5091, 6561, 23814,
42481-503
Corvus bennetti North, SA, Johnston & Edmonds
1951:1-3; Smales 2002a: 375; AHC 3269
Corvus coronoides Vigors & Horsfield, SA,
Smales 2002a: 375; AHC 5086
Corvus mellori Matthews, SA, V, Smales 2002a:
375; AHC 5088, 5108, 5109, 11530, 18225
Corvus tasmanicus Matthews, Tas, AHC 4586,
4633.
Corvus sp. SA, AM W1056, W1065
‘crow’, SA, NT, Smales 2002a: 375; AHC 1056,
1065, 3361
Grallina cyanoleuca (Latham), SA, NT, Smales
2002a: 375; AHC 434, 18222.
4. Mediorhynchus robustus Van Cleave, 1916
Syns: Mediorhynchus garruli Yamaguti, 1939
Mediorhynchus robustus Van Cleave, 1916;
Schmidt & Kuntz, 1977
Host: Grallina cyanoleuca (Latham), Q, Smales
2002a: 375; QM GL11212 Specimens
collected by J.W. Fielding, 1912, identified by
H.H. Baylis, 1926, are now missing. This
identification is doubtful but cannot be
confirmed.
5. Mediorhynchus sp. A
Host: Stiltia isabella Vieillot, NT, Smales 2002a:
375; CSIRO A21, identification by G.
Schmidt but material missing from the
collection.
6. Mediorhynchus sp. B
Hosts: Acanthogenys rufogularis Gould and
‘gull’, SA, Smales 2002a: 375; AHC 5126,
20640, 2 female specimens and 1 fragment
only available for study.
7. Mediorhynchus sp. larvae
Presumed paratenic host: [soodon macrourus
(Gould), Q.
Moniliformidae
8. Australiformis semoni (Linstow, 1898)
Syns: Echinorhynchus semoni Linstow, 1898
Prosthenorchis s.l. semoni Travassos, 1917
Gigantorhynchus sp. Johnston, 1910a; Johnston
& Deland, 1929
Gigantorhynchus semoni Porta, 1908; Johnston,
1909a, 1911; Johnston & Deland, 1929
Moniliformis semoni Johnston & Edmonds, 1952
Australiformis semoni Schmidt & Edmonds, 1989
Hosts: Antechinus agilis Dickman et al, AHC
19728-32, CSIRO A31, A36, A48, Antechinus
Stuartii Macleay, Schmidt & Edmonds 1989:
215-217
Isoodon macrourus (Gould), Q, NT, AHC 3416,
10512, 17994, 23308, 23309, 23316, CSIRO
AS, A6, A9, A61, A67, A107, QM GL14429,
GL14431, GL14433, GL14437, GL14438,
GL14440, GL14441, GL14442, GL14443,
GL14464, GL14465
Isoodon obesulus (Shaw),* NSW, Q, T, WA,
Linstow 1898: 471; Johnston 1909a: 521;
Johnston & Edmonds 1952: 215-217; Schmidt
& Edmonds 1989: 215-217; AHC 4090, 8325,
17929, 17930, 17931, 17932, 17980-91,
18038, 18041, 18207, 18208 42513-22,
CSIRO A90, A92
Perameles gunnii Gray, T, V, Schmidt &
Edmonds 1989: 215-217; AHC 5036, 5037,
5049, 5087, 11424, 11430, 16348, 16350,
16351, 17928, 17992, 17993, 18039, 18117,
18175, 18213, 23302, 23305, 23317, 23320,
23322, 23327, 23328, 23329, 16348, 16350,
16351, 17928, CSIRO A2, Al4
Perameles nasuta Geoffroy, NSW, Q, Johnston
1910: 27, 1911: 50; Johnston & Edmonds
AUSTRALIAN ACANTHOCEPHALA CHECKLIST 61
1952: 215-217; Schmidt & Edmonds 1989:
215-217; AHC 5093, CSIRO A3, A7, A66,
QM GL14430, GL14436, G211343
Phascogale tapoatafa (Meyer), NSW, Johnston
1910: 27, 1911:50; Johnston & Edmonds
1952: 18-20; Schmidt & Edmonds 1989: 215-
217
Potorous tridactylus (Kerr), T, AHC 10069,
18577, 17995
Bandicoot, no locality data, Q, T, AHC 3394,
3395, 3404,7850, 17978, 17995, 18576.
9. Moniliformis moniliformis (Bremser, 1811)
Syns: Echinorhynchus moniliformis Bremser,
1811
E. grassi Deffke, 1891; E. canis Porta, 1914; E.
belgicus Raillet, 1918
Gigantorhynchus Hamman, 1892 pro parte
Gigantorhynchus moniliformis Porta, 1908;
Johnston, 1909b, 1909c, 1909d, 1912b, 1913,
1916; Nicoll, 1914
Hormorhynchus moniliformis Johnston, 1918a;
Fielding, 1927; Southwell & McFie, 1925
Moniliformis moniliformis Travassos, 1915, nec
M. moniliformis sensu Travassos, 1917 see
Golvan, 1994; Johnston & Edmonds, 1952
Moniliformis dubius Meyer, 1932; Johnston &
Deland, 1929; Meyer, 1933
Hosts: Rattus rattus (Linn.), NSW, Q, SA,
Johnston 1909d: 583, 1909b: 218, 590, 1909c:
81, 1912b: 83, 1916: 43; Johnston 1918a: 69;
Fielding 1927: 123; Southwell & McFie 1925:
171; Johnston & Deland 1929: 147; Johnston
& Edmonds 1952: 20-21; AHC 42507, 42508,
42510
Rattus norvegicus (Berkenhout), NSW, Q, NT,
SA, Johnston 1909b: 218, 590, 1909c: 81,
1912b: 83, 1913: 93, 1916: 43; Johnston
1918a: 69; Fielding 1927: 123; Southwell &
McFie 1925: 171; Johnston & Deland 1929:
147; Johnston & Edmonds 1952: 20-21;
Edmonds, 1989: 127; QM GL11008,
GL11068, GL11091, GL14434, AHC 2486,
3419, 42504, 42505, 42506, 42509, 42511
Rattus fuscipes (Waterhouse) Edmonds, 1989: 128
rat, Rattus spp., NSW, Q, Nicoll 1914: 4; AM
W305, W1602, QM GL11572, GL11703,
AHC 42512.
Oligocanthorhynchidae
10. Macracanthorhynchus hirudinaceus (Pallas,
1781)
Syns: Taenia haeruca Pallas, 1766 pro parte, T.
hirudinaceus Pallas, 1781
Echinorhynchus hirudinaceus Pallas 1781; E.
gigas Bloch, 1782
Gigantorhynchus hirudinaceus Porta, 1908;
Johnston, 1909a, 1909c
Homorhynchus hirudinaceus Johnston, 1918b
Gigantorhynchus gigas Meyer, 1928
Macracanthorhynchus hirudinaceus Travassos,
1917; Johnston & Deland, 1929
Host: Sus scrofa Linn.,* Q, NSW, SA, V,
Johnston 1909d: 583, 1909c: 79, 1918b: 216;
Johnston & Deland 1929: 147; AHC 1596,
2471, 3422, 8480, 15473, 18500, 18903,
19018, 22539, AM W5549, W201622,
SARDI A110.
11. Multisentis myrmecobius Smales, 1997
Host: Myrmecobius fasciatus Waterhouse,* WA,
Smales 1997: 301-307; AHC 30021, 30022,
30034-35, 30091-93, 30096.
12. Oncicola pomatostomi (Johnston & Cleland,
1911)
Syns: Echinorhynchus pomatostomi Johnston &
Cleland, 1911; Johnston & Deland, 1929
Echinorhynchus s.l. pomatostomi Petrochenko,
1958
Oligocanthorhynchus pomatostomi Tubangi, 1933
Oncicola sp. Banks, 1952; Edmonds, 1957a
Oncicola pomatostomi Schmidt, 1983
Paratenic hosts: Acanthiza chrysorrhoa (Quoy &
Gaimard), SA, WA, Mawson et al 1986: 273
Amytornis purnelli Mathews, WA, Mawson et al
1986: 272
Anthochaera carunculata (White), WA, Mawson
et al 1986: 274; AHC 4684
Anthus novaeseelandiae (Gmelin), WA, Mawson
et al 1986: 266
Aphelocephala leucopsis Gould, SA, Cleland
1922: 108; Schmidt 1983: 397-399; CSIRO
A34
Artamus cinereus Vieillot, NT, Q, Mawson et al
1986: 281; AHC 18217
Artamus superciliosus (Gould), Edmonds 1989:
128
Cinclosoma castonotus Gould, SA, Johnston &
Deland 1929: 149; Schmidt 1983: 397-399
Cinclosoma cinnamoneum Gould, SA, NT,
Johnston & Deland 1929: 149; Schmidt 1983:
397-399; Mawson et al 1986: 270; AHC 4896
Climacteris affinis (Blythe), AHC 18212
62 LR SMALES
Climacteris leucopsis, AHC 1801
Climacteris melanura Gould, WA, Mawson et al
1986: 274; Schmidt 1983: 397-399
Climacteris picumnus Temminck, SA, Cleland
1922: 108; Johnston & Deland 1929: 150;
Schmidt 1983: 397-399; AHC 5099
Colluricincla harmonica (Latham), SA, AM
W1079
Cormobates leucophaea (Latham), SA, Johnston
& Deland 1929: 151; Schmidt 1983: 397-399
Daphoenositta chrysoptera (Latham), NT, WA,
Mawson et al 1986: 273; CSIRO A40, A47
Grallina cyanoleuca (Latham), NT, Mawson et al
1986: 281; AHC 5110
Gymnorhina tibicen (Latham), NT, SA, Mawson
et al 1986: 282
Hylacola sp., no locality data, AHC 8863
Lalage leucomela (Vigors & Horsfield), NT,
Mawson et al 1986: 267
Lichenostomus plumulus (Gould), WA, Mawson
et al 1986: 276
Lichenostomus virescens (Viellot), WA, Mawson
et al 1986: 276
Malurus cyaneus (Ellis), SA, AHC 28011
Manorina flavigula (Gould), NT, SA, WA,
Mawson et al 1986: 275; CSIRO A32
Melanodryas cucullata (Latham), NT, Mawson et
al 1986: 267
Microeca leucophaea (Latham), Q, Mawson et al
1986: 268
Nycticorax caledonicus (Gmelin), Q, CSIRO A46
Oreoica gutturalis (Vigors & Horsfield), NT,
Mawson et al 1986: 269
Pachycephala inornata Gould, SA, Johnston &
Cleland 1911: 115; Schmidt 1983: 397-399
Pachycephala rufiventris (Latham) NT, Mawson
et al 1986: 268; Schmidt 1983: 397-399
Pedionomus torquatus Gould, SA, Johnston &
Deland 1929: 148; Schmidt 1983: 397-399;
AM W955
Petroica goodenovii Vigors & Horsfield, NT,
CSIRO A33
Poephila cincta (Gould), Q, Mawson et al 1986:
279
Pomatostomus halli (Cowles), Q, CSIRO AS7
Pomatostomus ruficeps (Hartlaub), SA, Johnston
& Deland 1929: 150; Schmidt 1983: 397-399;
AHC 557, 5072, CSIRO A56, SARDI A112-3
Pomatostomus superciliosus (Vigors &
Horsfield), (*paratenic), NT, Q, SA, WA,
Johnston 1910: 107; Johnston & Cleland
1911: 112; Cleland 1922: 107; Schmidt 1983:
397-399; AHC 1729, 1804, 2707, 5054, 5074,
5077, 5078, 42537, 42538, AM W293,
CSIRO A27
Pomatostomus temporalis (Vigors & Horsfield),
NSW, NT, Q, WA, Johnston & Cleland 1911:
112; Cleland 1922: 108, Mawson et al 1986:
270; Schmidt 1983: 397-399; AHC 18459,
CSIRO A104, SARDI A112-9
Sericornis brunneus (Gould), SA, WA, Johnston
& Deland 1929: 150; Mawson et al 1986: 272;
AHC 28012, 28013, AM W1080
Sericornis cautus (Gould), SA, Mawson et al
1986: 272
Sericornis fuliginosus (Vigors & Horsfield), WA,
Mawson et al 1986: 272; CSIRO A26
Sericornis pyrrhopygius (Vigors & Horsfield),
SA, Johnston & Cleland 1911: 112; Schmidt
1983: 397-399; AHC 1802
Strepera versicolor (Latham), SA, CSIRO A60
Turnix castanota (Gould), SA, Mawson et al
1986: 246; AHC 5073
Turnix velox (Gould), Q, Mawson et al 1986; 246
Zoothera dauma (Latham), Q, SA, Schmidt 1983:
397-399; AHC 3369
Zoothera lunulata (Latham), Schmidt, 1983: 397-
399
bird, SA, WA, AM W889, W1078
Definitive hosts: Felis catus Linn.,* NSW, NT,
SA, V, Schmidt 1983: 397-399; AHC 9565,
15077, 18196, 18444-48, 18460, 18462-67,
30181-93, 30438, CSIRO A12, SARDI A112 -2,
4-8
Canis familiaris dingo Blumenbach, NT,
Edmonds 1957a: 79; Schmidt 1983: 397-399;
AHC 18443,18461, SARDI A112-1.
CLASS PALAEACANTHOCEPHALA
Centrorhynchidae
13, Centrorhynchus asturinus (Johnston, 1912)
Syns: Gigantorhynchus (sensu latum)Travassos,
1917
Gigantorhynchus asturinus Johnston, 1912a, 1913
Centrorhynchus asturinus Johnston, 1918b;
Travassos, 1926; Southwell & McFie, 1925;
Johnston & Deland, 1929; Golvan, 1956a;
Petrochenko, 1958; Yamaguti, 1963 as C.
asturinum
Echinorhynchus bazae Southwell & McFie, 1925
Prosthorhynchus bazae Travassos, 1926
Gordiorhynchus falconis Johnston & Best, 1943;
Petrochenko, 1958
AUSTRALIAN ACANTHOCEPHALA CHECKLIST 63
Centrorhynchus falconis Golvan, 1956a
Hosts: Accipeter cirrocephalus (Vieillot), NSW,
Q, Southwell & McFie 1925: 163; Johnston &
Deland 1929: 148; QM GL11509
Accipeter fasciatus (Vigors & Horsefield), NSW,
NT, SA, Southwell & McFie 1925: 163;
Johnston & Deland 1929: 148; AHC 3377,
8860, 42208-09
Accipeter novaehollandiae (Gmelin),* Q,
Johnston 1912a: 108, 1913: 93; Southwell &
McFie 1925: 164; AHC 950, 42203, 42205-
07, QM GL11064, GL11213, G213458
Aviceda subcristata (Gould), NSW, Q, Johnston
1918: 215; Southwell & McFie 1925: 177;
AHC 3371
Circus approximans Peale, NSW, Q, SA,
Johnston 1918: 216; Mawson et al 1986: 244
Falco berigoria Vigors & Horsfield, NSW, NT,
Q, SA, Southwell & McFie 1925: 164;
Johnston & Deland 1929: 148; Mawson et al
1986: 245; AHC 5039, 5080, 19594, 42213-
13, QM GL11200
Falco cenchroides Vigors and Horsfield, Q, SA,
Mawson et al 1986: 246; AHC 5119, 5817,
19595
catbird or crested hawk, AHC 8874.
14. Centrorhynchus bancrofti (Johnston & Best,
1943)
Syns: Echinorhynchus sp. Johnston, 1912
Gordiorhynchus sp. Johnston, 1918;
Gordiorhynchus bancrofti Johnston & Best,
1943
Centrorhynchus bancrofti Golvan, 1956a
Presumed paratenic hosts: Antechinus agilis
Dickman et al, NSW, V, AHC 16299, CSIRO
Al17, A30, A35, A39, A43, A73, A78, A81,
A85, A86, A88
Antechinus stuartii Macleay, NSW, QM G213754
Antechnius swainsonii (Waterhouse), NSW,
CSIRO A23, A25, A72, A82, A84
Hosts: Ninox boobook (Latham), NSW, Q, SA,
Johnston 1912a: 109; Johnston 1918b: 216;
AHC 42210-11
Ninox strenua (Gould),* Q, Johnston & Best
1943: 226; Mawson et al 1986: 262; AHC
5060, 5101, 5114, 18057, CSIRO A68.
15. Centrorhynchus horridus (Linstow, 1897)
Syns: Echinorhynchus horridus Linstow, 1897,
Marval, 1905
Echinorhynchus sp. Johnston, 1910b; Johnston &
Deland, 1929
Prosthorhynchus horridus Travassos, 1926
Centorhynchus horridus Meyer, 1932; Johnston
& Edmonds, 1948, 1958; Golvan, 1956a;
Yamaguti, 1963, as C. horridum
Hosts: Dacelo novaeguineae (Hermann), Q, SA,
Mawson et al 1986: 264; AHC 941, 5098,
18044, 42224-25, QM G207576
Todiramphus macleayii (Jardine & Selby), Q,
CSIRO A65
Todiramphus sanctus (Vigor and Horsfield),* Q,
Johnston 1910b: 105; Johnston & Edmonds
1948: 69; AHC 5057, 5124, 18802, 42214-23,
QM G207319, G207575
Dacelo sp., Q, AHC 5130, 18187
kookaburra, Q, QM G207282.
16. Centrorhynchus sp. A
Host: egret, Q, single immature specimen;
proboscis armature not consistent with
described species from Australian localities,
QM G207066.
17. Centrorhynchus sp. B
Hosts: kingfisher, no locality data, AHC 5123
hawk, no locality data, AHC 5134.
18. Centrorhynchus spp.
Presumed paratenic hosts: Antechinus agilis
Dickman et al, NSW, V, CSIRO A35, A42,
A79, A87, A105
Antechinus swainsonii (Waterhouse) NSW,
CSIRO A18, A37
Phascogale tapoatafa (Meyer), NSW, CSIRO
A103
Sminthopsis leucopus (Gray), T, CSIRO A22.
Plagiorhynchidae
19. Plagiorhynchus charadrii (Yamaguti, 1939)
Syn: Prosthorhynchus charadrii Yamaguti, 1939;
Johnston & Edmonds, 1947
Plagiorhynchus charadrii Van Cleave, 1951 nec
Golvan, 1956b; Schmidt and Kuntz, 1966;
Smales, 2002b ;
Hosts: Acridotheres tristis Linn., V, Smales
2002b: 210; AHC 8648
Centropus phasianus Latham, Q, Smales
2002b: 210; AHC 1790, 1793, 1796
Charadrius alexandrius Linn., SA, T,
Smales 2002b: 210; AHC 5046, 5061, 5070
Charadrius ruficapillus Temminck, SA, T,
Mawson et al 1986: 251; AHC 5116,
18040, 18191
64 LR SMALES
Haematopus fuliginosus Gould, T, Smales 2002b:
210; AHC 7731
Haematopus longirostris Vieillot, T, Smales
2002b: 210; AHC 7730
Pachyptila tutur (Kuhl), T, Smales 2002b: 210;
AHC 8862
Thinornis rubricollis (Gmelin), V, SA, Johnston
& Edmonds 1947: 561; AHC 3362, 5075,
5083, 15595, 18779, 42426-37
Turdus merula Linn., T, Smales 2002b: 210; AHC
8876.
20. Plagiorhynchus cylindraceus (Goeze, 1782)
Syns: Echinorhynchus cylindraceus Goeze, 1782;
E. brumpti Blanc and Cauchemez, 1911; E.
pict Gmelin, 1791; E. musicapae Rudolphi,
1819; E. dimorphocephalus Westrumb, 1821;
E. obliquis Dujardin, 1845; E. pigmentatus
Marval, 1902
Centrorhynchus cylindraceus Schrank, 1788;
Travassos, 1926; Petrochenko, 1958
Prosthorhynchus Kostylev, 1915; Yamaguti, 1963
as P. cylindraceus; Golvan, 1956a, 1956b;
Edmonds, 1982
Prosthorhynchus genitopapillatus Lundstrom,
1942 see Golvan, 1994
Prosthorhynchus upupae Lopéz-Neyra, 1946
Plagiorhynchus cylindraceus Schmidt and Kuntz,
1966; Schmidt, 1981; Amin et al, 1999;
Smales, 1988, 2002b
Presumed paratenic hosts: Antechinus agilis
Dickman et al, NSW, CSIRO A74
Hydromys chrysogaster, Geoffroy; Edmonds
1989: 130; AHC 19690
Isoodon obesulus (Shaw); T, Smales 1988: 1062-
4; AHC 18827, 18988, 19013, 19014, CSIRO
A94, A9S
Isoodon macrourus (Shaw), ACT, CSIRO A93
Perameles gunnii (Gray), T, CSIRO A96
Wallabia bicolor (Desmarest), NSW, AHC 7307
Sminthopsis leucopus (Gray), V, AHC 6559
Potorous tridactylus (Kerr), T, CSIRO A108
Vulpes vulpes Linn., V, AHC 6555
Hosts: Acridotheres tristis Linn., V, Edmonds
1989: 130; AHC 18034, 23847
Corvus coronoides Vigors & Horsfield, V, Smales
2002b: 210; AHC 18812, 18825 Gallina
tenebrosa Gould, V, Smales 2002b: 210; AHC
18087
Grallina cyanoleuca (Latham), V
Gymnorhina tibicen (Latham), T, V, Smales
2002b: 210; AHC 8877, 18035, 18226, 19046
Megalurus timoriensis Wallace, Johnston &
Deland 1929: 150; doubtful record
Sturnus vulgaris Linn., T, V, Smales 2002b: 210;
AHC 18186, 18203, 19426, 23849
Threskiornis molucca (Cuvier), T, Smales
2002b: 210; AHC 18182, 18205
Turdus merula Linn., T, V, Edmonds 1989: 130;
AHC 8879, 10011, 11381, 18033, 23850,
23851
Vanellus miles (Boddaert), T, V, Smales 2002b:
210; AHC 18021
Zoothera lunulata (Latham), V, AHC 32105
pigeon, Schmidt 1981: 597; AHC 23848
Hydromys chrysogaster Geoffroy; T, AHC 18183,
18209
Perameles gunnii (Gray), T, Smales 1988: 1062-
64; AHC 18184, 18206, 19012
21. Plagiorhynchus menurae (Johnston, 1912)
Syns: Echinorhynchus menurae Johnston, 1912b
Prosthorhynchus menurae Travassos, 1926;
Meyer, 1933; Johnston & Best, 1943;
Petrochenko, 1958, attributed in error to
Schaston, 1912
Plagiorhynchus menurae Golvan, 1956; Schmidt
and Kuntz, 1966; Smales, 2002b
Hosts: Menura alberti Bonaparte, NSW, Smales
2002b: 21; CSIRO A100, A101
Menura novaehollandiae Latham,* NSW, V,
Johnston 1912b: 88; Johnston & Best 1943:
226; AHC 6552, 17951, 17952, 17976, 18045,
18575, 22934, 32135, 42438-41, CSIRO ASO,
AS1, A52, A69, A70, A71, A89, A91.
22. Plagiorhynchus sp. Smales, 2002: 210
Hosts: Psophodes olivaceus (Latham), NSW,
CSIRO A55
Ptiloris victoriae Gould, Q, CSIRO A63.
23. Plagiorhynchus spp.
Possibly P. cylindraceus but cyst forms difficult
to determine with certainty
Presumed paratenic hosts: Antechinus agilis
Dickman et al, NSW, CSIRO A24, A41
Antechinus stuartii Macleay, NSW, QM GL
12584 slide no 213755
Isoodon macrourus (Shaw), ACT, CSIRO A98
Isoodon obesulus (Shaw), ACT, CSIRO A95
Sminthopsis leucopis, NSW, CSIRO A19.
24. Porrorchis hylae (Johnston, 1914)
Syns: Echinorhynchus sp. Johnston, 1912b
AUSTRALIAN ACANTHOCEPHALA CHECKLIST 65
Echinorhynchus hylae Johnston, 1914;
Petrochenko, 1958 as Echinorhynchus s.l.
hylae; E. bulbocaudatus Southwell & McFie,
1925; Johnston and Deland, 1929; E.
centropusi Tubangi, 1933
Prosthorhynchus bulbocaudatus Travassos, 1926
Gordiorhynchus hylae Johnston and Edmonds,
1948
Pseudoporrorchis hylae Joyeaux and Baer, 1935;
Edmonds, 1957a
Porrorchis hylae Schmidt & Kuntz, 1967; Smales,
2002b
Presumed paratenic host: Antechinus stuartii
Macleay, NSW, QM GL 12584 Slide No
213753, GL12593
Hosts: Burrhinus grallarius (Latham), Q, Smales
2002b: 210; QM G207024
Centropus phasianus (Latham),* NT, Q, WA,
AHC 5064, 5103, 5121, 18216, 18838 CSIRO
A64, QM GL11402, G207272, G207473;
Johnston & Deland 1929: 149; Edmonds
1957a: 76; Mawson et al 1986: 262; Smales
2002b: 210
Podargus strigoides (Latham), NT, Q, SA,
Johnston & Edmonds 1948: 74; Mawson et al
1986: 263; Smales 2002b: 210; AHC 857,
3411 (listed as types in the register but the
species was first described from C.
phasianus), 4606, 5084, 5129, 6553, 6562,
11214 15221, 18211, 18218, 18220, 18221,
42542-47, QM G207057, G207103, G207193.
25. Porrorchis hydromuris (Edmonds, 1957)
Syns: Pseudoporrorchis hydromuris Edmonds,
1957a
Porrorchis hydromuris Schmidt and Kuntz, 1967;
Smales, 2002b
Hosts: Hydromys chrysogaster Geoffroy,* Q,
Edmonds 1957a: 77; Smales 2002b: 210;
AHC 3398, 3402,5056, 5079, QM GL14411,
GL14432, GL14435, GL14460-63, GL14466
rat, QM GL14374.
26. Porrorchis sp.
Host: Felis catus Linn., NSW, possibly Q, Smales
2002b: 210; AHC 3414, QM GL12464.
Polymorphidae
27. Andracantha clavata (Goss, 1940)
Syns: Corynosoma clavatum Goss, 1940;
Johnston & Best, 1942; Johnston & Edmonds,
1953; Edmonds, 1955, 1957; Zdzitowiecki,
1986a, 1986b; Edmonds, 1989
Andracantha clavata: Zdzitowiecki, 1989, 1991
Hosts: Cygnus atratus (Latham), SA, AHC 3002,
3016
Eudyptula minor (Forster), V
Leucocarbo atriceps (King), Heard Is., Macquarie
Is., Edmonds 1955: 141, 1957: 96; AHC
18021, CSIRO A20
Leucocarbo colensoi Buller, Auckland Is.,
Campbell Is., Johnston & Edmonds 1953: 59
Leucocarbo fuscescens Viellot, SA, AHC 5058,
11213
Phalacrocorax melanoleucos Viellot, V, SA, WA,
Goss 1940: 12; Mawson et al 1986: 232; AHC
3384
Phalacrocorax sulcirostris (Brandt), SA, WA,
Goss 1940: 12; Mawson et al 1986: 231; AHC
18359
Phalacrocorax varius (Gmelin),* SA, WA, Goss
1940: 12; Johnston & Best 1942: 252; AHC
2698, 15434, 42274
Phalacrocorax verrucosus (Cabanis), Kerguelen
Is., Edmonds 1957b: 96
Phalacrocorax sp. Macquarie Is., AHC 18468
shag, WA, Goss 1940: 12-13; WAM WA73-83
Accidental host: Arctocephalus pusillus
(Schreber), SA, Johnston & Best 1942: 253;
AHC 22536.
28. Andracantha sp.
Identified as Corynosoma phalacrocoracis
Yamaguti, 1939: 337-338 now
Andracantha phalacrocoracis, Schmidt,
1975: 618-619. Specimens possibly
collected on the British, Australian and
New Zealand Antarctic Expedition of
1929-31. Probosces missing, therefore
identification can’t be confirmed.
Host: Leucocarbo atriceps (King), ‘Antarctic’
AHC 22639.
29. Arthmorhynchus johnstoni Golvan, 1960
Syns: Arythmorhynchus frassoni Johnston &
Edmonds, 1951
Arythmorhynchus johnstoni Golvan, 1960;
Edmonds, 1971
Host: Numenius madagascarensis (Linn.),* Q,
Johnston & Edmonds 1951: 3; Edmonds 1971:
60; AHC 22554, 42183, 42184, AM W4571,
QM GL11209 (specimen missing).
30. Arythmorhynchus limosae Edmonds, 1971
Host: Limosa lapponica (Linn.),* Q, Edmonds
1971: 58; AHC 42185-89, QM GL12403,
66 LR SMALES
GL12406, GL12415, GL12445, G213743,
G213744.
31. Bolbosoma baleanae (Gmelin, 1790)
Syns: Sipunculus lendix Phipps, 1774
Echinorhynchus balaenae Gmelin, 1790, E.
porrigens Rudolphi, 1814; E. mysticeti
Beneden, 1870
Bolbosoma balanae Van Cleave, 1953 in error,
see Golvan, 1994
Bolbosoma porrigens Johnston & Deland, 1929;
Meyer, 1932
Bolbosoma balaenae Petrochenko,
Zdzitowiecki, 1991
Hosts: Balenoptera acutorostrata Lacépéde,
Antarctic/ Pacific, AHC 30160, 30162
Globiocephala melas (Traill), SA, AHC
3423
whale probably Megaptera novaeangliae
(Borowski), NSW, Johnston & Deland 1929:
147; AHC 3423, 22544, AM G11124.
1958;
32. Bolbosoma capitatum (Linstow, 1880)
Syns: Echinorhynchus capitatus Linstow, 1880
Bolborhynchus capitatus Porta, 1906
Bolbosoma capitatum Porta, 1908; Meyer, 1932;
Edmonds, 1957a, 1987; Amin & Margolis,
1998
Hosts: Balaenoptera musculus Linn., SA, AHC
18826
Globicephala melas (Traill) Globicephala sp., T,
SA, Edmonds 1957a:78; AHC 11432
Pseudorca crassidens Owen, WA, SA, Edmonds
1957a: 78, 1987: 317; AHC 16308, 17979,
30159, WAM WA405-86
Physeter catodon Linn., T, AHC 10571
Accidental hosts: Arctocephalus foresteri
(Lesson), SA, AHC 19697
Arctocephalus pusillus doriferus (Schreber), V, T,
AHC 32114, 32126, 32132.
33. Bolbosoma turbinella (Diesing, 1851)
Syns: Echinorhynchus balaenocephalus Owen,
1803 see Golvan, 1994; E. turbinella Diesing,
1851
Bolborhynchus turbinella Porta, 1906
Pomphorhynchus turbinella Lieper & Atkinson,
1915 see Yamaguti, 1963
Bolbosoma turbinella Porta, 1908; Travassos,
1926; Baylis, 1929; Zdzitowiecki, 1991
Host: Balaenoptera musculus Linn., SA, AHC
18826.
34. Bolbosoma vasculosum (Rudolphi, 1819)
Syns: Echinorhynchus vasculosus Rudolphi,
1819; E. auranticus Risso, 1826; Diesing,
1851; E. pellucidus Leukart, 1828; E.
annulatus Molin, 1858; E. serrani Linton,
1888, juvenile worm, may be synonym, see
Golvan, 1994; E. bifasciatus Liihe, 1904
Bolbosoma aurantiacum Van Cleave, 1924;
Travassos, 1926
Bolbosoma vasculosum Porta, 1908: 273-274;
Petrochenko, 1958
Host: Mesoplodon bowdoini (Andrews), NT, SA,
AHC 30133
Accidental host: Arctocephalus pusillus doriferus
(Schreber) T, AHC 32106.
35. Bolbosoma sp.
Host: Pseudorca crassidens (Owen), no locality
data, AHC 30351
36. Corynosoma arctocephali Zdzitowiecki, 1984
Corynosoma singularis Skryabin & Nikolsky,
1971 pro parte; Hoberg, 1986
Corynosoma arctocephali Zdzitowiecki 1984a,
1986a, 1991; Hoberg, 1986
Host: Arctocephalus pusillus doriferus (Schreber),
Heard Island, AHC 12773.
37. Corynosoma australe Johnston, 1937
Syns: Corynosoma otarinae Morini & Boreo,
1960
Corynosoma australe Johnston, 1937; Johnston &
Edmonds, 1953; Vargara & George-
Nacimento, 1982; Zdzitowiecki, 1984a,
1986a, 1989; Smales, 1986; Pereira & de
Matos Neves, 1993
Hosts: Arctocephalus forsteri (Lesson), SA, AHC
19589, 30107, 41273
Arctocephalus pusillus doriferus (Schreber), V,
SA, AHC 10047, 18763, 18886, 18941,
18945, 18947, 19119, 19384, 22345, 30107,
30134, 32115, 32129
Arctocephalus tropicalis (Gray), V (Zoo), SA,
AHC 22972, 32108
Arctocephalus sp., SA, AHC 18931, 18934
Hydrurga leptonyx (Blainville) Auckland Is.,
Campbell Is., Johnston & Edmonds 1953: 58;
Smales 1986: 94; AHC 42235, 42236
Mesoplodon layardi (Gray), SA, AHC 24768
Neophoca cinerea (Peron),* SA, Johnston 1937:
13; Smales 1986: 94; AHC 15474, 22824,
23088, 30114, 31367, 42226-29, 42237,
32115, 32116, 32119
AUSTRALIAN ACANTHOCEPHALA CHECKLIST 67
Phocarctos hookeri (Gray); Auckland Is.,
Campbell Is., Johnston & Edmonds 1953: 58;
Smales 1986: 94; AHC 42231-34
Tursiops truncatus Montagu, V, AHC 24757,
32121
Accidental hosts: Eudyptula minor Forster, V
Leucocarbo atriceps (King), Heard Is., AHC
42279, 42280.
38. Corynosoma bullosum (Linstow, 1892)
Syns: Corynosoma mirabilis Skryabin, 1966
Echinorhynchus bullosus Linstow, 1892;
Corynosoma strumosum sensu Gower, 1939 see
Yamaguti, 1963
Corynosoma singularis Skryabin & Nickolsky,
1971, pro parte
Corynosoma bullosum Raillet & Henry, 1907;
Baylis, 1929; Travassos, 1926; Johnston &
Edmonds, 1953; Edmonds, 1955, 1957b;
Zdzitowiecki, 1984a, 1986a, 1991; Hoberg,
1986
Hosts: Mirouga leonina Linn.,* Crozet Is., Heard
Is., Macquarie Is., Marion Is., Johnston &
Edmonds 1953: 55; Edmonds 1995: 142;
Edmonds 1957b: 96; AHC 3396, 3804-10,
32107, 32131, 42240-65
Hydrurga leptonyx (Blainville), Heard Is., QM
G213756-63
Accidental host: Delphinus delphis Linn., WA,
AHC 18883.
39. Corynosoma cetaceum Johnston & Best,
1942
Syns: Echinorhynchus sp. Krefft, 1871
Corynosoma sp. Johnston & Deland, 1929
Corynosoma cetaceum Johnston & Best, 1942;
Figueroa & Puga, 1990; Aznar et al, 1999
Polymorphus cetaceus Schmidt & Dailey, 1971
Polymorphus arctocephali Smales, 1986;
Edmonds, 1989
Hosts: Arctocephalus pusillus doriferus
(Schreber), SA, V, Smales 1986: 97-99; Aznar
et al 1999: 59-70; AHC 13787, 14835, 23344,
33112, 32128, 32130, 32132, 32109, 32110,
43654-57
Delphinus delphis Linn.,* SA, V, Johnston &
Deland 1929: 149; Johnston & Best 1942:
250; AHC 3418, 18883, 30157, 40963, 40964,
42266-71
Hydrurga leptonyx (Blainville), V (Zoo)
Leptonychotes weddelli (Lesson), Antarctic, AHC
18025
Tursiops truncatus (Montagu), SA, V, Johnston &
Best 1942: 250; AHC 1778, 3602, 18362,
18678, 18743, 18949, 18951, 18970, 19646,
19950, 19952, 19959, 22831, 22838, 22839,
24757, 26198, 30111, 30144, 30145, 30156,
30328, 30331 30332, 32122-24, 32111,
32117, 32121, 32125, 32127, 42272, 42273
seal, Q (Zoo), QM G207090.
40. Corynosoma pseudohammani Zdzitowiecki,
1984
Syns: Corynosoma antarcticum Johnston & Best,
1937 nec C. antarcticum Rennie, 1906
Corynosoma hammani Edmonds, 1957b, possibly
a mixed infection of C. hammani and C.
pseudohammani, see Zdzitowiecki, 1984b
Corynosoma pseudohammani Zdzitowiecki,
1984b, 1986a, 1991; Hoberg, 1986
Hosts: Leptonychotes weddelli (Lesson),* Adelie
Land, Enderby Land, Johnston & Best
1937:10-12; Edmonds 1957b: 96; AHC
18020, 42238, 42239, 42291-93, 42296,
42297, AM W2872
Hydrurga leptonyx Blaineville, No locality data,
AHC 42298, 42299.
41. Corynosoma shakletoni Zdzitowiecki, 1978
Host: Pygoscelis papua Forster, Macquarie Is.,
Edmonds 1955: 141; Zdzitowiecki 1985: 11;
Hoberg 1986: 202; AHC 5067, CSIRO A38.
42. Corynosoma stanleyi Smales, 1986
Hosts: Hydromys chrysogaster Geoffroy,* Q, T,
V, Smales 1986: 92-94; Smales & Cribb 1997:
449-450; AHC 8878, 15642, 15643, 15660,
18163, 18768, 22343, 27791, 27792, 30432,
43539, 43540.
43. Polymorphus biziurae Johnston & Edmonds,
1948
Nickol, Crompton & Searle, 1999 [Nickol et al
comment generic assignment of P. biziurae is
difficult because the putative intermediate host
is a crustacean]
Hosts: Biziura lobata (Shaw),* NSW, SA,
Johnston & Edmonds, 1948: 71-74; AHC 625,
3375, 3387, 3424, 5106, 7489, 19404, 42443-
47, 424450-59
Cygnus atratus (Latham), SA, Mawson et al,
1986: 238; AHC 3391
Pelicanus conspicillatus Temminck, SA, Mawson
et al 1986: 228
Phalacrocorax sulcirostris (Brandt), SA, AHC
3382, 42449
68 LR SMALES
Phalacrocorax melanoleucos (Vieillot), SA, AHC
3384, 3389
Platalea flavipes Gould, SA, V, AHC 3388,
24061, 42455, 42457
Larus novaehollandiae Stephens, SA, AHC 3385
Threskiornis molucca (Latham), SA, T, AHC
3383, 3390, 5050, 13292, 42448, 42545,
42458.
44. Polymorphus brevis (Van Cleave, 1916)
Syn: Arythmorhynchus brevis Van Cleave, 1916b,
1945; Travassos, 1926; Golvan, 1960; Amin,
1985 as A. breve
Polymorphus brevis Meyer, 1933; Amin, 1992
Host: Botaurus poiciloptilus Wagler, Q, QM
GL11394, specimens missing from QM,
identification could not be confirmed.
45. Profilicollis sphaerocephalus (Bremser,
1811)
Syns: Echinorhynchus sphaerocephalus Bremser,
1811 in Rudolphi, 1819; E. haematopodis
Rudolphi, 1819; E. lari Rudolphi, 1819 see
Yamaguti, 1963
Filicollis sphaerocephalus Travassos, 1926;
Golvan, 1960
Polymorphus sphaerocephalus Van Cleave, 1947;
Webster, 1948; Schmidt & Kuntz, 1967;
Amin, 1992
Parafilicollis sphaerocephalus Petrochenko, 1958
Falsificollis sphaerocephalus Yamaguti, 1963
Profilicollis sphaerocephalus Khoklova, 1974;
Golvan, 1994: 17; Nickol, Crompton &
Searle, 1999
Hosts: Bizuria lobata (Shaw), SA, AHC 2988
Haematopus fuliginosus Gould, SA, AHC 5047,
18036, 18050 CSIRO A59
Haematopus sp., AHC 42307-14
Larus novaehollandiae Stephens, SA, T, AHC
296, 1873, 3364, 3372, 18049, 18210, 42305,
42306
Larus pacificus Latham, SA, CSIRO A58
Pelicanus conspicillatus Temmink, SA, AHC
3386
Phalacrocorax melanoleucos (Vieillot), SA, AHC
2662.
Rhadinorhynchidae
46. Rhadinorhynchus johnstoni Golvan, 1969
Rhadinorhynchus pristis Johnston & Edmonds,
1947
Rhadinorhynchus johnstoni Golvan, 1969
Accidental host: dolphin, NSW, Johnston &
Edmonds 1947: 17; AHC 19948.
Species inquirenda
No specimens or further reference corresponding
to these records can now be found.
1. Echinorhynchus sp.
Krefft, 1871: 212; Johnston & Deland, 1929: 147
Host: Delphinus forsteri Gray; probably D.
delphis Linn.
2. Echinorhynchus sp.
Johnston, 1912: 109; Johnston & Deland, 1929:
149
Host: Eurystomus orientalis
3. Echinorhynchus sp.
Johnston, 1910: 111; Johnston & Deland, 1929:
151
Host: Phylidonyris novaehollandiae (Latham) as
Meliornis novaehollandiae
4. Echinorhynchus sp.
Johnston, 1910: 107; Cleland, 1922: 108
Host: Psophodes olivaceus
5. ‘Echinorhynch’
Cleland, 1922: 108
Host: Myiagra inquieta (Latham).
Acanthocephala
The following bird hosts are listed in Mawson et
al 1986 as being infected with acanthocephalans
but the material was listed as unidentifiable and
has not been retained in any museum collection
for further study.
Hosts: Calidris ruficollis (Pallas), Coturnix
ypsilophora Bosc, Egretta alba Linn.,
Entomyzon cyanotis (Latham), Falco
longipennis Swainson, Hiraaetus
morphnoides Gould, Hydroprogne caspia
(Pallas), Macrorectes giganteus Gmelin,
Oxyura australis Gould, Peltohyas australis
Gould, Platalea regia Gould, Rallus
Philipensis Linn., Sterna nereis (Gould),
Tringa terek (Latham), Vanellus tricolor
(Vieillot).
AUSTRALIAN ACANTHOCEPHALA CHECKLIST
Host—ParasitTE List
MAMMALIA
Eutheria
Muridae
Hydromys chrysogaster
water rat
R. fuscipes
bush rat
R. norvegicus
brown rat
and as E. rattus
Rattus rattus
black rat
and as Epimys rattus
Rattus sp.
rat
Suidae
Sus scofa
pig
Felidae
Felis catus
feral cat
Canidae
Canis lupus dingo
dingo
as C. familiaris dingo
Vulpes vulpes
fox
Otariidae
Arctocephalus forsteri
New Zealand fur seal
(in error as type host
for C. australe)
A. pusillus
Australian fur seal
and as Gypsophoca dorifera
A. tropicalis
sub-Antarctic fur seal
Arctocephalus sp.
Neophoca cinerea
Australian sea lion
Phocarctos hookeri
New Zealand sea lion
Corynosoma stanleyi
Plagiorhynchus cylindraceus
Porrorchis hydromuris
Moniliformis moniliformis
Moniliformis moniliformis
Moniliformis moniliformis
Moniliformis moniliformis
Macranthorhynchus hirudinaceus
Oncicola pomatostomi
Porrorchis sp.
Oncicola pomatostomi
Plagiorhynchus cylindraceus
Bolbosoma capitatum
Corynosoma australe
Andracantha clavata
Bolbosoma capitatum
Bolbosoma vasculosum
Corynosoma arctocephali
Corynosoma australe
Corynosoma cetaceum
Corynosoma australe
Corynosoma australe
Corynosoma australe
Corynosoma australe
70 LR SMALES
Phocidea
Hydruga leptonyx
leopard seal
Leptonychotes weddellii
Weddell’s seal
Mirouga leonina
southern sea elephant
Ziphidae
Mesoplodon bowdoini
Andrew’s beaked whale
Mesoplodon layardii
strap toothed beaked whale
Balaenopteridae
Balaenoptera auctostrata
minke whale
Balaenoptera musculus
blue whale
Megaptera novaeanglae
humpbacked whale
as ‘whale’ possibly Megaptera nodosa
Delphinidae
Delphinus delphis
common dolphin
as Delphinus forsteri
Rhadinorhynchus johnstoni
Globiocephalas melas
long finned pilot whale
as Globiocephalas melaena
Globiocephala sp.
pilot whale
Pseudorca crassidens
false killer whale
Tursiops truncatus
bottle nosed dolphin
Physeteridae
Physeter catodon
sperm whale
MARSUPIALIA
Dasyuridae
Antechinus agilis
agile antechinus
Antechinus stuartii
brown antechinus
Corynosoma australe
Corynosoma bullosum
Corynosoma cetaceum
Corynosoma pseudohammani
Corynosoma cetaceam
Corynosoma pseudohammani
Corynosoma bullosum
Bolbosoma vasculosum
Corynosoma australe
Bolbosoma balaenae
Bolbosoma capitatum
Bolbosoma turbinella
Bolbosoma balaenae
Bolbosoma balaenae
Corynosoma cetaceum
Echinorhynchus sp.
Bolbosoma balaenae
Bolbosoma capitatum
Bolbosoma capitatum
Corynosoma australe
Corynosoma cetaceum
Bolbosoma capitatum
Australiformis semoni
Centrorhynchus bancrofti
Centrorhynchus sp.
Plagiorhynchus cylindraceus
Australiformis semoni
Centrorhynchus bancrofti
Plagiorhynchus sp.
Porrorchis hylae
AUSTRALIAN ACANTHOCEPHALA CHECKLIST 71
Antechinus swansonii
dusky antechinus
Phascogale tapoatafa
brush-tailed phascogale
as Phascogale penicillata
but may be Bettongia penicillata
Sminthopsis leucopus
white-footed dunnart
Peramelidae
Isoodon obesulus
southern brown bandicoot
I. macrourus
northern brown bandicoot
P. gunnii
eastern barred bandicoot
Perameles nasuta
long-nosed bandicoot
bandicoot
Potorodidae
Potorous tridactylus
long-nosed potoroo
Notorictidae
Myrmecobius fasciatus
numbat
Macropodidae
Wallabia bicolour
swamp wallaby
Spheniscidae
Eudyptula minor
little penguin
Pygoscelis papua
gentoo penguin
Phalacrocoracidae
Leucocarbo atriceps
blue eyed cormorant
as Phalacrocorax atriceps
Leucarbo colensoi
as Phalacrocorax colensoi
Auckland Island shag
Leucarbo fuscescens
black faced shag
as Phalacrocorax fuscescens
Phalacrocorax melanoleucos
little pied cormorant
AVES
Centrorhynchus bancrofti
Centrorhynchus sp.
Australformis semoni
Centrorhynchus sp.
Centrorhynchus sp.
Plagiorhynchus cylindraceus
Plagiorhynchus sp.
Australiformis semoni
Plagiorhynchus cylindraceus
Australiformis semoni
Mediorhynchus sp. larvae
Plagiorhynchus cylindraceus
Plagiorhynchus sp.
Australiformis semoni
Plagiorhynchus cylindraceus
Australiformis semoni
Australiformis semoni
Australiformis semoni
Plagiorhynchus cylindraceus
Multisentis myrmecobius
Plagiorhynchus cylindraceus
Andracantha clavata
Corynosoma australe
Corynosoma shakletoni
Andracantha clavata
Corynosoma australe
Andracantha sp.
Andracantha clavata
Andracantha clavata
Andracantha clavata
Polymorphus biziurae
Profilicollis sphaerocephalus
72 LR SMALES
Phalacrocorax sulcirostris
little black cormorant
as P. microcarbo
Phalacrocorax varius
pied cormorant
Phalacrocorax verrucosus
Kerguelen shag
Phalacrocorax sp.
Pelicanidae
Pelicanus conspicillatus
Australian pelican
Procellaridae
Pactyptila turtur
fairy prion
Ardeidae
Botaurus poicilopitus
Australasian bittern
Nycticorax caledonicus
rufous night heron ‘egret’
Plataleidae
Platalea flavipes
yellow spoonbill
Threskiornis molucca
sacred ibis
as Threskiornis aethiopica
Accipitidae
Accipiter cirrocephalus
collared sparrowhawk
Accipiter fasciatus
brown goshawk
Accipiter novaehollandiae
grey goshawk
as Astur novaehollandiae
and as Astur cinereus
Aviceda subcristata
Pacific baza
as Baza subcristata
Circius approximans
swamp harrier
hawk
Turnicidae
Turnix castanota
chestnut backed button quail
Turnix velox
little button quail
Falconidae
Falco berigoria
brown falcon
Andracantha clavata
Polymorphus biziurae
Centrorhynchus sp.
Andracantha clavata
Andracantha clavata.
Andracantha clavata
Polymorphus biziurae
Profilicollis sphaerocephalus
Plagiorhynchus charadrii
Polymorphus brevis
Oncicola pomatostomi
Centrorhynchus sp. A
Polymorphus biziurae
Polymorphus biziurae
Plagiorhynchus cylindraceus
Centrorhynchus asturinus
Centrorhynchus asturinus
Centrorhynchus asturinus
Centrorhynchus asturinus
Centrorhynchus asturinus
Centrorhynchus sp.
Oncicola pomatostomi
Oncicola pomatostomi
Centrorhynchus asturinus
AUSTRALIAN ACANTHOCEPHALA CHECKLIST
Falco cenchroides
Australian kestrel
Anatidae
Biziura lobata
musk duck
Cygnus atratus
black swan
Megapodiidae
Alectura lathami
Australian brush turkey
and as Catheturus lathami
Rallidae
Gallinula tenebrosa
dusky moorhen
Pedionomidae
Pedionomus torquatus
plains wanderer
Haematopodidae
Haematopus fuliginosus
sooty oystercatcher
Haematopus longirostra
pied oystercatcher
Haematopus sp.
Glaeolidae
Stiltia isabella
Australian pratincole
Burhinidae
Burhinus grallarius
bush thick-knee
Charadriidae
Chardris ruficapillus
red capped plover
as C. alexandrinus
Thinornis rubricollis
hooded plover
as Charadrius rubricollis
and C. cuculatus hooded dottrel
Vanellus miles
masked lapwing
Scolopacidae
Limosa laponica
bar-tailed godwit
Numenius madagascarensis
eastern curlew
as Numenius cyanopus
Centrorhynchus asturinus
Polymorphus biziurae
Profilicollis sphaerocephalus
Andracantha clavata
Polymorphus biziurae
Mediorhynchus alecturae
Plagiorhynchus cylindraceus
Oncicola pomatostomi
Plagiorhynchus charadrii
Plagiorhynchus charadrii
Profilicollis sphaerocephalus
Profilicollis sphaerocephalus
Mediorhynchus sp.
Porrorchis hylae
Plagiorhynchus charadrii
Plagiorhynchus charadrii
Plagiorhynchus cylindraceus
Arythmorhynchus limosae
Arythmorhynchus johnstoni
73
74
Laridae
Larus dominicanus
kelp gull
Larus novaehollandiae
silver gull
Larus pacificus
Pacific gull
gull
Cuculidae
Centropus phasianus
pheasant coucal
Strigidae
Ninox boobook
southern boobook
LR SMALES
as Ninox novaseelandia
Ninox strenua
powerful owl
Podargidae
Podargus strigoides
tawny frogmouth
Alcedinidae
Dacelo novaeguineae
laughing kookaburra
Dacelo sp.
T. macleayii
forest kingfisher
Todiramphus sanctus
sacred kingfisher
kingfisher
Campephagidae
Lalage leucomela
varied triller
Menuridae
Menura alberti
Albert’s lyrebird
Menura novaehollandiae
superb lyrebird
Motacillidae
Anthus novaeseelandiae
Richard’s pipit
Muspicidae
Melanodryas cucullata
hooded robin
Microeca leucophaea
jacky winter
Turdus merula
European blackbird
Corynosoma shakletoni
Polymorphus biziurae
Profilicollis sphaerocephalus
Profilicollis sphaerocephalus
Mediorhynchus sp. B
Plagiorhynchus charadrii
Porrorchis hylae
Centrorhynchus bancrofti
Centrorhynchus bancrofti
Porrorchis hylae
Centrorhynchus horridus
Centrorhynchus horridus
Centrorhynchus horridus
Centrorhynchus horridus
Centrorhynchus sp.
Oncicola pomatostomi
Plagiorhynchus menurae
Plagiorhynchus menurae
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Plagiorhynchus charadrii
AUSTRALIAN ACANTHOCEPHALA CHECKLIST
Zoothera dauma
white thrush
Zoothera lunulata
Bassian thrush
as Orecincla lunulata
Pachycephalidae
Colluricincla harmonica
grey shrike thrush
Oreoica gutturalis
crested bellbird
Pachycephala inornata
Gilbert’s whistler
Pachycephala rufiventris
rufous whistler
Rhipidura leucophrys
willie wag tail
Orthonychidae
Cinclosoma castonotus
chestnut quail thrush
as C. castaneum
Cinclosoma cinomomeum
cinnamon quail thrush
Petroica goodenovii
red capped robin
Psophodes olivaceus
eastern whipbird
Pomatostomatidae
Pomatostomus halli
Hall’s babbler
Pomatostomus ruficeps
chestnut crowned babbler
Pomatostomus superciliosus
white-browed babbler
Pomatostomus temporalis
grey crowned babbler
and as P. rubeculus
Sylviidae
Megalurus timorensis
tawny grassbird
Plocidae
Poephila cincta
black throated finch
Meliphagidae
Acanthagenys rufogularis
spiny cheeked honeyeater ~
Acanthochoera carunculata
red wattle bird
Acanthochoera chrysoptera
brush wattle bird
Oncicola pomatostomi
Oncicola pomatostomi
Plagiorhynchus cylindraceus
Oncicola pomatostomi
Mediorhynchus colluricinclae
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Mediorhynchus colluricinclae
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Plagiorhynchus sp.
Oncicola pomatostomi
Oncicola pomatostomi
Mediorhynchus coluricinclae
Oncicola pomatostomi
Oncicola pomatostomi
Plagiorhynchus cylindraceus
Oncicola pomatostomi
Mediorhynchus sp. B
Oncicola pomatostomi
Mediorhynchus alecturae
Mediorhynchus colluricinclae
1D
76 LR SMALES
Licheostomus plumulus
grey fronted honeyeater
Licheostomus virescens
singing honeyeater
Manorina flavigula
yellow throated miner
Sturnidae
Acridotheres tristis
common mynah
Sturnus vulgaris
common starling
Paradisaedae
Ptiloris victoriae
Victoria’s riflebird
Maluridae
Amytornis purnelli
dusky grasswren
Malurus cyaneus
superb fairy wren
Acanthizidae
Acanthiza chrysorrhoa
yellow rumped thornbill
Aphelocephala leucopis
southern white face
and as Climacteris leucopsis
Serricornis brunneus
red throat
as Pyrrhadaemus brunneus
Serricornis cautus
shy hylacola
Serricornis fuliginosus
calamanthus
Serricornis pyrrhopygius
chestnut rumped hyacola
as Hyacola pyrrhopygius
‘hylacola’
Neosittidae
Daphoenositta chrysoptera
varied sitella
Climacteridae
Climacteris affinis
white browed tree creeper
C. melanura
black tailed tree creeper
as C. wellsi
C. picumnus
brown tree creeper
Cormobates leucophaea
white throated tree creeper
as Climacteris leucophaea
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Plagiorhynchus cylindraceus
Plagiorhynchus charadrii
Plagiorhynchus cylindraceus
Plagiorhynchus sp.
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
AUSTRALIAN ACANTHOCEPHALA CHECKLIST 77
Corcoracidae
Corcorax melanoramphas
white winged chough
Grallinidae
Grallina cyanoleuca
Australian magpie-lark
Artamidae
Artamus cinereus
black faced wood swallow
Artamus superciliosus
white browed wood swallow
Cractidae
Gymnorhina tibicen
Australian magpie
Strepera versicolor
grey currawong
Corvidae
C. bennetti
little crow
Corvus coronoides
Australian raven
C. mellori
little raven
C. tasmanicus
forest raven
Corvus sp.
Mediorhynchus corcoracis
Mediorhynchus robustus
Mediorhynchus corcoracis
Oncicola pomatostomi
Plagiorhynchus cylindraceus
Oncicla pomatostomi
Oncicola pomatostomi
Oncicola pomatostomi
Plagiorhynchus cylindraceus
Oncicola pomatostomi
Mediorhynchus corcoracis
Mediorhynchus corcoracis
Plagiorhynchus cylindraceus
Mediorhynchus corcoracis
Mediorhynchus corcoracis
Mediorhynchus corcoracis
ACKNOWLEDGMENTS
My thanks to L. Cannon, QM; P. Berents, AM; J.
Forrest, S. Pichelin, C. Kemper, SAM; M. O’Callaghan,
SARDI; D. Spratt, CSIRO who gave me access to their
museum collections and provided useful information
about specimens; and to R. Norman, P. Duigan and S.
McDonald who generously donated specimens. This
project was supported by the Australian Biological
Resources Study.
REFERENCES
Amin, OM. 1985. Classification. Jn D.W.T. Crompton
& B.B. Nickol (eds) ‘Biology of The
Acanthocephala’ chap. 4, pp 27-72. Cambridge
University Press: Cambridge.
Amin, OM. 1987. Key to the families and sub-families
of Acanthocephala, with the erection of a new class
(Polyacanthocephala) and a new _ order
(Polyacanthorhynchida). J. Parasit. 73: 1216-1219.
Amin, OM. 1992. Review of the Genus Polymorphus
Luhe, 1911 (Acanthocephala: Polymorphidae), with
the synonymization of Hexaglandula Petrochenko,
1050 and Subcorynosoma Hoklova, 1967, and a key
to the species. Qatar Univ. Sci. J. 12: 115-123.
Amin, OM & Margolis, L. 1998. Redescription of
Bolbosoma capitatum (Acanthocephala:
Polymorphidae) from False Killer Whale off
Vancouver Island, with taxonomic reconsideration of
the species and synonomy of B. physeteris. J. Helm.
Soc. Wash. 65: 179-188.
Amin, OM, Canaris, OG & Kinsella, JM. 1999. A
taxonomic reconsideration of the genus
Plagiorhynchus _ s.lat. (Acanthocephala:
78 LR SMALES
Plagiorhynchidae), with descriptions of South
African Plagiorhynchus (Prosthorhynchus)
cylindraceus from shore birds and P.(P.)
malayensis and a key to the species of the
subgenus Prosthorhynchus. J. Helm. Soc.Wash.
66: 123-132.
Aznar, FJ, Bush, AO & Raga, JA. 1999. Polymorphus
arctocephali Smales, 1986, a synonym of
Corynosoma aetaceum Johnston & Best, 1942,
(Acanthocephala: Polymorphidae). Syst. Parasit. 44:
59-70.
Banks, AW. 1952. Some animal parasites of the
Northern Territory and some remarks. Aust. Vet. J.
28: 108.
Barton, DP. 1994. A checklist of helminth parasites of
Australian Amphibia. Rec. S. Aust. Mus. 27: 13-30.
Baylis, HA. 1929. ‘Parasitic Nematoda and
Acanthocephala Collected in 1925-1927.’ Discovery
Reports 1 pp. 541-560. Cambridge University Press:
Cambridge.
Benedon, PJ van. 1870. Les Poissons des cétes de
Belgique, leurs parasite et leur commensaux. Mém.
Acad. Roy. Belgique. 38: 1-100.
Blanc, GR & Cauchemez, LST. 1911. Sur un
echinorhynch nouveau (Echinorhynchus brumpti
nov.sp.) parasite du hérisson. C.R. Scs. Soc. Biol. 71:
120-121.
Bloch, ME. 1782. Abhandlung von der Zereugung der
weidewiimer und den mittein wider dieselben Berlin,
54pp.
Bremser, JG. 1811. Notitia collectionis insignis
vermium intestalium etc Vindobonae: Vienna,
31 pp.
Byrd, EE & Kellogg, FE. 1971. Mediorhynchus bakeri
a new acanthocephalan (Gigantorhynchidae) from the
bob-white, Colinus virginianus virginianus (L.). J.
Parasit. 57: 137-142.
Cleland, JB. 1922. The parasites of Australian birds.
Trans. R. Soc. S. Aust. 46: 85-118.
Deffke, O. 1891. Die entozoen des hundes. Arches.
Wissen. Prat, Thier Berlin 7:1-60; 253-289.
Diesing, KM. 1851. Systema Helminthum 1 and 2
Vindobonae, W. Braumiller, S88pp + corrigenda
3pp.
Dujardin, F. 1845. Histoire naturelle des helminthes ou
vers intestineux. Paris Librarire Encyclopédique
Roret: Paris, 652 pp.
Edmonds, SJ. 1955. Acanthocephala collected by the
Australian National Antarctic Research Expedition
on Heard Island and Macquarie Island during 1948—
1950. Trans. R. Soc. S Aust. 78: 141-144.
Edmonds, SJ. 1957a. Australian Acanthocephala No 10.
Trans. Roy. Soc. S. Aust. 80: 76-80.
Edmonds, SJ. 1957b. Acanthocephala. BANZ Antarctic
Research Expedition 1921-1931 Report Series B
(Zool. and Bot.) 6: 91-98.
Edmonds, SJ. 1971. Australian Acanthocephala No 13.
Three new species. Trans. Roy. Soc. S. Aust. 95: 55—
60.
Edmonds SJ. 1982. Australian Acanthocephala No 15.
Four species. Trans. Roy. Soc. S. Aust. 106: 71-76.
Edmonds, SJ. 1987. A Note on the occurrence of
Bolbosoma capitatum (Linstow, 1880)
(Acanthocephala) from a false killer whale stranded
on the coast of Western Australia. Rec. W. Aust. Mus.
13: 317-318.
Edmonds, SJ. 1989. A list of Australian Acanthocephala
and their hosts. Rec. S. Aust. Mus. 23: 127-133.
Fielding, JW. 1927. Observations on rodents and their
parasites. Proc. R. Soc. S. N.S.W. 61: 115-134.
Figueroa, L & Puga, S. 1990. Corynosoma cetaceum
Johnston & Best, 1942 (Acanthocephala) en delfin
chileno, Cephalorhynchus eutropia Gray, 1846
(Cetacea: Delphinidae). Bol. Chil. Parasit. 45: 93-
95.
Golvan, YJ. 1956a. Le genre Centrorhynchus Liihe
1911 (Acanthocephala- Polymorphidae) Révision des
espéces européennes et description d’une nouvelle
espéce africaine parasite de Rapace diurne. Bull de |’
IAFN 18: 732-785.
Golvan, YJ. 1956b. Acanthocéphales d’oiseaux
Troisiéme note. Revision des espéces européennes de
la sous-famille des Plagiorhynchinae A. Meyer 1931
(Polymorphidae). Ann. Parasit. hum. comp. 31: 350-
383.
Golvan, YJ. 1960. Le Phylum des Acanthocephala
(Troisiéme note.) La Classe des Palaeacanthocephala
(Meyer, 1931). Ann. Parasit. hum. comp. 35: 350-
386.
Golvan, YJ. 1962. Le phylum des Acanthocephala
(Quatriéme note) La Classe des Archiacanthocephala
(A. Meyer, 1931). Ann. Parasit. hum. comp. 37: 1-
1D
Golvan, YJ. 1969. Systematique des Acanthocéphales
(Acanthocephala: Rudolphi, 1801). L’Ordre des
Palaeacanthocephala Meyer 1931, la superfamille
des Echinorhynchidea (Cobbold, 1896; Golvan &
Houin, 1973). Mem. Mus. Natl. Hist. nat. Paris. Ser.
A Zool. 57: 1-375.
Golvan, YJ. 1994. Nomenclature of the Acanthocephala.
Res. Rev. Parasit. 54: 135-205.
Goss, OM. 1940. Platyhelminth and acanthocephalan
parasites of local shags. J. R. Soc. W. Aust. 36: 1-
14.
Gmelin, JF. 1790. Systema naturae per regna tria
naturae secundum classes, ordinae, genera, species
cum characteribus differentis, synonymis locis. No. 6
(Vermes): 3021-3910.
Gmelin, JF. 1791. Caroli a Linné Systema Naturae 13"
Edition | pars vi Lipsiae.
Goeze, JAE. 1782. Versuch einer Naturgeschichte der
eingeweiderwiirmer theirischer Kérper, 471 pp.
AUSTRALIAN ACANTHOCEPHALA CHECKLIST 79
Hamman, O. 1892. Das system der acanthocephalen.
Zool. Anz. 15: 195-197.
Hoberg, EP. 1986. Aspects of ecology and
biogeography of Acanthocephala in Antarctic
seabirds. Ann. Parasitol. Hum. Comp. 61: 199-214,
Johnston, TH. 1909a. The entozoa of Monotremata and
Australian Marsupialia. Proc. Linn. Soc. N.S.W. 34:
514-523.
Johnston, TH. 1909b. Notes and exhibits of Entozoa.
Proc. R. Soc. N.S.W. XX: 217-219, 590-591.
Johnston, TH. 1909c. List of parasites occurring in
Australia (in man and domestic animals). Rep. Bur.
Microbiol. N.S.W. 1 1909 (1910): 75-81.
Johnston, TH. 1909d. Notes on some Australian
parasites. Ag. Gaz. NSW 20: 581-584.
Johnston, TH. 1910a. Exhibit of Entozoa. Proc. R. Soc.
N.S.W. 44 xi-xv, xvii-xviii.
Johnston, TH. 1910b. On Australian avian entozoa.
Proc. R. Soc. N.S.W. 44: 84-122.
Johnston, TH. 1911. The entozoa of Monotremata and
Australian Marsupialia ii. Proc. Linn. Soc. N.S.W.
36: 47-57.
Johnston, TH. 1912a. Internal parasites recorded from
Australian birds. Emu 12: 105-112.
Johnston, TH. 1912b. Notes on some entozoa. Prac. R.
Soc. Qld. 26: 63-91.
Johnston, TH. 1913. Report on Cestoda and
Acanthocephala. Rep. Austr. Inst. Trop. Med. 1911
(1913): 75-96.
Johnston, TH. 1914. Some new Queensland
endoparasites. Proc. R. Soc. Qld. 76: 76-84.
Johnston, TH. 1916. A census of the endoparasites
recorded as occurring in Queensland arranged under
their hosts. Proc. R. Soc. Qld. 28: 31-79.
Johnston, TH. 1918a. Notes on certain entozoa of rats
and mice. Proc. R. Soc. Qld. 30: 63-78.
Johnston, TH. 1918b. Notes on miscellaneous
endoparasites. Proc. R. Soc. Qld. 30: 209-218.
Johnston, TH. 1937. Entozoa from the Australian hair
seal. Proc. Linn. Soc. N.S.W. 62: 9-16.
Johnston, TH & Best, EW. 1937. Acanthocephala.
Australian Antarctic Expeditions 1911-1914 Series
C. Zoology and Botany. 10: 1-20.
Johnston, TH & Best, EW. 1942. Australian
Acanthocephala No. 3. Trans. R Soc. S. Aust. 66:
250-254.
Johnston, TH & Best, EW. 1943. Australian
Acanthocephala No. 4. Trans. R. Soc. S. Aust. 67:
226-230.
Johnston, TH & Cleland, JB. 1911. Echinorhynchus
pomatostomi a subcutaneous parasite of Australian
birds. Proc. R. Soc. N.S.W. 45: 111-115.
Johnston, TH & Deland, EW. 1929. Australian
Acanthocephala No. 1. Census of recorded hosts and
parasites. Trans. R. Soc. S. Aust. 53: 146-154.
Johnston, TH & Edmonds, SJ. 1947. Australian
Acanthocephala No. 6. Rec. S. Aust. Mus. 8: 555-
562.
Johnston, TH & Edmonds, SJ. 1948. Australian
Acanthocephala No. 7. Trans. R. Soc. S. Aust. 72:
69-76.
Johnston, TH & Edmonds, SJ. 1951. Australian
Acanthocephala No. 8. Trans. R. Soc. S. Aust. 74: 1-
5.
Johnston, TH & Edmonds, SJ. 1952. Australian
Acanthocephala No. 9. Trans. R. Soc. S. Aust. 75:
16-21.
Johnston, TH & Edmonds, SJ. 1953. Acanthocephala
from Auckland and Campbell Islands. Rec. Dom.
Mus. 2: 55-61.
Joyeux, CE. & Baer, JG. 1935. Etude de quelques
Acanthocephalés d’Indochine. Ann. Mus. Hist. Nat.
27 Mém. 2: 1-15.
Khoklova, IG. 1974. Revision of the genera Profilicollis
Meyer, 1931 (= syn Falsificollis Webster, 1948 =
syn Parafilicollis Petrochenko, 1956)
(Acanthocephala: Filicollidae). Helminthologica
Bratislava 15: 803-811 [in Russian].
Kostylev, NN. 1915. Contributions 4 la fauna des
acanthocéphale de la Russie. Ann. Mus. Zool. Ac.
Imp. Scs. Petrograd 20: 389-394.
Krefft, G. 1871. On Australian entozoa. Irans. Ent. Soc.
N.S.W. 3: 206-232.
Leukart, FS. 1828. Breves animalium descriptiones.
Heidelberg.
Lieper, RT & Atkinson, EL. 1915. Parasitic worms with
a note on a free living nematode. /n ‘British Antarctic
(Terra Nova) Expedition, 1910. Natural History
Reports II’, pp. 19-60. British Museum (Natural
History): London.
Linstow, O von. 1880. Helminthologische
Untersuchungen. Arch. Naturg. 46: 41-54.
Linstow, O von. 1892. Helminthen von Sundgeorgien.
Nach der Ausbente des deutschen Station 1882—
1883. Jar. Hamburg. Wisssen. Anst. 9: 59-87.
Linstow, O von. 1897. Nemathelminthen gessamelt
Herrn Prof. Dahl in Bismark- Archipeligo. Arch.
Naturg. 63: 281-291.
Linstow, O von. 1898. Nemathelminthen von Herrn
Richard Semon in Australie gesammelt. Jn R. Semon
(ed.) ‘Zoologische Forschungsreisen in Australie’,
Vol. 5. Denkschr. Med-Naturw. Gesellsch. Jena 8:
469-472.
Linton, E. 1888. Notes on Entozoa of marine fishes with
descriptions of two new species. Rep. Comnuss. Fish.
Fisheries. 523-542.
Lopez-Neyra, CR. 1946. Compendio de helmintho logia
Ibérica (Continuacién) Parte II Cap IV Class
Acanthocephala Rudolphi 1808. Rev. Iber. Parasit.
6: 3-50.
80 LR SMALES
Liihe, M. 1904. Ceschichte und Ergebnissa des
Echinorhynchen-Forschung bis auf Westrumb (1821)
(Mit Bernekungen iiber alte und neue Gattungen der
Acanthocephalan). Zool. Annl. Zeitsch. Gesch. Zool.
Her. von B. Braun Wiirzburg 1: 139-250.
Marchant, S & Higgins, PJ. 1990-2001. ‘Handbook of
Australian, New Zealand and Antarctic birds’. Vol 1,
1990, S. Marchant & P.J. Higgins (eds), Ratites to
Ducks, 1400pp. Vol 2, 1993, S. Marchant & P.J.
Higgins (eds), Raptors to Lapwings, 984pp. Vol 3,
1996, P.J. Higgins & S.J.J.F. Davies (eds), Snipe to
Pigeons, 1028pp. Vol 4, 1999, P.J. Higgins (ed),
Parrots to Dollarbirds, 1244pp. Vol 5, 2001, P.J.
Higgins, J.M. Peter & W.K. Steele (eds), Tyrant
flycatchers to Chats, 1269pp. Oxford University
Press: Melbourne.
Marval, L. de. 1902. Etudes sur quelque
Echinorhynques d’oiseaux. Arch. Parasit. 15: 412-
439.
Marval, L. de. 1905. Monographie des Acanthocéphales
d’oiseaux. Rev. Suisse. Zool. 13: 195-387.
Mawson, PM, Angel, LM & Edmonds, SJ. 1986. A
checklist of helminths from Australian birds. Rec. S.
Aust. Mus. 19: 219-235.
Meyer, A. 1928. Die Furchung nebsi Eibildung, Reifung
und Befruchtung des Gigantorhynchus gigas (Ein
Beitrag zur Morphologie der Acanthocephalan).
Zool. Jahr. Abteil. Anat. Ontog. Tiere. 50: 177-218
Meyer, A. 1932. Acanthocephala. Jn H.G. Bronn (ed.)
‘Klassen und Ordnungen des Tier-Reichs’, Bd 4 (2)
Buch 2, 332 pp. Akademische Verlagsgesellschaft
M.B.H.: Leipsig.
Meyer, A. 1933. Ibid. pp. 333-582.
Molin, R. 1858. Prospectus helminthum quae in parte
seconda prodromifaunae helminthologicae venetae
continenter. Sitzungs. konig. Akad. Wissen. Wien.
Mathem-Natur. Kl. 30: 141.
Morini, EG & Boero, JJ. 1960. Corynosoma otarinae
n.sp. (Acanthocephala: Polymorphidae) parasito de
un lobo marino (Otaria flavescensi). In Actas y
Trabajos del I Congresso Sudamericano de
Zoologica (La Plata, 1959). 2: 229-234.
Nickol, BB, Crompton, DWT & Searle, DW. 1999.
Reintroduction of Profilicollis Meyer, 1931 as a
genus in Acanthocephala: significance of the
intermediate host. J. Parasit. 85: 716-718.
Nicoll, W. 1914. Remarks on the worm parasites of
tropical Queensland. Med. J. Aust. Sept. 1914: 244—
246.
Pallas, PS. 1766. Elenchus zoophytorum sistens
generum adumbrationes generaliores et speciarum
cognitarum, succinitas descriptiones cum selectis
auctorum synonymis. Hagne Comitum.
Pallas, PS. 1781. Bermerkungen tiber die bandwiirmer
in Menschen und Thieren. Neue nordischer Beitruge
zur physikalischen und geographischen Erd-und
Volkerbeschreib. Naturg Oekon (Petersburg und
Leipzig). 1: 39-112.
Pereira, JJr & de Matos Neres, LF. 1993. Corynosoma
australe Johnston, 1937 (Acanthocephala,
Polymorphidae) em Micropogonias furnieri
(Desmarest, 1823) (Perciformes, Sciaenidade) do
litoral do Rio Grande do sul. Comun. Mus Ciénc.
PUCRS sér zool. Porto Allegre 6: 51-61.
Petrochenko, VI. 1958. ‘Acanthocephala of domestic
and wild animals’, Vol 2. K.I. Skrjabin (ed),
translated from Russian. Israel Program for Scientific
Publications, Jerusalem, 1971.
Phipps, CJ. 1774. ‘A Voyage Towards the North Pole’.
London.
Pichelin, S, Thomas, PM & Hutchinson, MN. 1999. A
checklist of helminth parasites of Australian reptiles.
S. Aust. Mus. Monograph Ser. 5: 1-61.
Porta, A. 1906. Ricerche sull Echinorhynchus capitatus
v Linstow e nota sulia sistematica degli
Echinorhinchi dei cetacei. Zool. Anz. 30: 235-271.
Porta, A. 1908. Gli acantocefali dei mammaferi. Nota
preventiva. Arch. Parasit. 12: 268-282.
Porta, A. 1914. Acanthocephali nuoevi e note
sinonimiche. Zool. Anz. 44: 483-485.
Raillet, A. 1918. Echinorhynchus belgicus. Zool. Anz.
44: 483.
Raillet, A & Henry, ACL. 1907. Nemathelminthes
parasites. Expedition Antarctique Frangais 1903/
1905 (Dr. Jean Charcot). Scs. Nat. Dos. Scientif: 11-
15.
Risso, A. 1826. Histoire naturelle des principales
productions d’Europe meridionale et principalement
de celles des environs de Nice et des Alpes Maritime.
Paris. 5: 1-402.
Rudolphi, CA. 1814. Ester Nachtrag zu meiner
Naturgeschichte der Eingeweidewiirmer. Mag. Ges.
naturf. Freunde Berlin 6: 83-113.
Rudolphi, CA. 1819. Entozoorum synopsis, cui
accedunt mantissa duplex et indices locupletissima.
Berolini 8: 1-811.
Schmidt, GD. 1975. Andracantha, a new genus of
Acanthocephala (Polymorphidae) from fish eating
birds, with descriptions of three new species. J.
Parasit. 61: 615-620.
Schmidt, GD. 1981. Plagiorhynchus formosus Van
Cleave, 1918, a synonym of Plagiorhynchus
cylindraceus (Goeze, 1782) Schmidt and Kuntz,
1966. J. Parasit. 67: 597-598.
Schmidt, GD. 1983. What is Echinorhynchus
pomatostomi Johnston & Cleland, 1912. J. Parasit.
69: 397-399.
Schmidt, GD & Dailey, MD. 1971. Zoogeography and
the generic status of Polymorphus (Polymorphus)
cetaceum (Johnston et Best, 1941) comb.n.
(Acanthocephala). Proc. Helm. Soc. Wash. 38: 46.
Schmidt, GD & Edmonds, SJ. 1989. Australiformis
AUSTRALIAN ACANTHOCEPHALA CHECKLIST 81
semont (Linstow, 1898) n. gen. n. comb.
(Acanthocephala: Moniliformidae) from marsupials
of Australia and New Guinea. J. Parasit. 75: 215—
217.
Schmidt, GD & Kuntz, RE. 1966. New and little known
plagiorhynchid Acanthocephala from Taiwan and the
Pescadore Islands. J. Parasit. 52: 520-527.
Schmidt, GD & Kuntz, RE. 1967. Notes on the life-
cycle of Polymorphus (Profilicollis) formosus sp.n.
and records of the Arythmorhynchus hispidus Van
Cleave, 1925 (Acanthocephala) from Taiwan. J.
Parasit. 53: 805-809.
Schmidt, GD & Kuntz, RE. 1977. Revision of
Mediorhynchus Van Cleave, 1916 (Acanthocephala)
with a key to the species. J. Parasit. 63: 500-507.
Schodde, RS & Mason, IJ. 1999. ‘The Directory of
Australian Birds: Passerines’. 85lpp. CSIRO
Publishing: Collingwood.
Schrank, F von P. 1788. ‘Verzeichnis derbischer
hinliglich bekannten Eigeweidewiirmer, nebst einer
Abhandlung iiber ihre Anverwandtschaften’. 16pp.
Munchen.
Skryabin, AS. 1966. Corynosoma mirabilis n. sp.
parasite du cachalot. Jn S.L. Delymure (ed) ‘Faune
helminthologique des animaux des mers du sid’.
Nauk. Durnka Kiev 10-12 (in Russian).
Skryabin, AS & Nickolsky, OR. 1971. Corynosoma
singularis n. sp. Polymorphidae a parasite of marine
mammals from the Antarctic. Nauk. Dok. Vysshei
Shkoly Biol. Nauk. 11: 7-9 (in Russian).
Smales, LR. 1983. Helminth type specimens in the
South Australian Museum II Acanthocephala and
Cestodes. Res. S. Aust. Mus. 18: 493-501.
Smales, LR. 1986. Polymorphidae (Acanthocephala)
from Australian mammals with descriptions of two
new species. Syst. Parasit. 8: 91-100.
Smales, LR. 1988. Plagiorhynchus (Prosthorhyncus)
cylindraceus Goeze, 1787; Schmidt & Kuntz, 1996,
from the Australian bandicoots Perameles gunnii
Gray, 1838 and Jsoodon obesulus (Shaw, 1797). J.
Parasit. 74: 1062-1064.
Smales, LR. 1997. Multisentis myrmecobius gen. et. sp.
nov. (Acanthocephala: Oligocanthorhynchidae), from
the numbat Myrmecobius fasciatus and a key to
genera of the Oligocanthorynchidae. Invert. Taxon.
11: 301-307.
Smales, LR. 2002a. Species of Mediorhynchus
(Acanthocephala: Gigantorhynchidae) in Australian
birds with the description of Mediorhynchus
colluricinclae n. sp. J. Parasit. 88: 375-378.
Smales, LR. 2002b. Plagiorhynchidae Meyer, 1931
(Acanthocephala) from Australian birds and
mammals with descriptions of Plagiorhynchus
(Plagiorhynchus) menurae (Johnston, 1912) and P.
(P.) allisonae n. sp. Syst. Parasit. 51: 207-216.
Smales, LR & Cribb, T. 1997. Helminth parasite
communities of the water-rat Hydromys chrysogaster
from Queensland. Wildl. Res. 24: 445-457.
Southwell, T & Mcfie, JW. 1925. On a collection of
Acanthocephala in the Liverpool School of Tropical
Medicine. Ann. Trop. Med. Parasit. 19: 141-148.
Strahan, R. 1995. ‘The Mammals of Australia’. 756pp.
Reed Books: Chatswood.
Travassos, L. 1915. Reviséo dos acantocefalos
brazilieros il Familia Echinorhynchidae Hamman,
1892. Brazil Medic. Rio de Janero 48: 377.
Travassos, L. 1917. Contribucioes para o conhecimento
da fauna helmintologica brazileira VI Revisao dos
Acantocefalos brasileiros Familia Gigantorhynchidae
Hamman, 1892. Mem. Inst. Os. Cruz. 9: 1-61.
Travassos, L. 1926. Contribucioes para o conhecimento
da fauna helminthologica brasileira. XX. Revisao dos
Acanthocephalos brasilieros Familia
Echinorhynchidae Hamman, 1892 sub-fam
Centrorhynchinae Travassos, 1919. Mem. Inst. Os.
Cruz. 19: 31-125.
Tubangi, MA. 1933. Notes on Acanthocephala in the
Philippines. Phil. J. Sc. 50: 115-128.
Van Cleave, HJ. 1916a. Acanthocephala of the genera
Centrorhynchus and Mediorhynchus (new genus)
from North American birds. Trans. Am. Micros. Soc.
35: 221-231.
Van Cleave, HJ. 1916b. A revision of the genus
Arythmorhynchus with description of two new
species from North American birds. J. Parasit. 2:
167-174.
Van Cleave, HJ. 1924. A critical study of the
Acanthocephaladescribed and identified by Joseph
Leidy. Proc. Acad. Na. Sc. 76: 279-334.
Van Cleave, HJ. 1945. The status of the
acanthocephalan genus Arythmorhynchus with
particular reference to the validity of A. brevis.
Trans. Am. Micros. Soc. 64: 133-137.
Van Cleave, HJ. 1947. The Acanthocephalan genus
Mediorhynchus its history and a review of the species
occurring in the United States. J. Parasit. 33: 297—
315.
Van Cleave, HJ. 1951. Speciation and formation of
genera in the Acanthocephala Anatom. Rec. 111:
525-526.
Van Cleave, HJ. 1953. Acanthocephala of North
American Mammals. Illinois Biological Monograph,
23: 1-179. University of Illinois Press: Urbara.
Vargara, L & George-Nacimento, M. 1982.
Contribuci6n al estudio del paratismo en el congrio
colorado Genyplerus chilensis (Guichenot, 1848).
Bol. Chil. Parasit. 37: 9-14.
Webster, JD. 1948. A new acanthocephalan from the
bob-white. J. Parasit. 34: 84-86.
Westrumb, AHL. 1821. ‘De _ helminthibus
acanthocephalis. Commentatio historico- anatomica
adnexo recensu animalium in museo Vindobonensi
82 LR SMALES
circa helminthes dissectorum et singularum
specierum harum in illis repertarum’. Helwig Edit:
Hanoverae. 85pp.
Yamaguti, S. 1939. Studies on the Helminth fauna of
Japan. Part 29 Acanthocephala II. Jap. J. Zool. 13:
317-351.
Yamaguti, S. 1963. Acanthocephala. In ‘Systema
Helminthum’ Vol 5, 1-423 pp. Wilby Interscience:
New York.
Zdzitowiecki, K. 1978. Corynosoma shakletoni sp. n.
from hosts in South Shetlands and South Georgia
(Antarctica). Bull. Acad. Polon. Scs. Ser. Sciences
Biologique Cl II 27: 629-634.
Zdzitowiecki, K. 1984a. Some _ Antarctic
acanthocephalans of the genus Corynosoma
parasitising Pinnipedia with descriptions of three
new species. Acta. Parasit Polon. 29: 117-123.
Zdzitowiecki, K. 1984b. Redescription of Corynosoma
hammani (Linstow, 1892) and description of C.
pseudohammani sp.n. (Acanthocephala) from the
environs of the South Shetlands (Antarctic). Acta
Parasit. Polon. 29: 379-393.
Zdzitowiecki, K. 1985. Acanthocephalans of birds from
South Shetlands (Antarctic). Acta Parasit. Polon. 30:
11-24.
Zdzitowiecki, K. 1986a. Acanthocephala of the
Antarctic. Pol. Polar Res. 7: 79-117.
Zdzitowiecki, K. 1986b. Redescription of Corynosoma
tunitae (Weiss, 1914) and description of C. baylisi
sp.n. (Acanthocephala: Polymorphidae) parasites of
piscivorous birds. Acta. Parasit. Polon. 31: 117-123.
Zdzitowiecki, K. 1989. New data on the morphology
and distribution of two Acanthocephalans
Andracantha baylisi (Zdzitowiecki, 1986) comb. n.
and Corynosoma australe (Johnston, 1937). Acta
Parasit. Polon. 34: 167-172.
Zdzitowiecki, K. 1991. Antarctic Acanthocephala. Jn
J.W. Wagele & J. Sieq (eds) ‘Synopses of the
Antarctic Benthos’, pp 1-109. Theses Zoologicae
Vol 15. Koeltz Scientific Books: Koenigstein.
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES IN
THE RURAL LANDSCAPE OF THE LOWER MURRAY, SOUTH
AUSTRALIA
P. A. CLARKE
Summary
Since European settlement, Aboriginal peoole living in rural areas of southern South Australia have
had a unique relationship to the landscape, reflecting both pre-European indigenous traditions and
post-European historical influences. Aboriginal hunting, fishing and gathering practices in the
twentieth century were not relics of a pre-European past, but were derived from cultural forces that
have produced a modern indigenous identity. The Lower Murray ethnographic data presented in this
cultural geography study were collected mainly during the 1980s, supplemented with historical
information concerning earlier periods.
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES IN THE RURAL
LANDSCAPE OF THE LOWER MURRAY, SOUTH AUSTRALIA
PA CLARKE
CLARKE, PA. 2003. Twentieth-century Aboriginal harvesting practices in the rural
landscape of the Lower Murray, South Australia. Records of the South Australian Museum
36(1): 83-107.
Since European settlement, Aboriginal people living in rural areas of southern South
Australia have had a unique relation to the landscape, reflecting both pre-European indigenous
traditions and post-European historical influences. Aboriginal hunting, fishing and gathering
practices in the twentieth century were not relics of a pre-European past, but were derived from
cultural forces that have produced a modern indigenous identity. The Lower Murray
ethnographic data presented in this cultural geography study were collected mainly during the
1980s, supplemented with historical information concerning earlier periods.
PA Clarke, Science Division, South Australian Museum, North Terrace, Adelaide, South
Australia 5000. Manuscript received 4 November 2002.
INTRODUCTION
The Aboriginal people living in the Lower
Murray region during the twentieth century were
not hunters, fishers and gatherers in terms of their
total subsistence economy; nevertheless, they
continued some hunting, fishing and gathering
practices. This paper explores contemporary
relationships that indigenous people have with a
landscape that has been transformed into an
environment dominated by agricultural and urban
activities. Unlike some northern desert and
subtropical areas of Australia, where Aboriginal
subsistence economies persist in an altered form
in relative isolation (Altman 1987; Meehan 1982),
European-style economic development in the
south conflicts more directly with Aboriginal land
use. In the Lower Murray, Aboriginal people have
interacted extensively with Europeans since the
1830s. In spite of this, a distinct indigenous
identity has remained and developed throughout
this period (Clarke 1994, 1995, 1996a, 1996b,
1998b, 1999a, 2001a, 2001b, 2001ms). When
Europeans first arrived in the Lower Murray
region in the late 1830s, the Aboriginal people
living there were differentiated into numerous
descent groups and several dialects. Due to an
early population crash and the eventual relocation
of survivors into mission and state-controlled
institutions in the late nineteenth century, the
descendants formed a new cultural and social
identity. Throughout the twentieth century,
indigenous people with pre-European connections
to the Lower Murray landscape have called
themselves Ngarrindjeri.'
The pre-European hunter and gatherer
subsistence economy in the Lower Murray region
is, in comparison to the rest of southern Australia,
well documented. Clarke (1985a, 1985b, 1986a,
1986b, 1987, 1988, 1998a) and Cleland (1957,
1966) have studied the ethnobotany of the region.
Berndt and Berndt (1993), Campbell (1934, 1939,
1943), Campbell et al (1946), Clarke (1999b,
2001a, 2002), Hemming (1989, 1991), Hemming
and Jones (1989) and Luebbers (1978) have
provided overviews of the pre-European material
culture. The main focus in the current work is
with twentieth-century Aboriginal practices in the
Lower Murray, although when Negarrindjeri
people are concerned data is included from the
Riverland agricultural district of South Australia.
The paper stems from the author’s museum work
and doctoral research addressing how indigenous
people relate to a modern rural and urban
landscape. It provides a list of words recorded
from the local variety of Aboriginal English
spoken during the author’s field study in the
1980s. This adds to studies by Foster et al (1998,
In early sources, such as Taplin (1859-79, 1874, 1879), Ngarrindjeri is written as ‘Narrinyeri’.
84 PA CLARKE
2003) and Clarke (2001ms) that investigate the
historical origins of twentieth-century Aboriginal
English spoken in southern South Australia. Maps
showing places of significance to Lower Murray
people are provided elsewhere (Clarke 1994,
1999a, 1999b).
HisTorIcAL BACKGROUND
The Lower Murray cultural region covers that
part of the Murray-Darling Basin south of the
entrance of the Murray River into Lake
Alexandrina, including the southern coast of
SPORT ADELAIDE
K @ ADELAIDE CITY
Fleurieu Peninsula, the area surrounding Lake
Albert and the Coorong. It formerly had a
relatively high population density, with an
estimated 6,000 people living there (Brown 1918:
230-231; Clarke 1994: 57-63) prior to the first
smallpox epidemic of the 1830s. After official
European settlement at Encounter Bay in 1836,
the Aboriginal population continued to decline,
chiefly due to other introduced diseases and land
alienation (Clarke 1994: chapter 6; 1995: 156, end
note 1; Gale 1969; Smith 1980). The survivors
gradually moved into European-controlled
situations, such as pastoral stations, the Point
McLeay Aboriginal Mission and fringe camps
hes
ANNUM
Ewurray BRIDGE
poise BEND
POINT
MCLEAY
X — FRINGECAMP
FIGURE 1. Twentieth century fringe campsites from Adelaide to the South East of South Australia.
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 85
around towns (Fig. 1).* Indigenous hunting,
fishing and gathering activities declined as
agricultural practices took over, commencing first
in the northern section of the Lower Murray,
restricting Aboriginal people to smaller parts of
the landscape. Ngarrindjeri people worked in the
whaling industry at Encounter Bay from 1836
(Clarke 2001a: 27-32). On the northern shore of
Lake Alexandrina during the 1850s, Aboriginal
people were drawn to living in towns, such as
Milang and Wellington, due in part to their
involvement in the fish trade (Taplin Journals, 12
April 1859). In 1859 the missionary George
Taplin made plans to establish a fishing industry
at Point McLeay, on the southern shore of Lake
Alexandrina.? This appears primarily to have been
intended to make the local Aboriginal community
more sedentary. Additionally, local hunting,
fishing and gathering activities at this time would
also have served to supplement the mission’s poor
supplies of food, the result of a shortage of
capital.
By the end of the nineteenth century, the
physical environment of the Lower Murray had
deteriorated. Irrigation schemes up river, which
commenced in 1881 at Monteith and spread to
Loxton, Berri and Renmark, and across the border
into Victoria and New South Wales, kept water
levels low (Fenner 1931: 84; Griffin & McCaskill
1986: 22; Williams 1969: 84, 243-244; 1974: 49,
235-236, 240). This increased the saltiness of the
lakes and also decreased natural fish stocks. The
sea water entering Lake Alexandrina in 1901, due
to abnormally low river levels, destroyed the
lucrative wool washing industry that had been
established at Point McLeay in the early 1880s
(Jenkin 1979: 177-178, 206). In 1905 the
Aboriginal fishing industry started by George
Taplin ended due to competition with white
fishers who had the funds to obtain better
technology (Jenkin 1979: 211). The barrages at
Hindmarsh Island to prevent sea water entering
Lake Alexandrina were completed in 1940 (Linn
1988: 181; McCourt & Mincham 1987: 11). The
authorities in charge of the Point McLeay
Aboriginal Mission at the time were in favour of
their construction, as it promised them a more
reliable supply of water suitable for agricultural
purposes.* However, an unfortunate consequence
was that the barrages contributed to the siltation
of the Coorong Lagoon, which also had a decrease
in freshwater flow from the south due to the South
East drainage schemes (Griffin & McCaskill
1986: 22; Holmes & Waterhouse 1983: 49-50;
Jack Koolmatrie cited Ely 1980).
The acquisition by the South Australian State
Government of Narrung Station for subdivision
into farming allotments occurred under the Closer
Settlement Act 1907 (Holtham, cited in Padman
1987: 10). The loss of this station as a whole was
reported to be sorely felt by the Point McLeay
people, who were previously allowed by the
manager, George Hackett, to have free range over
it for hunting, fishing and gathering (McCourt &
Mincham 1987: 11). The Aborigines’ Friends’
Association, which administered Point McLeay
from its base in Adelaide, responded to the
planned subdivision by stating that ‘it would be
advisable to make the boundary between them
[farmers] and the blacks as wide as possible’.°
Due to growing problems that the Association had
with managing the mission, particularly with its
increasing resident population, the government
took it under direct control in 1916 as a mission
station (Jenkin 1979: chapter 9). The Lower
Murray could no longer support Aboriginal people
in a totally pre-European fashion, involving
seasonal movements across a range of ecological
zones. This region had become part of ‘rural
South Australia’.
THE MODERN ENVIRONMENT
The Lower Murray has seen much economic
development since European settlement (Clarke
1994; Fenner 1931; Griffin & McCaskill 1986;
Linn 1988; McCourt & Mincham 1987; Williams
1974), due to factors such as the favourable
climate of the region, the potential of the river for
For instance, there were Aboriginal camps on Narrung and Poltaloch (pronounced by Aboriginal people as ‘Portaluck’) stations from the late
nineteenth to early twentieth century. Aboriginal residents generally referred to the mission station as ‘Raukkan’ (or ‘Ralkon’), which became an
official settlement name in the early 1990s. Examples of fringe camps around towns were the Three Mile (from Tailem Bend) and One Mile (from
Meningie).
There are many entries in Taplin’s Journals concerning the establishment of the fishing industry. The important references are 21 September 1859,
18 October 1859, 25 November 1859, 22 December 1859, 11 January 1860, 7 February 1860, 15 February 1860, 1 March 1860. See also Jenkin
(1979: 97-98, 110-111).
no.8/1930), State Records, Adelaide.
Register newspaper, 7 December 1906.
Memoranda to the Commissioner of Public Works from the Superintendent of Point McLeay and the Chief Protector of Aborigines (GRG 52/1,
86 PA CLARKE
transport and irrigation, and the close proximity to
Adelaide and the sea. Major highways and railway
lines pass through the Lower Murray, connecting
South Australia to the eastern states. Crops and
pasture have largely replaced the indigenous
vegetation. Irrigation directly from the lake and
river system is common practice. It is difficult for
the contemporary observer to imagine how the
region appeared before European settlement. Only
in locations marginal to agricultural use, such as
the Younghusband Peninsula, do large tracts of
indigenous flora remain. Aboriginal reserves and
national parks on both sides of the Coorong
Lagoon contain most of what remains of the pre-
European landscape.
Many of the pre-European plants and animals
formerly found in the Lower Murray are now
either scarce or locally extinct (Tyler et al 1983).
Those organisms that formerly occurred in open
woodlands, grasslands and the river have suffered
most. Such habitats were not only the first
ecological zones exploited by European settlers,
but are also the areas most intensively transformed
by agriculture. In contrast, plants and animals
found in the mallee or heavily wooded areas have
generally fared much better.
Europeans have introduced many foreign plant
and animal species into the Lower Murray. Not all
of these were essential for farming. To create a
neo-European landscape, South Australian
colonists also introduced organisms as pets and
garden plants (Rix 1978: 1-7). Other species came
accidentally as weeds and pests. European-style
agriculture favours the economic exploitation of a
few species. Therefore, the biological diversity of
farming regions is generally far less than for
uncultivated land in the same area. European
colonisation has irreversibly changed the
ecosystem of the Lower Murray.
European intrusion into the Lower Murray has
affected the distribution and abundance of most
indigenous animal species, primarily due to the
clearance of pre-European vegetation, the
alteration of the water flow conditions and the
introduction of exotic fish species into the basin.
For instance, during the author’s fieldwork in the
1980s many middle-aged and older Aboriginal
people lamented the reduction in numbers of
favoured species of eating fish, such as silver
perch (Bidyanus bidyanus), golden perch
(Plectrophilus ambiguus) and Murray cod
(Maccullochella peeli). The once abundant
Murray lobster (Euastacus armatus) is also now
scarce in South Australia (Reschke 1985: 173-
174; Warneke 2000: 104, 226). Several species of
water and ground birds became locally extinct
(Eckert 2000b; Parker & Reid 1983). Mammals,
in particular, have suffered immensely from
European colonisation in the Lower Murray. For
instance, the toolache wallaby (Macropus greyii),
which featured in Lower Murray Aboriginal
cosmology (Clarke 1997: 128), became extinct in
the 1920s (Aitken 1983: 127; Robinson & Young
1983; Strahan 1983: 234).
The rural landscape of the Lower Murray
created by Europeans provides refuge for many
introduced species. A number of invertebrate pests
have proliferated in the Lower Murray (Gross
1983; Zeidler 1983; Fisher 1983); for example,
the introduced honey bee (Apis mellifera) is
commonly encountered in all types of vegetation
(Matthews 1976: 88), and has largely displaced
indigenous bees, such as Trigona species, which
were formerly a source of honey for southern
Aboriginal people (Eyre 1845: 2: 273-274).
Several foreign species of fish are established in
the river and lake systems. In particular, the
European carp (Cyprinus carpio), goldfish
(Carassius auratus) and redfin perch (Perca
fluviatilis) are replacing the pre-European fish
fauna (Glover 1983; Sim et al 2000). Introduced
birds, such as the house sparrow (Passer
domesticus), feral pigeon (Columba livia) and
starling (Sturnus vulgaris), predominate in the
farm areas of the Lower Murray (Eckert 2000b).
Foreign mammals, including the house mouse
(Mus musculus), black rat (Rattus rattus), rabbit
(Oryctolagus cuniculus), brown hare (Lepus
capensis), feral cat (Felis catus) and fox (Vulpes
vulpes), are living wild in the Lower Murray
(Eckert 2000a). Domestic stock in the paddocks
consists mainly of various breeds of cattle and
sheep.
Some species of pre-European fauna have
flourished under the altered ecological regime,
whereas others persist in the reduced niches
available to them. For instance, the stumpy-tailed
lizard (Tiliqua rugosa) and the brown snake
(Pseudonaja textiles) are favoured by the
transformation of indigenous vegetation into
pasture (Eckert 2000c: 92, 94; Thompson & Tyler
1983: 156). Field observations by the author
during the 1980s suggest that species doing
moderately well in certain areas are the echidna
(Tachyglosus aculeatus) and water rat (Hydromys
chrysogastor). Some animal species that became
locally extinct in the Lower Lakes area have
survived on the Younghusband Peninsula and in
the Coorong National Park. These include the grey
kangaroo (Macropus fuliginosus), brusher wallaby
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 87
(Macropus rufogriseus), emu (Dromaius
novaehollandiae), wombat (Vombatus ursinus)
and the mallee fowl (Leipoa ocellata). Wombats
became locally extinct in the Lake Albert to Lake
Alexandrina area by the late nineteenth century
(McCourt & Mincham 1987: 10). Aboriginal
sources in the 1980s claimed that the mallee fowl
(native pheasant, Leipoa ocellata) disappeared in
the Lower Lakes area during vegetation clearance
in the early twentieth century.
The survival of these animals in the southern
Coorong and parts of the adjacent South East of
South Australia is the result of better coverage of
pre-European vegetation. In the late twentieth
century, some animal species spread back into the
Lower Lakes area, presumably from surviving
populations in the South East. For instance, grey
kangaroos and emus reappeared on the Narrung
Peninsula during the 1980s. Aiding this recovery
was the existence of patches of indigenous mallee
and sheoak scrub surviving on Aboriginal-leased
land. Major causes of the loss of indigenous
mammals were over-shooting and habitat
destruction.
The plant species introduced by Europeans have
had an irreversible effect on the Lower Murray
landscape. In many areas weeds had reached
equilibrium with the local vegetation by the
1980s. For example, the open areas on the
sandhills of the Younghusband Peninsula were
covered with the Mediterranean sea spurge
(Euphorbia paralias) and marram grass
(Ammophila arenaria), a dune-binding species
from Europe.® The bridal creeper (Myrsiphyllum
asparagoides), a garden plant originally from
South Africa, had taken over pockets of remnant
scrub in the inland regions of limestone karst.
Weeds dominated the farmed areas, particularly
around Point McLeay. Nuisance species for
farmers included the boxthorn (Lycium
ferocissimum)’ from South Africa, evening
primrose (Oenothera stricta)* from America and
horehound (Marrubium vulgare)’ from Europe,
and many introduced grasses.
Rabbits have changed the structure of local
flora throughout southern Australia (Walker 1985:
84-5). Richard Penney introduced rabbits on some
of the islands in Encounter Bay in 1841
(Whitelock 1985: 65), followed by mainland
introductions of the rabbit in the 1870s (Rolls
1984). This has undoubtedly made some plant
species, formerly used by Aboriginal people as
food and medicine, locally extinct or rare. Rabbits
also may have caused the displacement of many
species of small mammal. A demonstration of the
environmental impact of rabbits occurred in the
1950s when, due to a crash in the rabbit
population through myxomatosis, there was
significant regrowth of vegetation on the sand
dunes of Younghusband Peninsula for a short
period (McCourt & Mincham 1987: 19). The
whole of the Lower Murray has become modified
into a European landscape.
TWENTIETH-CENTURY HUNTING AND GATHERING
PRACTICES
Although European settlement in the Lower
Murray region occurred early by South Australian
standards, some pre-European knowledge
concerning the environment persisted in the
Aboriginal community through the twentieth
century. From the 1930s to the 1960s, researchers
such as Harvey, Tindale and the Berndts recorded
aspects of hunting, fishing and gathering practices
from elderly people, such as Albert Karloan,
Pinkie Mack and Clarence Long, who had
maintained a ‘memory culture’ (Tonkinson 1993:
xix).'° By the late twentieth century there were
still some people in the Ngarrindjeri community
who knew the identity and method of use of
particular species of plants and animals, as well as
the associated Aboriginal words (see Table 1). For
example, in the 1980s an elderly Ngarrindjeri man
remembered the term yulinthun, which referred to
the actions of a hunter who swam out into a
lagoon underwater and pulled ducks under by
their feet.!' As stated elsewhere, fieldwork with
the Aboriginal population in the 1980s produced
Alcock & Symon (1977) give lists of Coorong plant species. Plant origins are given by Jessop & Toelken (1986).
7 Point McLeay Mission Station residents formerly ate the fruit (Wilson 1998: 42). In the 1980s some Aboriginal people would regularly shake
boxthorn bushes growing in hedges, so that their fowls could eat the fallen fruits. Photographs (c. 1920) of boxthorn hedges are in the Ramsay-
Smith collection, AA6, Anthropology Archives, S.A. Museum.
Farm’. Mission children ate the seeds (Wilson 1998: 28).
Primroses dominated the Lower Murray landscape to the extent that one of the Narrung farming properties near Point McLeay was called ‘Primrose
During the twentieth century Aboriginal people used horehound as a medicinal plant (Clarke 1987: 15).
Clarke (2002: 149-150) provides an overview of these ethnographic sources.
A related Ramindjeri word appears to be yorl-un, recorded as ‘descending’ or ‘coming down’ (Meyer 1843: 66).
88
TABLE 1. Fauna and flora terms used by Ngarrindjeri people in the 1980s
PA CLARKE
Species
Mammals
cat (Felis catus)
dog (Canis familiaris)
echidna (Tachyglossus aculeatus)
fox (Vulpes vulpes)
horse (Equus caballus)
kangaroo, large (Macropus species)
mouse, house (Mus musculus)
possum (species?)
rabbit (Oryctolagus cuniculus)
rat, water (Hydromys chrysogaster)
sheep (Ovis species)
wombat, southern hairy-nosed (Lasiorhinus latifrons)
Birds
bird (all species)
chat, white-faced; tin-tack bird (Ephthianura albifrons)
coot, Eurasian (Fulica atra)
currawong, grey (Strepera versicolor)
duck, black (Anas superciliosa)
duck, hardhead or white eyed (Aythya australis)
duck, mountain (Tadorna tadornoides)
duck, musk (Biziura lobata)
emu (Dromaius novaehollandiae)
flycatcher, restless (Myiagra inquieta)
goose, Cape Barren (Cereopsis novaehollandiae)
gull, silver (Larus novaehollandiae)
hawk, brown (Falco berigora)
hen, mallee (Leipoa ocellata)
heron, white-faced; crane, blue (Ardea novaehollandiae)
magpie, Australian (Gymnorhina tibicen)
mudlark; Murray magpie; piwi (Grallina cyanoleuca)
pelican (Pelecanus conspicillatus)
plover, spur-winged (Vanellus miles)
raven (Corvus species)
shag, black; cormorant, black (Phalacrocorax carbo)
skylark (Alauda arvensis)
snipe, little grey (species?)
stilt, banded (Cladorhynchus leucocephalus)
swan, black (Cygnus atratus)
tern, caspian (Hydroprogne caspia)
wattlebird, red (Anthochaera carunculata)
willie wagtail (Rhipidura leucophrys)
wren, superb blue (Malurus cyaneus)
Reptiles
dragon, bearded (Pogona barbata)
bluetongue lizard (Tiliqua scincoides)
skink, drop-tail (order Scincidae)
sleepy lizard; stump-tailed lizard (Trachydosaurus rugosus)
snake (all species)
tadpole (all species)
tortoise
tortoise, turtle (all species)
Aboriginal term
malgu
booba, ke:li
porcupine
kanatji
porthi
primpari, marlu, wangami
punthi
punmathi
bappa
ra:wlkandi
tjambaki
watu
pulyeri
nankinduli
thuri
kilindi, kilinglin
mookari
pungkari
mounties
tilmarri
pamu
tjeri-tjeri
lawri
thrukeri
kiraki
lawan
krawli
multhari
thil-thil
nori
ratha-rathi
maragani
yoldi
thilbadi
kripari
nilkani
kungarri
tenetjeri
rungkan
ritjiruki
watji(-bird)
gunap, wirrakothi
pungkung
kindi
galta, kalta, manthari
krayi
nyikunthi
malanthaiperi
thukabi
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES
Species
Fish
bream, bony; pyberry fish; tukari fish (Fluvialosa richardsoni)
callop; golden perch; yellowbelly (Plectroplites ambiguus)
cod, Murray (Maccullochella peeli)
congolli fish (Pseudaphritis urvilli)
fish (all species)
mullet; yellow-eye (Aldrichetta forsteri)
mulloway; butterfish (Argyrosomus hololepidotus)
perch, silver; tcheri fish (Bidyanus bidyanus)
porcupine fish (Allomycterus pilatus)
tommy rough (Arripis georgiana)
Arthropods
ant (all species)
flea (order Siphonaptera)
lice, of the head (Pediculus humanus)
lice, of the pubic region (Phthirius pubis)
wood-grub (species?)
Plants
apples, native; monterry (Kunzea pomifera)
ballart, coastal (Exocarpos syrticolus)
box, white; Christmas-bush (Bursaria spinosa)
boxthorn (Lycium ferocissimum)
bulrush; reedmace; flag (Typha species)
cherry, wild (Exocarpos syrticolus)
cranberry, native (Astroloma humifusum)
currant, native (Leucopogon parviflorus)
date, wild (Billardiera scandens)
flax-lily, pale (Dianella longifolia)
fruit, edible sheoak (Casuarina stricta)
grass, basket making (unidentified species)
grasstree (Xanthorrhoea species)
grasstree flower stem when dried (Xanthorrhoea species)
gum, from wattle (Acacia pycnantha)
honeysuckle (Banksia ornata)
juniper tree (Myoporum insulare)
lignum bush (Muehlenbeckia cunninghamii)
old man’s beard (Clematis species)
pea, broom bitter (Daviesia genistifolia)
pigface (Carpobrotus rossi)
root, edible species of (unidentified species)
samphire (family Chenopodiaceae)
sedge, coastal sword (Lepidosperma gladiatum)
sedge, hoary rapier (Lepidosperma canescens)
sedge, spiny-headed (Cyperus gymncaulos)
sedge, sticky sword (Lepidosperma viscidum)
sedges used to make baskets & mats
sow-thistle (Sonchus oleraceus)
wattle, coastal (Acacia longifolia sophorae)
Aboriginal term
thukeri
callop, pilalki, pilaki
ponde
kungali
marmi
kanmeri
malawi
tert
danimudla
pukaratji
prildi
titjeri
gudlu, gudli, gooli, poti
mutharuk
waldaruk
manthri
doll’s eyes
palgi
katheri(-bush)
makuru, manangkeri, manakeri
waltjeri (= wild cherry)
milbakorthi
kalathami, ngooli
kundawi
peentuk
sheoak-apple
yalkeri
kinyeri
ngleyi
tangari
yelakut
boobialla, booalla, palberi
watji(-bush)
yalkuri
kuranthantha
nganingi, poyup
mrangganyi, pakanu(-potato)
parragoni
ngrakani, thyuk, wingi
pinki-moranyi
mangatu
kukandu
basket-rush
thalgi
boobialla, booalla, kalari(-bush)
90 PA CLARKE
information on the pre-European mode of
subsistence not previously recorded (Clarke
1986b). Many Ngarrindjeri people still used
Aboriginal terms for fish species in preference to
European names.
During 1980s fieldwork by the author,
Aboriginal people usually brought forth
information about plant and animal uses within
the context of narratives of their own life history.
For instance, many of the Aboriginal people
interviewed about bush resources recalled what
they, as children, had observed being collected
and used by older kinsmen many years ago. Some
remembered the types of food, such as fruits and
berries, they gathered and ate on the way to and
from school. Detailed accounts of the environment
were received from Aboriginal people who had
formerly relied on natural resources to supplement
their meagre family income. Such people trapped
water rats for their skins, fished, and caught
rabbits for food and for sale. A variety of methods
were employed. For water rats and rabbits,
Aboriginal hunters used steel traps and wire
snares. Opportunistic harvesting occurred too. For
instance, Jack Koolmatrie remembered that early
in the twentieth century, Lower Murray people
killed a beached 5.6 metre female whale near
Rabbit Island in the Coorong Lagoon (Ely 1980).
They dragged parts of it into their boat and later
cut it up, distributing the meat among their
neighbours at Point McLeay. On another occasion
at Mypolonga, Koolmatrie recalled that his father
killed a large Murray cod with a double-barrel
shotgun blast because he had no spear at hand.
The nature of Aboriginal lifestyles in the Lower
Murray preserved some pre-European knowledge
of environmental resources. At Point McLeay
local sources of wild food helped families who
were on rations. Ngarrindjeri woman Dulcie
Wilson recalled that in the 1940s and 1950s:
Living by the lake, our diet consisted mainly of
fish, bream, callup [golden perch], and cod.
Rabbits also supplemented our diet.
Sometimes, when father had shot a swan she
[mother] would mince up the breast, mix it with
herbs and onions and make delicious rissoles
(Wilson 1998: 24).
From the time of the establishment of the Point
McLeay Mission, Aboriginal family groups living
there followed the practice of camping away from
Point McLeay during the summer school break at
places such as the Goolwa Channel, Ngalang
(Gnurling Point), Mark Point and ‘The Landing’
near the Narrung Narrows.” All these summer
camps were near inland waterways and were to
some extent isolated from European settlements.
It is likely that the earlier camps were formed
around particular elderly family members who
wanted to visit important cultural sites, such as
seasonal camps and old burial grounds that were
linked to their descent group. For Aboriginal
people the camps served as a break from mission
life, whilst for the mission authorities it probably
eased the burden of providing food rations. Due
to such seasonal movements, the Aboriginal
population at Point McLeay during summer
consisted mainly of the old and sick.
According to Lower Murray people interviewed
in the 1980s, these annual trips continued until
the mid 1960s.'? The people used ‘wurley-sticks’
and hessian sacks to make shelters, and took
sugar, tea, flour for damper, jam and blankets."
The main method of transport was by horse and
buggy, although some people used dinghies too.'*
Wild food, such as berries, cockles, fish, emus,
echidnas, rabbits and kangaroos supplemented
their provisions once they arrived and a pelican or
swan wing served as a brush to sweep the floor of
the shelter (Wilson 1998: 40). Extended family
groups would stay away from the mission station
for several weeks. The summer trips by families
reportedly had the official support of the Point
McLeay authorities. The school did not require
the children during that time and the coastal
environment was pleasant for camping out during
the summer.
The Coorong as a destination was particularly
attractive for a number of reasons. Up until the
Second World War, non-Aboriginal farmers had
largely ignored the margin of the Coorong Lagoon
with its shallow soils and lack of water suitable
for irrigation. The Coorong has several declared
Aboriginal reserves along its mainland shore,
some of them with small houses and shacks. In
'2 There are many early references to Coorong summer trips in Taplin’s Journals (15 & 29 January 1862, 16 February 1862, 15 January 1863, 28
December 1864 — 3 January 1865).
n
98) and Wilson (1998: 39-40,'97).
14
Hemming (1994: 14) provides a photograph of a summer camp along the Coorong, in about 1900. More recent references are DETE (2001b: 81,
Temporary shelters made from bags were called ngauwanthi, shelter poles were called ‘wurley-sticks', sugar was pinyatawi and tea was termed
lingali, Elderly Ngarrindjeri people called damper pampi, although this term appears to be a Moandik word from the South East of South Australia
(Clarke 2001 ms).
Buggies were referred to as titjeri (flea), a reference to the reliance of a buggy when being drawn upon the body of a horse (Clarke 2001 ms).
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 91
the 1990s Lindsay Wilson, who was an elderly
Aboriginal man with ties to the Coorong and
South East of South Australia, stated that Jacob
Harris had taken him and other youths from Point
McLeay to the Younghusband Peninsula during
the 1930s.'° They took off all their clothes and
lived by hunting, fishing and gathering. This was
to ‘introduce us to our country’.
In spite of the landscape changes by the early
twentieth century, Aboriginal people in the Lower
Murray retained a distinctly Aboriginal view and
use of the physical environment, albeit in a
modified form. Up until the 1930s some
Aboriginal people, known in Aboriginal English
as ‘camp-blacks’, lived in ‘wurleys’ (traditional
shelters) on a hill overlooking the mission
settlement. Some early traditional harvesting
practices continued, particularly for people based
in the fringe camps and living on reserves away
from the mission. Some Ngarrindjeri people
moved to other parts of South Australia to live
and work. For example, the Giles family lived in
the Riverland during the 1940s and 1950s by
selling Murray cod when in season and water rat
skins for the rest of the time. They lived in
‘wurleys’ made from introduced wild tobacco
saplings and hessian bags, and by catching what
food they could from around the camp:
We ate ducks and swans, and their eggs, fish,
caught yabbies now and then, and there were
plenty of rabbits around, especially during flood
time, We would just grab them out of the lignum
bushes, where they sat trying to escape the rising
water (Grace 1990: 159).
Some of this wild food was traded with local
farmers for clothes, tobacco, flour and milk.
Bellchambers (1931: 120) reported that in the
1920s at Swan Reach in the Riverland,
descendants from the local Aboriginal groups
lived in fishing camps but suffered ‘certain
hardships from having no fishing facilities
reserved for them.’ This seemed strange to him,
considering that the camp was almost permanent.
Aboriginal people worked on the periphery of
many small-scale industries. For example,
Ngarrindjeri people remembered catching baby
long-necked tortoises (Chelodonia longicollis)
and parrots in the Riverland as youths in the
1950s for the Adelaide pet trade. Leeches were
collected and sold for use by Europeans to treat
‘© Also reported by Wilson (1998: 89, 115).
7
Australia.
various blood ailments (Clarke 1989: 3-4; Grace
1990: 171). Skinned and gutted rabbit carcases
were sold to cray fishermen for use as bait
(Wilson 1998: 118). Aboriginal people also boiled
sheep heads and lamb tails for food and collected
loose ‘dead wool’ from paddocks for sale
(Abdulla 1993).'’ Short-term employment was
gained from orchardists by fruit picking, from
fishermen by cleaning fish, and from the farmers
by stump and stone picking in the paddocks and
hessian bag sewing (DETE 2001b: 59, 61, 69, 71).
Non-Aboriginal people occasionally engaged in
similar pursuits, but Aboriginal people living
along the river relied on these activities to such as
extent that it became a part of their rural lifestyle.
During more restrictive periods in the early
twentieth century, such as when the ‘colour bar’
operated in the rural towns of the Lower Murray
(Berndt & Berndt 1951; Clarke 1994: section 6.4),
exclusion from many of the benefits gained
through access to towns helped maintain a high
level of interaction between Aboriginal people
and the physical environment. In particular, it was
apparent in the 1980s when interviewing
Ngarrindjeri people that former dwellers of fringe
camps had extensive knowledge of the medicines
and edible plants that were ‘used by the old
people’. This was simply because they had needed
these indigenous resources to survive. The
proximity of their dwellings to main roads and
settlements during the 1950s and 1960s did not
lessen their connection with the broader
environment. In the 1980s a few elderly people
from this background still collected wild plants,
such as sow thistle. The stems were eaten as food,
described as ‘blackfellow’s salad’, and the milky
sap was used for treating cuts and warts (Clarke
1986a: 10; 1987: 9). Sow thistle was in a category
referred to as ‘blood medicine’, because of its
invigorating property as a food and tonic. When
the ‘colour bar’ formally ceased to operate,
allowing Aboriginal people much greater access
to towns, the use of wild foods and building
materials decreased markedly, since the wild
resources of the landscape were no longer needed
as a buffer between rations and wages. This had a
detrimental impact upon the survival of
Aboriginal knowledge of the pre-European uses
of naturally occurring plants and animals.
The heavily regulated lifestyle of Aboriginai
Acrylic painting (S.A. Museum, A69498) by Ian Abdulla, 1990, features collecting dead wool in the Riverland agricultural district of South
92 PA CLARKE
people in the Lower Murray had helped to
maintain some knowledge of traditional resource
exploitation through hunting, fishing and
gathering. Nevertheless, many of the former
hunting and gathering places, particularly those in
agricultural areas, were inaccessible to
Ngarrindjeri people. By the mid 1960s, when
legislation restricting Aboriginal movements was
rescinded (McCorquodale 1987), visits by large
family groups to summer camping sites, such as
along the Coorong, declined in frequency. People
now had other places they could go for recreation.
The European-dominated landscape partially
opened up for Aboriginal people, resulting in
more movement into towns and the Adelaide
suburbs. The summer trips, although recreational,
had been important events that gave participants a
sense of belonging to the Lower Murray
landscape. Through the 1980s, the descendants of
families that had lived on the Aboriginal reserves
continued to maintain a connection with this area.
Although based in Adelaide, some of them leased
these reserves from the Aboriginal Lands Trust
and maintained small holiday shacks on them.
In the 1980s older members of Aboriginal
families that had taken up farming on various
Lower Murray reserves generally had some
knowledge about pre-European uses of plants and
animals. This was so because of their earlier
reliance on naturally occurring resources to
supplement supplies gained from local towns and
because they had an occupation that still involved
use of the land. Fringe camp dwellers and
Aboriginal farmers were marginal people in the
sense that their greater remoteness from direct
white control, in comparison to people ‘on the
mission’, meant that they were unable to rely on
outsiders for all their material requirements. These
people therefore needed to be more opportunistic
than those more directly supported by the state.
Some Aboriginal people were able to move
between the Aboriginal farms, the fringe camps
and the mission station.
FISHING
Fishing was a major activity of Aboriginal
people in the pre-European period (Clarke 2002),
and continued after European settlement, with the
involvement of Aboriginal people in the fishing
industry. The seasonality of European-controlled
fishing activities would have suited the
incorporation of indigenous labour, particularly
during the nineteenth century when Aboriginal
movements were less restricted. European fishers
in the Lower Murray adopted the use of many
Aboriginal fish names. The importation of these
words into Australian English, like those for other
faunal species with a restricted distribution, was
generally confined to the area of the source
language (Ramson 1966: 120-121; Turner 1972:
123). For example, the golden perch is also widely
known in Australian English, particularly in the
eastern states, as ‘yellow-belly’, based on its
appearance. In the South Australian section of the
Murray River, contemporary anglers call it
‘callop’, which is probably derived from an
Aboriginal term, kalapko, from the Ngaiawung
and Nganguruku languages of the Riverland
district (Clarke 2001ms). Nevertheless, many non-
indigenous fishers of the Lower Lakes still refer
to this species as tarki, based on one of the
associated Ngarrindjeri words (Clarke 2001ms;
Eckert & Robinson 1990: 18-19; Smith 1930:
229; Turner 1972: 123). During the author’s
1980s fieldwork, Lower Murray people
exclusively used another Ngarrindjeri word,
pilalki, for this fish.
In the 1860s involvement in the Lower Lakes
fish trade centred at Milang was a major part of
the economy of the Point McLeay Aboriginal
Mission. The creation of the Murray River
Barrages, completed in 1940, destroyed this
mission station enterprise (Clarke 1994: section
6.1). In particular, the mulloway (Argyrosomus
hololepidotus) and jumping mullet (Liza
argentea) fisheries around the Murray Mouth and
in the Coorong suffered (Olsen 1991: 2, 21-22;
Sim et al 2000: 103, 105). Ngarrindjeri people
also participated in the Murray River fishing
industry (Abdulla 1993; Grace 1990). Oscar
Kartinyeri recalled during an interview with the
author in 1988 that Aboriginal people in the
Lower Murray and upstream to the Riverland
agricultural district of South Australia in the early
twentieth century used handmade nets to catch
fish. These nets were made from split rushes,
scalded before knotting to strengthen them. The
fish would be driven up creeks leading into the
river and the net placed across the entrance. Fish
were then forced back downstream into the net.
Golden perch and silver perch were often caught
in this manner. Apparently the Mannum to
Renmark area of the Murray River had many such
creeks suitable for this purpose. According to Jack
Koolmatrie, nets and fish-traps were still being
utilised by Aboriginal people in the Coorong
during the same period (Ely 1980). Bellchambers
(1931: 21-22) claimed that along the Murray
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 93
River the Aboriginal fishing spear made from two
lengths of fencing wire mounted on a wooden
shaft was still commonly made in the 1880s and
was the last pre-European style weapon to
disappear from general use. The poorer examples
he saw being made in the 1920s were for sale to
European ‘relic hunters’.
During the author’s fieldwork, an Aboriginal
person gave an account of how Aboriginal people
living along the Murray River during the 1950s
stored surpluses of fish. A Ngarrindjeri man and
his family travelled to the Riverland to find
seasonal work, such as fruit picking. Fish from
the river, caught by the father, were a major
source of food. The man was eventually offered a
shearing job away from camp for a few days.
Nevertheless, he did not want to leave his family
without a means of getting food. Therefore, before
leaving he fished, catching seven or eight fish for
several meals. The surplus was kept in a nearby
small muddy pond. The fish remained alive for
several days, and were pulled out by his family as
required. This man apparently often put fish there.
This method of preserving food is similar to that
for the fish storage ponds described in the early
ethnographic literature (Clarke 2002). Near
Pelican Point, European fishers also kept their fish
alive by placing them in ‘pounds’ made of ti-tree
stakes, while they waited for favourable weather
to allow transportation to the Goolwa market
(Evans 1991: 40). It is not known who learned
this practice from whom.
Aboriginal people were opportunistic in some
of their economic activities. For instance, from
August to September a large number of bony
bream (Nematalosa erebi) die of natural causes in
Lake Alexandrina and Lake Albert, floating to the
surface. Local Aboriginal people were once in the
habit of going to the lakeshore or heading out in
small boats to collect them. According to
Ngarrindjeri sources, up until the 1930s and 1940s
old women at the mission station would organise
children into groups with hessian bags to collect
the dying fish from the lake shore. The only fish
taken were those with red gills, as this is a sign of
their freshness. This species of fish has sweet
flesh, although its numerous bones make it
commercially less valuable.'® Many younger
Aboriginal people refused to eat this fish, and still
do, precisely because it is so bony. In the 1980s a
few of the older Lower Murray people were still
able to cook the fish in such a way that the bones
came away in one piece.
As a result of a decline in the Lower Lakes
fishery, by the 1980s there were few Aboriginal
people living at Point McLeay or in other Lower
Murray towns who had any direct experience with
commercial fishing. Whereas many older
Aboriginal people could remember a time when
favourite indigenous fish were abundant, by this
time mainly European carp was caught. A few of
the local non-Aboriginal people with fishing
licences caught mainly estuarine fish, such as
yellow-eye mullet (Aldrichetta forsteri) in the
Coorong, and European carp (Cyprinus carpio),
redfin perch and some golden perch in the Lower
Lakes (Olsen 1990; Sim et al 2000). Aboriginal
people who were middle aged or older,
particularly women, were the main recreational
fishers at Point McLeay. During fieldwork it was
observed that several elderly women living there
enjoyed fishing for silver perch and golden perch.
A favourite location for them was at ‘The
Bulrushes’, near Wangarawar Point on the
northeastern edge of Point McLeay town reserve.
Groups of old women, no longer burdened by
child rearing, were in the habit of going fishing
for long hours on the lake shore. Carp was the
main fish species caught, but was generally left to
die on the bank. Only a few of the Point McLeay
residents would eat such coarse meat. Aboriginal
people sometimes used it as yabbie bait (DETE
1998: 105). Parents and grandparents would
occasionally take their younger children fishing
along the lake or river. Youths also went fishing
in the lagoons for carp with handmade thrusting
spears.
During the author’s Lower Murray fieldwork in
the 1980s, most of the fishing by Aboriginal
people was with hand-lines. Throughout southern
South Australia, Aboriginal people often stated
that they were reluctant to fish with rods. This is
probably, to some extent, due to the
inconvenience of carrying so much tackle."? It was
also said that the use of a fishing rod was ‘too
flash’. The hand-line tradition of fishing was an
expression of the modern southern Aboriginal
identity. Earlier in the twentieth century,
Ngarrindjeri fishers often made their own lines
from cord, with sinkers made from lead melted in
'* A version of the Ngurunderi story, told in schools, explains how this fish became bony (Education Department of South Australia 1988). In the
Ngurunderi mythology, bony bream is the fish that young women are forbidden to eat (Berndt 1940: 173).
© Aboriginal people in southem Australia, before the arrival of Europeans, probably did not commonly use the fishhook and line (Clarke 2002: 150-151).
94 PA CLARKE
a teaspoon (DETE 2001b: 82, 88). So strong was
the hand-line practice in the 1980s that Aboriginal
people consciously drew this distinction between
themselves and white fishers. A young Aboriginal
man explained that ‘Only whitefellas use rods.
Nungas [Aboriginal people] do it blackfella
way.’
SHELLFISH GATHERING
Lower Murray people formerly collected
shellfish in great numbers (Cann et al 1991;
Luebbers 1978, 1981, 1982; Pretty et al 1983:
117-118; Tindale 1930-52: 67). The middens of
mollusc shells frequently found along undisturbed
sections of banks of the river and lakes, and on
the shores of the Coorong and sea, provide
evidence of this. Some Aboriginal people were
employed by Europeans to collect cockles (pipi,
Plebidonax deltoides) from along the Coorong
beach in sugar bags (DETE 2001b: 88). By the
late twentieth century, Aboriginal people largely
ignored mussels (such as Velesunio ambiguus)
and cockles as a food source, possibly due to
environmental changes in the Lower Lakes
making them either scarce or not as easily
gathered. Up until the 1960s, when Aboriginal
families visited Younghusband Peninsula and the
Goolwa area during the summer, cockles and
periwinkles were eaten (DETE 2001b: 64, 69, 70,
98). By the 1980s Lower Murray people rarely
went there, apart from infrequent day visits. In
spite of the proximity of Point McLeay to the sea,
the modern landscape made it difficult for
Aboriginal people to get to the ocean. Few
Aboriginal people in the Lower Murray had access
to watercraft or to the off-road vehicles needed to
get to the beach via the Forty Two Mile and Ti-
Tree Crossings. The contrast between the riverine
and marine zones was made more apparent after
the construction of the Murray Mouth Barrages,
completed in 1940 (McCourt & Mincham 1987:
11).
During the 1930s and 1940s yabbies
(‘crawfish’, Cherax destructor) were caught by
Ngarrindjeri people in a small bay near
Wangarawar, east of Point McLeay. There were
two methods employed to catch yabbies: pumping
their mud holes with one’s foot, which forced the
occupant out of a connecting tunnel; or fishing
for them with meat on a string (Wilson 1998: 92).
Ngarrindjeri woman Jenny Grace recalled that as
a child in the Riverland during the 1950s:
We'd be in the water a lot getting yabbies too. In
the winter time we used to go and crawl in the
swamp for yabbies. We’d feel under the blanket
weed and we’d find them under there (Grace
1990: 166).
Yabbies were important, not just as food but
also as bait for Murray cod fishing (Abdulla
1993). In the 1980s Lower Murray people caught
yabbies, chiefly during visits to the Riverland, by
using nets and wire traps.
MamMAL HUNTING
By the early twentieth century, most of the
traditional material culture and skills associated
with Aboriginal hunting and fishing practices in
southern South Australia had disappeared
(Hemming 1991: 134; Sutton et al 1988: 186).
Duck nets and spears had previously typified
hunting and fishing in this region (Clarke 1994:
section 4.2; Hemming & Jones 1989). In the case
of Lower Murray clubs, a few types persisted.
Men kept the fighting stick, or kanarki, as a
weapon of defence in their wurleys and houses
(Wilson 1998: 110). This was the custom as late
as the 1940s, according to Aboriginal sources.
Also, until about the 1960s, male youths were in
the habit of using a short club, or wadi (waddy),
with a single or double bulbous head to throw at
rabbits (DETE 2001b: 82, 89; Wilson 1998: 39,
58). For them, the killing of rabbits was a game of
skill, the thrower having to gauge the distance
whilst aiming at the head. With the demise of
wurley camps and the introduction of firearm
restrictions, these ‘old’ style weapons have
become souvenirs or museum pieces.
In the 1980s Ngarrindjeri people hunted rabbits
and birds by shotgun or .22 rifle, chiefly as a
recreational activity for the warmer months of the
year. Lower Murray people could remember
eating other creatures such as wood grubs, snakes,
echidnas and a variety of lizards. Kangaroos were
eaten less than introduced red meat sources like
sheep, mainly due to their scarcity. In the decades
prior to the 1980s, most kangaroo meat came from
areas in the South East of South Australia, such as
Coonalpyn or Kingston, where they were still
20 Aboriginal people define Nungas (pronounced ‘Nargars’) as indigenous people from southern South Australian communities (Clarke 2001ms;
Mattingley & Hampton 1988).
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 95
relatively common. Aboriginal men had earlier
been involved in shooting kangaroos for their
hides in the South East (Wilson 1998: 96). During
the 1980s at Point McLeay, some people,
originally from the West Coast of South Australia,
would catch, cook and eat blue-tongue and sleepy
lizards, which are relatively common on the
Narrung Peninsula.
Ngarrindjeri family groups hunted water rats for
their skins, which were sold to European furriers.
During the early to mid twentieth century this
appears to have been more commonly practised
along the Murray River, from Tailem Bend to the
Riverland. Ngarrindjeri woman Jenny Grace
remembered how water rat hunting was a common
activity during her childhood in the Nildottie area
of the Murray River during the 1950s. On the
family boat:
Most of the room would have been taken up with
the boards, and I would have to sit on top of
them. These boards were used for pegging out
rat skins. ... We'd just travel around, maybe row
about seven miles, camp near where there was a
big swamp or something, where we thought it
was going to be good for rats. I think dad had
about 120 traps and they would have been the
most valuable possessions that we had. ... We'd
stay in one place for about three days usually,
until the skins dried, and if we ran out of boards
to peg them on we’d peg them onto the gumtrees
then roll them up ready to be sold (Grace 1990:
158).
The skins were destined for the fur market in
Adelaide. The families of Bluey Roberts and Jerry
Mason junior were also involved in catching water
rats in the Riverland (DETE 1998: 86; 2001b: 78).
Colin Cook said that at one time they sold the
water rat skins for about four shillings each
(DETE 2001b: 62). Ian Abdulla, who lived at
Cobdogla during the 1950s and 1960s, claimed
that:
There was another way of making an income
and that was catching rats and selling the skins
to a buyer at Renmark in the Riverland so the
skins could be used to make purses or handbags.
To get the rats we had to dive down to the
bottom of the creek or swamps to get mussels to
put on the traps. ... We set the traps on logs to
catch the rats overnight. ... The next morning
my father and brother would go out in the boat
to check the traps to see how many rats we
caught overnight, then they would take the rats
home to be skunt or skinned. Then the skins
were pegged out on the boards and put in the sun
to dry (Abdulla 1993).?!
In the 1980s Ngarrindjeri woman Laura
Kartinyeri said that her family had been heavily
involved in the water rat skin trade, particularly
when they were based in the Three Mile Camp at
Tailem Bend. Such activities fitted in with spells
working as farm labourers or in local factories.
During the author’s fieldwork, rabbits were the
most readily obtained wild mammals in the Point
McLeay region. Although most Aboriginal people
knew that the rabbit was an introduced species,
this did not diminish the cultural importance of
rabbit shooting. On many occasions hunting
parties were organised spontaneously, rather than
in advance. A visitor who was unfamiliar with the
region may have had one of these events arranged
for their benefit. This allowed the Lower Murray
people at Point McLeay to ‘show our land’ to the
newcomer. Even when a hunting party was
primarily a response to a desire for rabbit or duck
meat, the cultural significance remained. A senior
person in the community made arrangements for
obtaining guns and a car. The type of car preferred
was usually a large sedan with high clearance
from the ground. Generally, the time chosen to go
‘rabbiting’ was the early evening when it was
becoming dark. Hunting excursions were
generally to nearby Aboriginal-run land reserves
and farms, such as Block K, Gum Park, or in the
paddocks at the back of Big Hill.
Local hunting trips were almost entirely male
events. Women might be present when the
shooting was secondary to another activity, such
as getting firewood. On most trips experienced by
the author, a particular old ‘uncle’ at Raukkan
was consulted early during the arrangements. This
was to see if he would come along, or whether he
could lend some of his guns, or simply to tell him
that people were ‘going bush’. The driver was
usually the organiser, because he took control of
where the party went. The favoured areas for
shooting had driving hazards which were difficult
to see at night. Obstacles to avoid included fallen
trees, tree stumps, low patches of scrub, sand
drifts, rabbit warrens, piles of limestone,
soakages, rusting farm machinery, barbed wire
tangles and general rubbish. It was therefore
necessary for the driver to have a high degree of
localised geographic knowledge. Men who had
worked on the Point McLeay properties took pride
in identifying the landscape during the night’s
71 See Abdulla (1993), Clarke (2001b, pl. 92) and Hemming & Clarke (1991: 14) for paintings of water rat hunting activities.
96 PA CLARKE
activities and were delighted when outsiders lost
their sense of direction. Although the driver
usually did little shooting, the structure of the
event meant that his was a high prestige role.
Youths who took part generally either spotted
with the searchlight or acted as runners to collect
and finish off the shot rabbits.
There was some resistance to shooting at
animals other than rabbits, despite the fact that
hares, foxes, a small number of kangaroos and
deer were often seen.” The stated reason was
usually that they were either not common or
simply that they were not “doing the hunters any
harm’. In this context, Aboriginal people
articulated that feral animals were to some extent
like them, which is outside ‘white law’. The
shooting parties of local non-indigenous farmers
do not possess this sentiment. Although they
engage in rabbit shooting for recreation, the
structure of their activity generally reflects their
personal economic interests in getting rid of
pests.”?
For Aboriginal people the aim was to shoot
rabbits through the head, as this was a discarded
part of the carcass. A plastic garbage bag in the
boot of the car held the shot rabbits until the
conclusion of the shoot. The gutting took place in
the field in front of the car’s headlights, as this
was a messy job. The removal of the entrails made
this operation too dirty for home. Back at Point
McLeay, the heads and lower legs of the rabbits
were chopped off, using a hatchet or machete on a
block of wood. On a good night there would be as
many as 50 rabbits to skin and gut. If there were a
large number of rabbits killed, the processed
carcasses were held by the hide of their legs on a
clothesline until the whole job was over. This
prevented dogs from running off with them before
the end of the job. Hungry dogs at the settlement
quickly removed the refuse produced.
The rabbit meat was ready for cooking after it
had been soaked overnight in water to remove
some of the strong odour of the flesh peculiar to
rabbits. Next morning, various senior people at
Point McLeay received the carcasses that were
wrapped first in layers of newspaper and finally
plastic. Often, the biggest share went to the
provider of the guns or ammunition, or to the
owner of the vehicle. Although people in the
Point McLeay settlement would often hear about
22
a hunting trip the next day, the specific details
were generally not discussed outside the local
Aboriginal group. Hunting on Aboriginal land
occurred in an Aboriginal realm of activity that
Point McLeay people preferred to keep to
themselves.
BirD SHOOTING
The main species of duck hunted by Point
McLeay people in the late twentieth century were
the grey teal (Anas gibberifrons) and the
mountain duck (Tadorna_tadornoides).
According to Aboriginal sources, the hardhead
duck (Aythya australis) was common in the
Lower Lakes but seldom seen by the 1980s
(Wilson 1998: 90). Other species formerly
hunted for food by mission station residents
include the banded stilt (Cladorhynchus
leucocephalus), black swan (Cygnus atratus) and
Cape Barren goose (Cereopsis novaehollandiae).
In particular, cooked swan intestines were
regarded as a great delicacy** and the Cape
Barren goose was desired for Christmas roast.
The pelican (Pelecanus conspicillatus) was often
hunted for its feathers, which were used in
making house ornaments (Clarke 1994: 290, 336;
1996a: 75; DETE 2001b: 70). The flesh of the
pelican was said to be like the shag (Leucocarbo
fuscescens), considered ‘too fishy to eat’ by most
Aboriginal people in the Lower Murray during
the 1980s. Nevertheless, a Ngarrindjeri man
claimed that the breast of the pelican was like
steak if properly prepared. The carcass needed
hanging for a few days ‘to get rid of the wild
taste’. Bait for fishing sometimes came from the
flesh of the silver gull (Larus novaehollandiae).
The bird was caught by baited hook on nylon
fishing line tied to a log or branch.
Duck shooting usually happened in the early
morning. It involved more stealth than for rabbits;
the shooters often crawled for some distance and
then hid. For this reason, bird-shooting groups
from Point McLeay were generally smaller than
those for rabbits. After travelling to the area in a
car, the hunters walked to the lagoon. Talking
outside the vehicle was minimal and in whispers.
Messages were by hand signals and single word
utterances in Ngarrindjeri language, such as nakan
The deer originally escaped in the 1980s from a stud near Narrung. The stud was then closed and the remaining stock removed.
23 Morton (1990) has investigated the cultural role of non-Aboriginal hunting in contemporary Australia.
4 Swan intestines were called kungari waltjeri.
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 97
(‘look’), kungen (‘listen’), tawul (‘stop’) and
lewin (‘lie down’). As for rabbit shooting,
knowledge of the landscape was crucial for duck
shooting, not just to avoid obstacles but also to
find a suitable place from which to shoot.
The main duck hunting sites near Point McLeay
were the lagoons at ‘The Bulrushes’ and on the
flats behind ‘Big Hill’ near Teringie. At the latter
site the lagoons were periodically flooded. Point
McLeay workers deliberately opened up the
entrance to the lake with a tractor to produce a
habitat to attract water birds. Bunkers were dug
out of the mud well in advance of the hunting trip
and the walls were covered with samphires
(Halosarcia species). These served as shooting
points next to lagoons, and were particularly
necessary near Teringie where the landscape is
open. Another spot at the Teringie lagoons from
which to shoot was next to some large boxthorns.
This area was ‘prildi place’ to some — a reference
to the numerous ants found there at night. By
crouching in front of the bushes, a shooter
wearing dark clothing remained hidden from the
birds. At “The Bulrushes’ there were plenty of
hiding places among the lignum (Muehlenbeckia
cunninghamii) and bulrushes (Typha species). The
remains of an old limestone-walled bunker on the
more open side of “The Bulrushes’ lagoon were
still visible during the 1980s.
From a good early morning hunt, a dozen ducks
might be shot. Birds were plucked on site before
returning home to avoid making a mess in the
township. Also, feathers lying about a person’s
yard may lead to unwanted questions from visitors
from outside their extended community. There
was some distrust of the authorities interfering
with their activities. Back at Point McLeay, as
with rabbits, senior people in the community
tended to be given most of the catch.
COLLECTING Birp EccGs
The practice of collecting swan eggs, known in
Aboriginal English as ‘swan-egging’, was a major
activity for Aboriginal people in the Lower Lakes
and Murray River districts up until the late
twentieth century (Abdulla 1993; DETE 2001b:
69; Ely 1980). Swan eggs (kungari ngatjeri) are
large and greenish white; they are equivalent in
volume to five average fowl eggs. Although they
taste much the same as fowl eggs, those of the
swan are richer. The eating of a whole egg by a
single person has been known to cause diarrhoea.
The persistence of bird egg collecting as a
seasonal activity had continuity with pre-European
harvesting practices. Aboriginal informants
described how they would carefully observe swan
behaviour from late winter. Although the swan-
breeding season is broad and variable, Aboriginal
people claimed that in the Lower Murray it
occurred when the water levels in the lagoons
were high. The men first tried to determine the
general area where floating nests made from reeds
were being built. To find the exact location, the
collectors searched for swan tracks pushed
through the bulrush beds. Collectors generally
obtained the eggs by wading out into the lagoons,
although occasionally small boats were used.
Putting eggs in water tested their freshness — the
ones that sank were considered good for eating. A
few older Lower Murray people preferred to cook
and eat eggs that had ‘turned’, meaning that they
had chicks in them about to hatch. Swan-egging
occurred mainly in spring, before tiger snakes
(Notechis ater) become a major hazard in the
warmer months.
Aboriginal people travelled long distances to
obtain swan eggs. In the early twentieth century,
men from the Point McLeay Mission Station used
blanket sails on their dinghies to travel across the
lake to Point Sturt, returning with hundreds of
swan eggs (Wilson 1998: 44). As late as the
1950s, two women from Point McLeay rowed
across Lake Alexandrina to Mulgundawa to obtain
swan eggs in early spring (Padman 1987: 24).
They returned with their dinghy so heavily laden
with swan eggs that it was reported that only
about 75 millimetres of the boat was above water.
Certain Europeans in the Narrung area reportedly
received some of the booty as a gift. Other
Ngarrindjeri people used to row up Currency
Creek in the southern Fleurieu Peninsula to collect
swan eggs (DETE 2001b: 87).
European naturalists did not look favourably
upon the taking of swan eggs. Inspector McIntosh
of the Fisheries Department, before the First
World War, recorded that at Tanunda Bay along
the Coorong ‘two half-castes had arrived with a
boatload of swans’ eggs, which system of
wholesale robbery in the closed season the
inspector understands is a common practice
around the lakes’.** The ornithologist Captain SA
White recorded his views in his account of a bird
*S Register newspaper, 2 November [year not recorded] (Cutting Book, Anthropology Archives, S.A, Museum),
98 PA CLARKE
watching party he led to Dodd Creek on the
western side of Lake Albert. He reports:
We intended to continue our observations among
the water birds here, but to our disgust, we found
a party of natives encamped. They trade under
the name of aborigine, but most of them have
very fair skins - in fact, quite white, as I
remarked before. These men destroy a fearful
number of swans, by rifling the nests. This
outrageous slaughter should be stopped (White
1913: 57).
The scientific concerns of White and his
colleagues were not compatible with the needs of
local Aboriginal people.
Aboriginal people had to collect swan eggs by
stealth. A farmer living near the Point McLeay
settlement provided one account of a swan
expedition from Point McLeay. She said:
Only a few years ago, the alarm was sounded all
along the lake edge that four ‘boys’ from Point
McLeay were missing. They had gambled that
they could get some swan eggs although they
knew that it was illegal. Those of us who lived
along the waterway switched on lights in case
the missing boys needed land marks. Some of
the men were in the act of rigging up spotlights
on four wheel drive vehicles when the call came
that they were safe. Actually they’d been sitting
behind some reeds for some considerable time,
afraid to land, as they could see a police patrol
vehicle at the ferry. Eventually they threw their
forty odd eggs overboard, wrongly thinking that
the officer was waiting to catch them (Padman
1987, p.25).
Since the 1980s Aboriginal people were legally
able to remove the eggs in a restricted number of
places, as long as it was not part of a commercial
venture (Wilson et al 1992: 91-2). Nevertheless,
as with rabbit and duck hunting, they tended to
keep secret the details of these activities.
During the 1980s Lower Murray people
generally ignored the eggs of birds other than the
swan. Nevertheless, Ngarrindjeri informants say
that in the 1940s and 1950s eggs of the silver gull
were often obtained for eating. Collecting took
place from islands in the Coorong. In particular,
people living on nearby Aboriginal reserves on
the mainland side had access to these resources.
Other species whose eggs were eaten include the
coot (Fulica atra), water hen (Porphyrio
porphyrio), teal (Anas gracilis) and black duck
(Anas superciliosa) (DETE 2001b: 62, 64, 78-79,
94). Aboriginal people in South Australia had the
right to take wildfowl eggs until this right was
repealed under the National Parks and Wildlife
Act 1972.7° Under the Fauna Conservation Act
1964 that it replaced, Aboriginal people had the
right to hunt out of season, on crown land and on
private property. In the latter case, hunting was
allowed only if the landowner gave permission. In
the 1972 Act no consideration was given to
Aboriginal land use. Most Ngarrindjeri people
spoken to in the 1980s asserted that they had the
moral and cultural right to take a few swan eggs,
as long as at least one egg per nest was left
untouched. Aboriginal people claimed that swans
would generally only rear one chick, and they
therefore thought it was reasonable to leave only a
single egg to become an adult. In the Lower
Murray region Aboriginal gatherers stated that
there are generally four eggs in each clutch.”’
ARTEFACT MANUFACTURE AND ART
Aboriginal people in the Lower Murray during
the 1980s considered that the knowledge of how
to make ‘old time’ artefacts, and of where in the
landscape to obtain the necessary raw materials,
helped to reinforce their Ngarrindjeri identity.
After a long period, when Aboriginal
woodcarving and art practices had largely
vanished from the Lower Murray, these traditions
were revived in the early 1980s. Some artefacts,
described as ‘old time’ examples, were made for
Aboriginal use as home decorations (Clarke
1996a). Some were also sold to non-Aboriginal
collectors and museums. In these cases the objects
were essentially statements of the artists’
connections with the pre-European past. Artefacts
such as baskets and mats were utility articles in
the pre-European period, but from the 1980s they
had the added status of icons, particularly for local
Aboriginal people.*® The interest in and
consumption of Aboriginal culture by such non-
Aboriginal agencies as contemporary art and
artefact collectors, museums (Hemming & Jones
1989), and education departments (Education
Department of South Australia 1988, 1990, 1991)
has helped increase the significance of these items
as symbols of a hunter-gatherer past.
26 McCorquodale (1987) discussed the impact of legislation on Aboriginal issues.
Breeding time is dependent upon water level.
Omithologists state the number of eggs in one clutch is between four and seven, although over ten has been recorded (Beruldsen 1980: 161).
This trend grew through the 1990s, providing a medium for some indigenous people to express their cultural identity (see Bell 1998: 78-89).
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 99
FIGURE 2. Lindsay Wilson at the Coorong making a wadi club from eucalyptus wood, using a broken plate as a
scraper.
100
Since the 1980s and early 1990s, Lower Murray
artists and crafts people have had prominence in
the local Aboriginal art and craft market in
Adelaide (Hemming & Clarke 1991: 12-14;
Sutton et al 1988: 188-190). Aboriginal people
such as Paul Kropinyeri and Bluey Roberts
specialised in carving. For example, Paul
Kropinyeri experimented with making bark spear-
deflecting shields, some of which the South
Australian Museum purchased (Hemming 1991:
135-6; Sutton et al 1988: Fig. 230). One of his
last projects was discovering how to make bark
canoes. Bluey Roberts carved mainly emu eggs
and boomerangs for sale as art pieces, developing
a unique style that incorporated figural elements
from both the West Coast side of his family, such
as emus and goannas, and the Lower Murray side,
usually a Murray cod (DETE 1998: 86-7;
Hemming & Clarke 1991: 14; Sutton et al 1988:
Fig. 234). As with Paul Kropinyeri, Lindsay
Wilson used museum collections as a source of
information for reproducing the old style weapons
from the Lower Murray. Nevertheless, he was also
able to draw upon his own memories of early
boomerang and club types (Fig. 2). In the 1930s
Lindsay Wilson had assisted Clarence Long in
making clubs for sale to Europeans.” From the
1980s there was a small market in making realistic
representations of pre-European harvesting and
fighting implements.
Some artists expressed a close relationship to
the landscape, not through making pre-European
style objects, but by producing images in Western
style art media. For example, Harvey Karpany
produced water colour paintings and ink drawings
that focused on various Lower Murray spirits and
their associated environments (Hemming &
Clarke 1991: 14; Sutton et al 1988: Fig. 236).
Many Aboriginal people found that his work had
a supernatural quality, being ‘like gupas’ (or
ghosts). Jack Stengle concentrated on acrylic
paintings on board and canvas. He tended to use
Lower Murray mythology and history as subjects
(Clarke 2001b: pl. 93; DETE 1998: 90-91, 2001a;
Sutton 1988: Fig. 237). Older Aboriginal people
in the Lower Murray community have played a
major role as sources of the cultural and social
data depicted in the work of these artists.
people of the Coorong (see Tindale 1986: 498-499).
PA CLARKE
The local market for baskets was strong early in
the twentieth century when similar ‘third world’
goods from India and Indonesia were not widely
available. In 1909 the Royal Institute for the Blind
attempted to get Aboriginal people at Point
McLeay to make particular styles of basket to
replace the rattan imports from Asia (Jenkin 1979:
214). The reluctance of Aboriginal people to
change craft styles is reported to have led to the
failure of this initiative. The Point McLeay
Mission Station supported the basket-making
tradition by placing it on the school curriculum in
1904 (Jenkin 1979: 227). The skill was taught to
girls as part of their domestic duties (Wilson
1998: 23). Up until 1951 tourists on paddle
steamers came across the lake to visit the mission.
Dulcie Wilson recalled that ‘Near to the jetty,
women from the Mission would display their
craft-work, mainly baskets and mats, made from
rushes or grasses grown by the lake shore’
(Wilson 1998: 25).*° Basket and mat makers also
sold their product to local non-Aboriginal people,
before foreign imports from the 1960s priced them
out of the market for cheap domestic items. The
persistence of indigenous basket-making practices
in the Lower Murray was primarily due to
continued household use of these items by both
Aboriginal and non-Aboriginal people.
In the early 1980s Lower Murray people revived
their basketry traditions as part of the building of
a local indigenous identity (Fig. 3). Due to the
small but steady craft market that developed, this
aspect of pre-European material culture has
survived in a modified form to the present.
Through the 1980s and 1990s the main Aboriginal
people making mats and baskets were Ellen
Trevorrow and Yvonne Koolmatrie, both of whom
were taught the techniques by Dorothy Kartinyeri
in 1982 (Clarke 2001b: 111-112; DETE 1998:
104-105, 110-111; Hemming 1989: 48; Sutton et
al 1988: 187-188). Museums and art galleries
have acquired examples of their work.
The making of flower ornaments from pelican
feathers was another distinctive Lower Murray
craft of the late twentieth century, although
originally introduced from Victoria (Inglis
1961).31 Women chiefly made these to sell to
visitors to the mission station, local farmers and
Clarence Long, also known as Milerum, was considered by Tindale to be the last of the Coorong people with traditional knowledge of the Tangani
Aboriginal informants remembered, as children, jumping into the lake for coins thrown from the paddle steamers. Trips from Goolwa ended in 1951
when the local steamer was destroyed in a fire (F. Tuckwell, pers. comm.).
Annie (‘Fof-fon’) Rankine was reputed to have been the first maker of feather flowers in the Lower Murray (J. Chilman, pers. comm.). She
experimented with feathers from a number of species before concentrating on pelicans.
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 101
FIGURE 3. A selection of Lower Murray / South East ‘sister’ baskets. From top left: maker unknown, Mannum,
c.1932 (A17530); Ethel Watson, Kingston South East, c.1931 (A15950); Yvonne Koolmatrie, Berri, 1989
(A69209). From bottom left: maker unknown, Manunka, c.1932 (A17524); Ellen Trevorrow, Meningie, 1987
(A65184); maker unknown, Manunka, c.1932 (A16638), maker unknown, Encounter Bay, c.1900 (A2519).
town dwellers (Wilson 1998: 25). In the 1980s the
National Parks and Wildlife Service would give
permission for Aboriginal people to kill a pelican
for its feathers. However, this was only in order to
keep the tradition going because, legally, the
finished artefacts could not be sold (Wilson et al
1992: 91-2). Aboriginal people occasionally used
feathers from a pelican found dead, perhaps killed
by the power lines. Alternatively, some people
made their flowers from the feathers of bantams
and other bird species.
As with other regions of Australia, the sale of
artefacts supplemented the income of some
extended Aboriginal families. Aboriginal people
often earned money by demonstrating their unique
craft and art styles to school children and special
interest groups. In the 1980s the work of many
southern Aboriginal artefact-makers and artists
was being promoted through exhibitions and
workshops organised by the South Australian
Museum and the National Aboriginal Cultural
Institute at Tandanya in Adelaide. In the case of
the craft people, the knowledge of where to find
the raw material in the landscape and the
possession of the appropriate ‘traditional’ artefact-
making skills, was considered by them to be an
integral part of their Lower Murray culture.
CULTURAL IMPORTANCE OF MODERN HUNTING AND
GATHERING
Hunting and gathering wild food seasonally
added to the food supply of many Aboriginal
households in the Lower Murray, although its
significance diminished in the closing decades of
the twentieth century. As demonstrated by Sackett
(1979) in the Western Desert, in assessing the
importance of foraging activities to the
contemporary community, it is wrong to assume
that they were simply food-producing activities
conducted solely in response to economic and
recreational needs. For many Aboriginal people in
the Lower Murray, foraging is an expression of
their local identity. Hunting and gathering
practices have important cultural values, not only
102
‘proving’ Aboriginal abilities in obtaining a living
from the land, but demonstrating that people have
an affinity with and knowledge of the landscape,
however altered it is by non-Aboriginal activities.
In the 1980s some Ngarrindjeri people associated
their families with the totemic symbols (ngatji) of
the pre-European clans.” Most of these are birds,
such as the musk duck (Biziura lobata), Cape
Barren goose, pelican and black swan (Clarke
2001ms). Although these symbols no longer have
a role in determining kinship relationships, the
knowledge of them serves to reinforce
Ngarrindjeri identity. Birds can have a modern
symbolic significance as well. In the 1980s
Aboriginal people in the Lower Murray adopted
the black swan as the Ngarrindjeri emblem, as
used, for example, on sporting uniforms.
Modern harvesting practices reinforce an
Aboriginal view of the landscape, albeit a
recently developed one. An analysis confined to
the technology used, often steel traps and shot
guns, would not adequately demonstrate the
distinctiveness of Aboriginal use of the
environment. The cultural importance of
harvesting to Lower Murray people is
particularly evident in the case of rabbit
shooting. One of the advantages of this particular
type of hunting is that it is a group activity. The
use of a vehicle facilitates much conversation
amongst the hunting party. Discussions concern
the location of particular geographical features
on the reserves, such as water tanks, ruins, old
wells, trees, tracks and fences. The dialogue
often touches upon past events associated with
the scrub and the connecting farmland. Stories
are told featuring the past residents of Point
McLeay, as well as drawing upon the psychic
realm of ghosts, spirit beings and sorcerers.**
Although, to a lesser extent, this occurs during
duck shooting and swan egging, the high level of
interaction among the hunters in vehicles is not
possible when stalking or ambushing. Sometimes
the most in-depth look at the land came when
the group, or a part of it, later reflected upon the
hunting trip. In their Aboriginal view of the
landscape, the harvesting areas are
topographically and culturally important sites.
Aboriginal participants in shooting parties and
PA CLARKE
swan egging expeditions not only forage for
food; they are taking part in occasions for
interpreting and experiencing their landscape.
Legislation in the twentieth century, restricting
the killing of indigenous birds and prohibiting the
taking of their eggs, severely affected Aboriginal
bird harvesting practices in the Lower Murray.
Although most Aboriginal people interviewed in
the 1980s stated that hunters must leave certain
species alone due to their scarcity, they perceived
the wildlife protection acts as yet another
encumbrance placed upon them by white
authorities. Added to this were the restrictions
placed on vehicular access to the Younghusband
Peninsula. When speaking about land use, Lower
Murray people stressed that they must be given
the rights to continue pre-European-style
harvesting practices. Aboriginal people saw no
problem with national parks as long as they had
access to their resources. During the 1980s local
park and wildlife protection authorities allowed
some degree of use of the parks for gathering raw
plant materials for artefacts and for the shooting
of protected faunal species. Some Negarrindjeri
men were employed as park rangers, which
facilitated an improved relationship between the
local Aboriginal community and the authorities.
Nevertheless, the constant monitoring demanded
by these activities, such as the individual permits
required to shoot a certain number of animals,
means that much tends to occur outside the law.
Aboriginal people prefer to be discreet about their
activities to avoid non-Aboriginal interference.*
For this reason, Aboriginal people in the Lower
Murray often appear to outsiders to be
unnecessarily secretive about their hunting,
fishing and gathering expeditions.
A number of studies have urged Australian
governments to give more formal recognition to
indigenous hunting, fishing and gathering rights
over both marine and inland resources (Altman et
al 1995; Peterson & Rigsby 1998; Resource
Assessment Commission 1993: 166-189; Smyth
1993: 211-225). Other reports have considered
the role of Aboriginal people in managing wild
animal resources (Altman et al 1997; Bomford &
Caughley 1996; Parliament of the Commonwealth
of Australia 1998; Wilson et al 1992), and the
2 For a description of the pre-European role of ngatji, see Berndt & Berndt (1993: 249-251, 470-473, 417-419).
See Clarke (2002ms) for an explanation of ‘gupa’ and ‘kuratji yarns’. Such pre-European style spirits, as distinct from the ghosts of known people,
are often associated with areas of old vegetation, such as Block K (Clarke 1999a: 153-155, 160).
Aboriginal hunters and gatherers.
Brody (1983) gives a detailed description of the plight of Indian hunters in Northwest Canada, which has some similarities to that of modern
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 103
complexity of hybrid economies operating in
many Aboriginal communities (Altman 2001). To
many Aboriginal people in the Lower Murray,
access to the environment and its resources was
considered important in spite of landscape
changes. From the 1980s this has drawn them into
greater involvement in environmental issues.** The
use of the landscape by non-Aboriginal people is
usually not complementary to indigenous
harvesting practices.
In the Lower Murray during the 1980s many
older Aboriginal people recognised that, in spite
of poor social conditions, a few aspects of their
own earlier restricted lifestyle were, in hindsight,
desirable. The eating of wild foods, in particular,
was considered by them to have made their people
‘feel stronger’ than they do now. Many elderly
Aboriginal people expressed great sorrow that the
land they knew in their youth no longer exists.
These people spoke of the contemporary
landscape as being ‘sick’. Many of the Aboriginal
medicine and food plants and animals were no
longer to be found and the waters were now turbid
and prone to algal blooms. The reserves where
hunting, fishing and gathering could take place
were few and small, and generally restricted to the
Point McLeay—Coorong area. Nevertheless, some
Lower Murray people were able to maintain links
with their hunter-gatherer past. Such people, from
various backgrounds, stressed the importance of
their knowledge and use of local foods for the
maintenance of their regional Aboriginal identity.
Artefact making, in the style of the ‘old people’,
was important in a similar way. A distinct
Aboriginal perception of the physical landscape in
the Lower Murray persists, though it is radically
different from that which prevailed before
Europeans arrived.
REFERENCES
Abdulla, I. 1993. ‘As I Grew Older’. Omnibus Books:
Adelaide.
Aitken, PF. 1983. Mammals. Jn MJ Tyler, CR Twidale,
JK Ling & JW Holmes (eds) ‘Natural History of the
South East’, pp. 127-133. Royal Society of South
Australia: Adelaide.
Alcock, CR & Symon, DE. 1977. The flora. Jn DD
Gilbertson & MR Foale (eds) ‘The Southern Coorong
and Lower Younghusband Peninsula of South
Australia’, pp. 25-44. Nature Conservation Society
of South Australia: Adelaide.
Altman, JC. 1987. ‘Hunter—gatherers Today: an
Aboriginal Economy in North Australia’. Australian
Institute of Aboriginal Studies: Canberra.
Altman, JC. 2001. ‘Sustainable Development Options
on Aboriginal Land: The Hybrid Economy in the
Twenty-first Century’. Centre for Aboriginal
Economic Policy Research, Australian National
University: Canberra.
Altman, JC, Bek, HJ & Roach, LM. 1995. ‘Native Title
and Indigenous Australian Utilisation of Wildlife:
Policy Perspectives’. Centre for Aboriginal
Economic Policy Research, Australian National
University: Canberra.
Altman, JC, Roach, LM & Liddle, LE. 1997.
‘Utilisation of Native Wildlife by Indigenous
Australians: Commercial Considerations’. Centre for
Aboriginal Economic Policy Research, Australian
National University: Canberra.
Bell, D. 1998. ‘Ngarrindjeri Wurruwarrin. A World
That Is, Was, and Will Be’. Spinifex: Melbourne.
Bellchambers, TP. 1931. ‘A Nature-Lovers Notebook’.
Nature Lovers League: Adelaide.
Berndt, RM. 1940. Some aspects of Jaraldi culture,
South Australia. Oceania 11(2): 164-185.
Berndt, RM & Berndt, CH. 1951. ‘From Black to White
in South Australia’. Cheshire: Melbourne.
Berndt, RM, & Berndt, CH with Stanton, JE. 1993. ‘A
World That Was. The Yaraldi of the Murray River
and the Lakes, South Australia’. Melbourne
University Press at the Miegunyah Press: Melbourne.
Beruldsen, G. 1980. ‘A Field Guide to Nests and Eggs
of Australian Birds’. Rigby: Adelaide.
Bomford, M. & Caughley, J. (eds) 1996. ‘Sustainable
Use of Wildlife by Aboriginal Peoples and Torres
Strait Islanders’. Australian Government Publishing
Service: Canberra.
Brody, H. 1983. ‘Maps and Dreams. Indians and the
British Columbia Frontier’. Penguin Books: London.
Brown, AR (Radcliffe-Brown) 1918. Notes on the
social organisation of Australian tribes. Journal of
the Anthropological Institute of Great Britain 48:
222-253.
Campbell, TD. 1934. Notes on the Aborigines of the
south-east of South Australia. Part 1. Transactions of
the Royal Society of South Australia 58: 22-33.
** Hemming (1993), Kean et al (1991), Mulvaney (1991) and Young er al (1991). In the mid to late 1990s the Aboriginal community of the Lower
Murray became embroiled in the environmental and cultural debate over the development of Hindmarsh Island. Consideration of this is outside the
scope of the present paper.
104
Campbell, TD. 1939. Notes on the Aborigines of the
south-east of South Australia. Part 2. Transactions of
the Royal Society of South Australia 63: 27-35.
Campbell, TD. 1943. Some Aboriginal camp sites in the
Woakwine Range region of the south-east of South
Australia. Records of the South Australian Museum
7: 371-396.
Campbell, TD, Cleland, JB & Hossfeld, PS. 1946.
Aborigines of the Lower South East of South
Australia. Records of the South Australian Museum
8: 445-502.
Cann, JH, De Deckker, P & Murray-Wallace, CV. 1991,
Coastal Aboriginal shell middens and their
palaeoenvironmental significance, Robe Range,
South Australia. Transactions of the Royal Society of
South Australia 115(4): 161-175.
Clarke, PA. 1985a. The importance of roots and tubers
as a food source for southern South Australian
Aborigines. Journal of the Anthropological Society
of South Australia 23(6): 2-12.
Clarke, PA. 1985b. Fruits and seeds as food for
southern South Australian Aborigines. Journal of the
Anthropological Society of South Australia 23(9): 9-
22.
Clarke, PA. 1986a. Aboriginal use of plant exudates,
foliage and fungi as food and water sources in
southern South Australia. Journal of the
Anthropological Society of South Australia 24(3): 3-
18.
Clarke, PA. 1986b. The study of ethnobotany in
southern South Australia. Australian Aboriginal
Studies 2: 40-47.
Clarke, PA. 1987. Aboriginal uses of plants as
medicines, narcotics and poisons in southern South
Australia. Journal of the Anthropological Society of
South Australia 25(5): 3-23.
Clarke, PA. 1988. Aboriginal use of subterranean plant
parts in southern South Australia. Records of the
South Australian Museum 22(1): 73-86.
Clarke, PA. 1989. Aboriginal non-plant medicines in
southern South Australia and western Victoria.
Journal of the Anthropological Society of South
Australia 27(5): 1-10.
Clarke, PA. 1994. Contact, Conflict and Regeneration.
Aboriginal Cultural Geography of the Lower Murray,
South Australia. PhD thesis. Anthropology &
Geography. University of Adelaide: Adelaide.
Clarke, PA. 1995. Myth as history: the Ngurunderi
mythology of the Lower Murray, South Australia.
Records of the South Australian Museum 28(2):
143-157.
Clarke, PA. 1996a. Aboriginal use of space in the
Lower Murray, South Australia. Conference of
Museum Anthropologists Bulletin 28: 74-77.
Clarke, PA. 1996b. Early European interaction with
Aboriginal hunters and gatherers on Kangaroo Island,
South Australia. Aboriginal History 20(1): 51-81.
PA CLARKE
Clarke, PA. 1997. The Aboriginal cosmic landscape of
southern South Australia. Records of the South
Australian Museum 29(2): 125-145.
Clarke, PA. 1998a. Early Aboriginal plant foods in
southern South Australia. Proceedings of the
Nutrition Society of Australia 22: 16-20.
Clarke, PA. 1998b. The Aboriginal presence on
Kangaroo Island, South Australia. Jn J Simpson & L
Hercus (eds) ‘Aboriginal Portraits of 19th Century
South Australia’, pp. 14-48. Aboriginal History
Monograph. Australian National University:
Canberra.
Clarke, PA. 1999a. Spirit Beings of the Lower Murray,
South Australia. Records of the South Australian
Museum 31(2): 149-163.
Clarke, PA. 1999b. Waiyungari and his role in the
mythology of the Lower Murray, South Australia.
Records of the South Australian Museum 32(1): 51-
67.
Clarke, PA. 2001a. The significance of whales to the
Aboriginal people of southern South Australia.
Records of the South Australian Museum 34(1): 19-
35.
Clarke, PA. 2001b. The South Australian Museum
Adelaide. Jn S. Cochrane (ed.) ‘Aboriginal Art
Collections. Highlights from Australia’s Public
Museums and Galleries’, pp. 108-113. Craftsman
House: Sydney.
Clarke, PA. 2001ms ‘The Historical Origins of Late
Twentieth Century Aboriginal English in Southern
South Australia’. Manuscript. 378pp.
Clarke, PA. 2002. Early Aboriginal fishing technology
in the Lower Murray, South Australia. Records of
the South Australian Museum 35(2): 147-167.
Clarke, PA. 2002ms. ‘Modern Aboriginal beliefs in
spirits and ghosts, Lower Murray, South Australia’.
Manuscript. 40pp.
Cleland, JB. 1957. Ethno-ecology. Our natives and the
vegetation of southern Australia. Mankind 5(4): 149—
162.
Cleland, JB. 1966. The ecology of the Aboriginal in
south and central Australia. In BC Cotton (ed)
‘Aboriginal Man in South and Central Australia. Part
1’, pp. 111-158. South Australian Government
Printer: Adelaide.
DETE (Department of Education, Training &
Employment). 1998. ‘Aboriginal Artists in South
Australia’. Hyde Park Press: Adelaide.
DETE (Department of Education, Training &
Employment). 200la. ‘Ngarrindjeri Dreaming
Stories, with Paintings by Jacob Stengle’. DETE
Publishing: Adelaide.
DETE (Department of Education, Training &
Employment). 2001b. ‘Ngarrindjeri People and
Environment. Past, Present and Future’. DETE
Publishing: Adelaide.
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 105
Eckert, J. 2000a. Mammals. /n Strathalbyn Naturalists
Club ‘Natural History of Strathalbyn and Goolwa
Districts’, pp. 13-24. Strathalbyn Naturalists Club:
Strathalbyn.
Eckert, J. 2000b. Birds. /n Strathalbyn Naturalists Club
‘Natural History of Strathalbyn and Goolwa
Districts’, pp. 25-86. Strathalbyn Naturalists Club:
Strathalbyn.
Eckert, J. 2000c. Reptiles and Amphibians. Jn
Strathalbyn Naturalists Club ‘Natural History of
Strathalbyn and Goolwa Districts’, pp. 87-96
Strathalbyn Naturalists Club: Strathalbyn.
Eckert, J & Robinson, RD. 1990. The fishes of the
Coorong. The South Australian Naturalist 65(1): 4—
30.
Education Department of South Australia. 1988.
‘Thukeri: A Ngarrindjeri Dreaming Story’.
Aboriginal Studies R-7. Education Department of
South Australia: Adelaide.
Education Department of South Australia, 1990. ‘The
Ngarrindjeri People: Aboriginal People of the River
Murray, Lakes and Coorong’. Aboriginal Studies 8—
12. Education Department of South Australia:
Adelaide.
Education Department of South Australia. 1991. ‘The
Kai Kai Nature Trail: A Resource Guide for
Aboriginal Studies’. Aboriginal Studies R-12.
Education Department of South Australia: Adelaide.
Ely, B. 1980. ‘Murray/Murundi’. Experimental Art
Foundation: Adelaide.
Evans, D. 1991. ‘The Coorong — a Multi-species
Fishery. Part 2 — Fishing Methods, Technology and
Personal Experiences 1930-1966, and Gear Statistics
1972-1989’. Fisheries Research Paper Number 22.
Department of Fisheries: Adelaide.
Eyre, EJ. 1845. ‘Journals of Expeditions of Discovery’.
2 vols. Boone: London.
Fenner, CAE. 1931. ‘South Australia: a Geographical
Study’. Whitcombe & Tombs: Melbourne.
Fisher, RH. 1983. Butterflies. Jn MJ Tyler, CR Twidale,
JK Ling & JW Holmes (eds) ‘Natural History of the
South East’, pp. 215-22. Royal Society of South
Australia: Adelaide.
Foster, RKG, Miihlhiusler, P & Clarke, PA. 1998.
‘Give me back my name’: the ‘classification’ of
Aboriginal people in colonial South Australia. Jn P
Miihlhausler (ed) ‘Papers in Pidgin and Creole
Linguistics’, pp. 35-59. Pacific Linguistics, No.5.
Foster, RKG, Monaghan, P & Miihlhausler, P. 2003.
‘Dictionary of 19th Century South Australian Pidgin
English’. Pacific Linguistics Monograph. Australian
National University: Canberra.
Gale, F. 1969. A changing Aboriginal population. Jn F
Gale & GH Lawton ‘Settlement and Encounter:
Geographical Studies Presented to Sir Grenfell
Price’, pp. 65-88. Oxford University Press:
Melbourne.
Glover, CJM. 1983. Freshwater and marine fishes. Jn
MJ Tyler, CR Twidale, JK Ling & JW Holmes (eds)
‘Natural History of the South East’, pp. 157-167.
Royal Society of South Australia: Adelaide.
Grace, J. 1990. Murray River Woman. /n A Pring (ed)
‘Women of the Centre’, pp. 157-172. Pascoe
Publishing: Sydney.
Griffin, T & McCaskill, M. (eds) 1986. ‘Atlas of South
Australia’. South Australian Government Printer:
Adelaide.
Gross, GF. 1983. Myriapods, insects and allied forms.
In MJ Tyler, CR Twidale, JK Ling & JW Holmes
(eds) ‘Natural History of the South East’, pp. 205—
213. Royal Society of South Australia: Adelaide.
Hemming, SJ. 1989. Aboriginal coiled basketry in
South Australia. Journal of the Anthropological
Society of South Australia 27(5): 48-50.
Hemming, SJ. 1991. Lower Murray shields: an
historical perspective. Records of the South
Australian Museum 24(2): 125-138.
Hemming, SJ. 1993. Camp Coorong — combining race
relations and cultural education. Social Alternatives
12(1): 37-40.
Hemming, SJ. (ed) 1994. ‘Troddin Thru Raukkan. Our
Home. Raukkan Re-Union 1994. Oral Histories by
Lindsay Wilson, Marjory Koolmatrie, Margaret
Jacobs, Bruce Carter and Marlene Stewart’. Raukkan
Council & South Australian Museum: Adelaide.
Hemming, SJ & Clarke, PA. 1991. ‘Aboriginal People
of South Australia’, Second edition. ATSIC:
Canberra.
Hemming, SJ & Jones, PG with Clarke, PA. 1989.
‘Ngurunderi: an Aboriginal Dreaming’. South
Australian Museum: Adelaide.
Holmes, JW & Waterhouse, JD. 1983. Hydrology. Jn
MJ Tyler, CR Twidale, JK Ling & JW Holmes (eds)
‘Natural History of the South East’, pp. 49-59. Royal
Society of South Australia, Adelaide.
Inglis, J. 1961. Aborigines in Adelaide. Polynesian
Society 70(2): 200-218.
Jenkin, G. 1979. ‘Conquest of the Ngarrindjeri: the
Story of the Lower Lakes Tribes’. Rigby: Adelaide.
Jessop, JP & Toelken, HR. (eds). 1986. ‘Flora of South
Australia’. Pts 1-4. South Australian Government
Printer: Adelaide.
Kean, J, Richardson, G & Trueman, N. (eds). 1988.
‘Aboriginal Role in Nature Conservation. Emu
Conference, June 7th-9th 1988’. South Australian
National Parks & Wildlife Service, & Department of
Aboriginal Affairs: Adelaide.
Linn, R. 1988. ‘A Diverse Land: a History of the Lower
Murray, Lakes and Coorong’. Meningie Historical
Society: Meningie.
Luebbers, R. 1978. ‘Meals and Menus: a Study of
Change in Prehistoric Coastal Settlements in South
Australia’. PhD thesis. Australian National
University: Canberra.
106
Luebbers, R. 1981. The Coorong Report. An
Archaeological Survey of the Southern
Younghusband Peninsula 1981’. Department of
Environment & Planning: Adelaide.
Luebbers, R. 1982. Coorong Archaeological Project.
Journal of the Anthropological Society of South
Australia 20(4): 5-6.
McCorquodale, J. 1987. ‘Aborigines and the Law: a
Digest’. Aboriginal Studies Press: Canberra.
McCourt, T. & Mincham, H. 1987. ‘The Coorong and
Lakes of the Lower Murray’. National Trust:
Beachport.
Matthews, EG. 1976. ‘Insect Ecology’. University of
Queensland Press: St Lucia.
Mattingley, C & Hampton, K. (eds) 1988. ‘Survival in
Our Own Land: Aboriginal Experiences in South
Australia Since 1836, Told by Nungas and Others’.
Wakefield Press: Adelaide.
Meehan, B. 1982. ‘Shell Bed to Shell Midden’.
Australian Institute of Aboriginal Studies: Canberra.
Meyer, HAE. 1843. ‘Vocabulary of the Language
Spoken by the Aborigines of South Australia.’ Allen:
Adelaide.
Morton, J. 1990. Rednecks, ’roos and racism: kangaroo
shooting and the Australian way. Social Analysis 27:
30-49.
Mulvaney, DJ. 1991. Introduction. Jn DJ Mulvaney (ed)
‘The Humanities and the Australian Environment’,
pp. 1-4. Occasional Paper no. 1. Papers from the
Australian Academy of the Humanities Symposium
1990. Australian Academy of the Humanities:
Canberra.
Olsen, AM. 1991. ‘The Coorong — a Multi-species
Fishery. Part 1 — History and Development’.
Fisheries Research Paper Number 22. Department of
Fisheries: Adelaide.
Padman, EL. 1987. ‘The Story of Narrung: the Place of
Large She-oaks’. Lutheran Publishing House:
Adelaide.
Parker, SA & Reid, NCH. 1983. Birds. Jn MJ Tyler, CR
Twidale, JK Ling & JW Holmes (eds) ‘Natural
History of the South East’, pp. 135-150. Royal
Society of South Australia: Adelaide.
_ Parliament of the Commonwealth of Australia. 1998.
‘Commercial Utilisation of Australian Native
Wildlife. Report of the Senate Rural and Regional
Affairs and Transport References Committee’.
Parliament House: Canberra.
Peterson, N. & Rigsby, B. (eds) 1998. ‘Customary
Marine Tenure in Australia’. Oceania Monograph
No. 48. University of Sydney: Sydney.
Pretty, GL, Paton, RC & Weathersbee, RDJ. 1983.
Tribal Man. Jn MJ Tyler, CR Twidale, JK Ling &
JW Holmes (eds) ‘Natural History of the South East’,
pp. 115-126. Royal Society of South Australia:
Adelaide.
PA CLARKE
Ramson, WS. 1966. ‘Australian English. An Historical
Study of the Vocabulary 1788-1898’. Australian
National University Press: Canberra.
Reschke, W. 1985. A personal view of the river. Jn PS
Davis & PJ Moore (eds) 1985. ‘Who Owns the
Murray? A South Australian Perspective’, pp. 173-
178. River Publications: Adelaide.
Resource Assessment Commission. 1993. ‘Coastal Zone
Inquiry. Final Report?’ Commonwealth of Australia:
Canberra.
Rix, CE. 1978. ‘Royal Zoological Society of South
Australia 1878-1978’. Royal Zoological Society of
South Australia: Adelaide.
Robinson, AC & Young, MC. 1983. ‘The Toolache
Wallaby (Macropus greyii Waterhouse)’. National
Parks & Wildlife Service: Adelaide. Also described
as Department of Environment & Planning, South
Australia. Special Publication 2: 1-54.
Rolls, E. 1984. ‘They All Ran Wild: the Animals and
Plants that Plague Australia’. Angus & Robertson:
Sydney.
Sackett, L. 1979. The pursuit of prominence: hunting in
an Australian Aboriginal community.
Anthropologica 21(2): 223-246.
Sim, T, Potts, L, Hammer, M & Doube, J. 2000. Fishes.
In Strathalbyn Naturalists Club ‘Natural History of
Strathalbyn and Goolwa Districts’, pp. 97-107.
Strathalbyn Naturalists Club: Strathalbyn.
Smith, LR. 1980. ‘The Aboriginal Population of
Australia’. Aborigines in Australia Society, no. 14.
Academy of the Social Sciences. Australian National
University Press: Canberra.
Smith, W. Ramsay 1930. ‘Myths and Legends of the
Australian Aboriginals’. Harrap: Sydney.
Smyth, D. 1993. ‘A Voice in all Places. Aboriginal and
Torres Strait Islander Interests in Australia’s Coastal
Zone’. Revised edition. Resource Assessment
Commission: Canberra.
Strahan, R. (ed). 1983. ‘The Complete Book of
Australian Mammals’. Angus & Robertson: Sydney.
Sutton, P. (ed.) 1988. ‘Dreamings: the Art of Aboriginal
Australia’. Penguin Books: Melbourne.
Sutton, P, Jones, PG & Hemming, SJ. 1988. Survival,
regeneration and Impact. Jn P Sutton (ed) 1988b.
‘Dreamings: the Art of Aboriginal Australia’, pp.
180-212. Penguin Books: Melbourne.
Taplin, G. 1859-79. Journals. Mortlock Library:
Adelaide.
Taplin, G. 1874 [1879]. The Narrinyeri. In J.D. Woods
(ed) ‘The Native Tribes of South Australia’, pp. 1-
156. E.S. Wiggs: Adelaide.
Taplin, G. 1879. ‘Folklore, Manners, Customs and
Languages of the South Australian Aborigines’.
South Australian Government Printer: Adelaide.
Thompson, MB & Tyler, MJ. 1983. Reptiles and
TWENTIETH-CENTURY ABORIGINAL HARVESTING PRACTICES 107
amphibians. Jn MJ Tyler, CR Twidale, JK Ling &
JW Holmes (eds) ‘Natural History of the South East’,
pp. 151-156. Royal Society of South Australia:
Adelaide.
Tindale, NB. 1930-52. ‘Murray River Notes’.
Anthropology Archives: South Australian Museum.
Tindale, NB. 1986. Milerum entry. Jn B Nairn & G
Serle (eds) ‘Dictionary of Biography. Volume 10:
1891-1939. Lat-Ner’, pp. 498-499. Melbourne
University Press: Melbourne.
Tonkinson, R. 1993. Foreword. Jn RM Berndt & CH
Berndt, ‘A World That Was. The Yaraldi of the
Murray River and the Lakes, South Australia’, pp.
xvii-xxxi. Melbourne University Press at the
Miegunyah Press: Melbourne.
Turner, GW. 1972. ‘The English Language in Australia
and New Zealand’. Second edition. Longmans:
London.
Tyler, MJ, Twidale, CR, Ling, JK & Holmes, JW. (eds)
1983. ‘Natural History of the South East’. Royal
Society of South Australia: Adelaide.
Walker, KF. 1985. The conservationist — a need for
more conservation reserves. Jn PS Davis & PJ Moore
(eds) 1985. ‘Who Owns the Murray? A South
Australian Perspective’, pp. 81-90. River
Publications, Adelaide.
Warneke, G. 2000. Crustaceans. Jn Strathalbyn
Naturalists Club ‘Natural History of Strathalbyn and
Goolwa Districts’, pp. 225-227. Strathalbyn
Naturalists Club, Strathalbyn.
White, SA. 1913. ‘The Gawler Ranges. An
Ornithological Expedition’. W.K. Thomas & Co.:
Adelaide.
Whitelock, D. 1985. ‘Conquest to Conservation. History
of Human Impact on the South Australian
Environment’. Wakefield Press: Adelaide.
Williams, M. 1974. ‘The Making of the South
Australian Landscape: a Study in the Historical
Geography of Australia’. Academic Press: London.
Wilson, D. 1998. ‘The Cost of Crossing Bridges’. Small
Poppies Publishing: Melbourne.
Wilson, G, McNee, A & Platts, P. 1992. ‘Wild Animal
Resources: Their Use by Aboriginal Communities’.
Bureau of Rural Resources. Australian Government
Publishing Service: Canberra.
Young, E. 1983. ‘The Aboriginal Component in the
Australian Economy. Tribal Communities in Rural
Areas’. Development Studies Centre, The Australian
National University: Canberra.
Young, E, Ross, H, Johnson, J & Kesteven, J. (eds).
1991. ‘Caring for Country. Aborigines and Land
Management’. Australian National Parks and
Wildlife Service: Canberra.
Zeidler, W. 1983. Freshwater and some terrestrial
invertebrates. In MJ Tyler, CR Twidale, JK Ling &
JW Holmes (eds) ‘Natural History of the South East’,
pp. 187-204. Royal Society of South Australia:
Adelaide.
INECOIRIDS
OJF
TB0E
SOUTH
AUSTRALIAN
MUSEUM
VOLUME 36 PART 1
DECEMBER 2003
ISSN 0376-2750
CONTENTS:
ARTICLES
] E MAKOVICKY
Ornamental diamond patterns in Aboriginal bark paintings from N.E. Arnhem Land,
Australia.
P| U MUHLENHARDT-SIEGEL
Shallow-water cumacean Crustacea from Australia and Lombok (Indonesia): families
Bodotriidae and Leuconidae.
ae) LR SMALES
An annotated checklist of the Australian Acanthocephala from mammalian and bird
hosts.
83 PA CLARKE
Twentieth-century Aboriginal harvesting practices in the rural landscape of the Lower
Murray, South Australia.
Published by the South Australian Museum,
North Terrace, Adelaide, South Australia 5000.
IN O@@INIDS
©)
AUSTRALIAN
MUSEUM
VOLUME 36 PART 2
DECEMBER 2003
A NEW GENUS OF WATER BEETLE GENTILINA GEN. NOV. FROM
AUSTRALIA (COLEOPTERA : HYDROPHILIDAE)
FRANZ HEBAUER
Summary
Gentilina gen. nov. is described and illustrated from Queensland. It comprises one species
previously described by Gentili (1993) as Paranacaena nitens after a female. The new genus belongs
to the subfamily Hydrophilinae, tribe Laccobiini, and comes close to Hydrophilomima Hansen &
Schédl, 1997 in its external appearance. The aedagophore of a recent specimen is figured and a
revised key to the genera of Laccobiini is given.
A NEW GENUS OF WATER BEETLE GENTILINA GEN. NOV.
FROM AUSTRALIA (COLEOPTERA: HYDROPHILIDAE)
FRANZ HEBAUER
HEBAUER, F. 2003. A new genus of water beetle Gentilina gen. nov. from Australia
(Coleoptera: Hydrophilidae). Records of the South Australian Museum 36(2): 109-114.
Gentilina gen. nov. is described and illustrated from Queensland. It comprises one species
previously described by Gentili (1993) as Paranacaena nitens after a female. The new genus
belongs to the subfamily Hydrophilinae, tribe Laccobiini, and comes close to Hydrophilomima
Hansen & Schédl, 1997 in its external appearance. The aedeagophore of a recent specimen is
figured and a revised key to the genera of Laccobiini is given.
F. Hebauer, Ulrichsberg 7, D-94539 Grafling, Germany. Revised manuscript received
30 November 2001.
It is not at all surprising to continue to discover
new genera of insects from Australia. Many areas
of this continent are still undercollected for water
beetles. In particular, the Northern Territory was
found to support new species of Hydrophiloidea
such as Spercheus wattsi (Hebauer 1999),
Helochares spp. (Hebauer & Hendrich 1999),
some Berosus spp. (Watts 1987) and Hydrochus
spp. (Watts 1999), as well as Anacaenini and
Laccobiini (Gentili 1980, 2000) and a large
number of new genera and species of
Sphaeridiinae (Hansen 1990). At present there are
45 genera and over 200 species of Hydrophiloidea
described from Australia (or 55 genera and over
250 species from the Australian region).
The Hydrophilidae tribe Laccobiini is poorly
represented in Australia, until now with the sole
genus Laccobius. A second genus of this tribe is
described in this paper represented by a single
species, found at two localities (North Queensland
near the Cape Tribulation National Park; and
Buderim Mountain). New material is deposited with
the following institutions and individuals: Australian
National Insect Collection, CSIRO, Canberra
(ANIC); Collection of Elio Gentili, Rasa-Varese,
Coll. Lars Hendrich, Berlin (CHB); Collection of
Franz Hebauer, Grafling, Germany (CHG); Museo
di Storia Naturale, Verona (MSNV);
Naturhistorisches Museum Wien, (NMW); and the
South Australian Museum, Adelaide (SAMA).
Gentilina gen. nov.
(Figs 14)
Type species
Paranacaena nitens Gentili, 1993, fixed by
designation here. The gender is female.
Diagnosis
Body elongate, widest behind pronotal—elytral
junction, contour not interrupted between
pronotum and elytra, evenly attenuated
posteriorly, weakly convex (Fig. 1). Dorsal face
FIGURE 1. Gentilina nitens (Gentili), (ANIC), body
shape.
110
FIGURE 2. Gentilina nitens (Gentili), (ANIC),
maxillary palp.
glabrous. Clypeus not demarcated from frons by a
suture, forming a shelf above antennal base,
reaching almost to outer edge of eyes; anterior
margin convex, anterior corners rounded. Eyes
rather large, separated by about 3x the width of
one eye, very slightly protruding from outline of
head; anterior margin hardly emarginate. Head
slightly narrowed behind eyes. Maxillary palpi
half as long as width of head; second segment
swollen, apical portion thicker than basal portion;
third segment much shorter than second; fourth
segment almost twice as long as _ third,
asymmetrical with inner face straightened (Fig. 2).
Mentum rectangular, about 1.5x as wide as long,
slightly concave, anterior margin almost straight.
Labial palpi about as long as width of mentum,
slender, cylindrical; second segment without
subapical wreath of setae; third segment about as
long as second, almost symmetrical. Gula well
developed, almost parallel-sided. Antennae 9-
segmented, half as long as width of head; first
segment of moderate length; second about half as
long as first; third to fifth segments very small,
subequal; cupule rather small, well differentiated;
segments 7 to 9 forming a somewhat compact,
pubescent club, which is 3.5x as long as wide
(Fig. 3). Pronotum widest at base, sides weakly
rounded and strongly narrowed anteriorly; surface
evenly convex, without transverse series of
punctures at hind margin, but with distinct coarser
setiferous punctures forming a short oblique
transverse group on each side. Prosternum short,
without antennal grooves, not conspicuously
elevated medially and without a longitudinal
F HEBAUER
carina; middle portion defined from lateral
portions by a pair of very fine oblique ridges;
without spines. Mesosternum not fused to
metepisterna, only reaching anterior mesothoracic
margin at a single point; middle portion rather
flat, without a lamina or projection. Metasternum
with weakly raised middle portion, not projecting
anteriorly between mesocoxae; with hydrofuge
pubescence except for a narrow glabrous area on
raised drop-shaped middle portion; without
femoral lines. Metepisterna parallel-sided, about
6x as long as wide. Abdomen with 5 visible
sternites; first and second of about same length,
not longitudinally carinate; posterior margin of
fifth ventrite subtruncate as in Laccobius, not
emarginate medially; all ventrites covered with
fine pubescence. Epipleura and pseudepipleura
well defined from each other, oblique. Elytra
slightly convex, evenly attenuated from shoulder
to rounded apex, without punctural series, but
with sharply impressed sutural stria in posterior
two-thirds; rows of coarser systematic punctures
hardly traceable. Scutellum of moderate size,
triangular, about as long as wide. Coxae with
sparse pubescence; anterior and posterior coxae
almost contiguous; middle coxae narrowly
separated; all trochanters with dense pubescence.
Femora slightly flattened, with sharply defined
tibial grooves on inner face. Anterior and middle
femora covered with dense pubescence except
apical portion; hind femora pubescent on basal
half and along anterior margin. Middle and hind
FIGURE 3. Gentilina nitens (Gentili), (ANIC), antenna.
NEW GENUS OF WATER BEETLE GENTILINA GEN. NOV.
111
FIGURE 4. Gentilina nitens (Gentili), (ANIC), hind wing.
femora completely contacting the trochanter
basally. Tibiae slender, cylindrical and straight,
with moderately long and moderately strong
spines on inner face. Tarsi 5-segmented, long and
slender, together surpassing length of tibiae;
posterior tibiae with a fringe of long and fine
swimming-hairs on outer face. The first segment
of middle and hind tarsi short; second segment
very long; claws rather small, slightly and evenly
curved; without sexual dimorphism. Hind wing
almost twice as long as elytra; radial cross vein r4
rising from about middle of radial cell (pigmented
area at anterior wing margin); medial (cubital)
spur rising from apex of medial loop, reaching a
little less than halfway towards posterior wing
margin; media distinct and united with cubitus to
form a M-Cu loop; wedge cell much smaller than
basal cell; anal lobe well developed, demarcated
from remainder wing by a sharp excision at
posterior wing margin (Fig. 4).
Etymology
The generic name refers to my dear friend Dr.
Elio Gentili, specialist in the genus Laccobius and
discoverer of the type species.
Discussion
This new genus has the following diagnostic
features of Laccobiini (Oocyclini), as given by
Hansen (1991):
- the presence of systematic punctures on head,
pronotum and elytra (sometimes not detectable
on all three parts; if completely absent then
the pseudepipleuron is at least as wide as the
true epipleuron anteriorly or is sharply defined
from it by a fine ridge
- the apical segment of maxillary palpi longer
than the penultimate.
Anacaenini genera of similar size and colour
differ from Gentilina in the following characters:
- Paracymus has the midprosternum sharply
carinate and the maxillary palpi shorter than
half as long as the width of the head.
- Anacaena has no traces of systematic
punctures on head, pronotum or elytra; the
pseudepipleuron is narrow throughout, much
narrower than the true epipleuron anteriorly.
- Paranacaena has, in addition, detectable rows
of serial punctures on the elytra.
Gentilina comes close to Hydrophilomima
Hansen & Schédl and, apart from Scoliopsis
Orchymont and Tritonus Mulsant, it is the only
genus of Laccobiini with 9-segmented antennae.
Besides Pseudopelthydrus Jia, it is the only genus
of the tribe with the middle and hind femora
extensively pubescent. The present known species
ranks with the smallest members of the tribe.
Gentilina differs from the genus Laccobius
mainly in the 5-segmented abdomen, the 9-
segmented antennae and the pubescent femora.
From Pelthydrus it is distinguished by the 9-
segmented antennae, the presence of a sutural
Stria, and the pubescent femora. From
Pseudopelthydrus, which also has pubescent
femora, Gentilina is separated by the 9-segmented
antennae and the non-keeled first ventrite. In
contrast to Gentilina, Arabhydrus Hebauer has 8-
segmented antennae, its maxillary palpi are
distinctly longer (two-thirds as long as width of
head) and the second segment is not thickened
apically. From the similarly shaped
Hydrophilomima, the new genus can be
distinguished by the middle portion of the
mesosternum lacking an elevated portion, the 9-
segmented antennae, the swollen second segment
of the maxillary palpi being not more than half as
112
long as the width of the head (about two-thirds in
Hydrophilomima), the first ventrite being
unkeeled, and the extensively pubescent femora
(entirely glabrous in Hydrophilomima). The
genera Tritonus Mulsant, Scoliopsis Orchymont,
Oocyclus Sharp and Beralitra Orchymont are
much larger in size and less easily confused with
the above genera because of their striking
characters, for example spines, explanate elytra,
reniform eyes, acutely pointed hind angles of
pronotum.
Gentilina nitens (GENTILI, 1993)
(Fig. 5)
Type material
Holotype (female): Australia: Queensland,
Buderim Mtn., Mooloolah, C. J. W. Dec-89
[=1889! C. J. W. = not Watts! The locality is just
north of Brisbane] (SAMA).
Paratypes: 4 females as for holotype (SAMA,
MSNV).
Additional material: 97 examples: Australia.
North-Queensland/Cape Tribulation, Daintree
National Park, Turpentine Road, 120 m,
8.xii.1996, Hendrich leg./Loc. 18. (ANIC, CHB,
CHG, NMW, SAMA).
Because there is now available a large number
of new specimens, including males, a
redescription of the species is given here.
Redescription
Length: 1.8-2.0 mm; width: 0.9-1.0 mm.
Elongate oval, widest behind shoulders,
attenuated behind, moderately convex, black with
sides and angles of pronotum widely pale. Head
entirely black; clypeus weakly punctate and
shagreened, frons rather coarsely and densely
irregularly punctate. Maxillary palpi rather long,
reaching back to posterior margin of eyes; second
segment distinctly dilated on anterior portion,
ultimate segment much longer than third,
asymmetrical, darkened apically. Antennae 9-
segmented. Pronotum widest at base, narrowed
anteriorly, shining black with sides and angles
broadly yellow; rather coarsely and irregularly
punctate; punctured interstices shining. Elytra
entirely black, shining, about 1.2x as long as their
combined width; coarsely and densely punctate,
subseriate; sutural stria sharply impressed in more
than posterior half. Irregular rows of coarser
punctures hardly traceable. Epipleura oblique.
Legs testaceo-brunneous; femora basally
darkened; tarsi long and slender, middle and hind
tarsi longer than tibiae; with long and fine
F HEBAUER
swimming-hairs. Underside piceous; abdomen 5-
segmented, entirely pubescent, first ventrite not
carinate medially, fifth segment subtruncate,
without apical excision. Mentum rectangular,
slightly concave, rugosely reticulated. Prosternum
without median carina and without apical notch.
Mesosternum only bluntly bulging medially,
without a distinct elevation or projection. Anterior
and middle femora pubescent except apical
portion; posterior femora pubescent in basal half
and anterior margin. Aedeagophore with basal
piece rather narrow and slender; median lobe
filiform, a little shorter than parameres, bifurcate
basally. Parameres broad, strongly convex on
outer face and straight on inner face, apices
pointed (Fig. 5).
FIGURE 5.
aedeagophore.
Gentilina nitens (Gentili), (CHG),
NEW GENUS OF WATER BEETLE GENTILINA GEN. NOV. 113
Distribution
Known only from Queensland. Lars Hendrich
(pers. comm.) collected numerous specimens in a
small waterfilled rockhole (20 sq cm) in front of a
waterfall. The puddle was enriched with some
plant debris. The beetles have the habit of flying
away immediately when taken out of the water (as
in Agraphydrus and many Laccobius). The small,
permanent and almost shaded stream is situated in
primary lowland rainforest on private property
near the Cape Tribulation National Park.
REVISED KEY To THE GENERA OF THE TRIBE
LACCOBIINI
1 — Maxillary palpi at least two-thirds as long
as width of head. Mesosternum broadly
reaching anterior mesothoracic margin.
First ventrite with median carina, at least
basally. emacs Fa he aa eeeseesenss 2
— Maxillary palpi less than half as long as
width of head. Mesosternum only reaching
anterior mesothoracic margin at a single
point. First ventrite without a keel......... 5
2 — Anterior and middle femora densely
pubescent except at apex, posterior femora
pubescentin basal half and/or along anterior
and posterior margin. Prosternum almost
flat, without median carina—southern
China .......... Pseudopelthydrus Jia, 1998
— All femora glabrous or pubescent in less
than basal half. Prosternum more or less
tectiform, with median carina at least
anteriorly jyt6Alschindesass tech aneraanils 3
3 — Abdomen with 6 distinct ventrites.
Mesosternum only bluntly bulging
posteromedially—Arabian Peninsula
(Oman)......... Arabhydrus Hebauer, 1997
— Abdomen with 5 distinct ventrites.
Mesosternum abruptly raised
posteromedially, forming a strongly
margined, elevated portion ................ 4
4 — Metasternum with narrow, somewhat
flattened, glabrous median ridge which is
connected with median ridge of mesosternal
elevation to form a continuous sternal keel.
Femora with well-developed tibial grooves
on inner face—Oriental region ...............
Hydrophilomima Hansen & Schédl, 1997
— Metasternum simply convex, often more
shiny in middle portion, but without median
ridge, anteriorly well demarcated from
mesosternum. Femora without well-defined
9
tibial grooves on inner face—Oriental and
eastern Palaearctic regions ...........::ceceeee
vibe dyin thes Pelthydrus Orchymont, 1919
Abdomen with 6 distinct ventrites.
Trochanters of posterior legs very large,
not completely abutting femora, but with
bluntly projecting apices. Posterior tibiae
usually curved—worldwide (except South
America) ....... Laccobius Erichson, 1837
Abdomen with 5 distinct ventrites.
Trochanters of posterior legs of moderate
size, not freely projecting apically. Posterior
tiblae-straighit=, 1 nce DB ehiasdiet ihe 6
Elytra with distinct sutural stria in about
posterior half. Antennae 9-segmented .. 7
Elytra without distinct sutural stria, but
sometimes with the sutures a little elevated
posteriorly. Ventrites uniformly pubescent
and punctate. Antennae 8-segmented ... 9
Second to fifth ventrites with large well-
defined, glabrous and almost impunctate
areas Medially oo... eeeeeseesesseseeeeees 8
All ventrites pubescent—Australia .........
fewrinshaviaparyvanienpreetatt Gentilina gen. nov.
Posterior corners of pronotum angulate,
not produced into a long acute spine. Pro-
and mesosternum without spines. Eyes
hardly oblique in dorsal view—Mauritius
meats devas cactoasspeasagal Tritonus Mulsant, 1844
Posterior corners of pronotum produced
into a long acute spine. Pro- and
mesosternum with some strong spines
medially. Eyes obliquely shaped in dorsal
View—Sri Lanka «00... eececeeseeeeeeeeseeees
Elytra a little explanate towards margin,
the suture distinctly raised posteriorly. Body
weakly convex—South America ............
deetdacisbesltetiee Beralitra Orchymont, 1919
Elytra not explanate towards margin, the
suture not raised. Body often more
convex—Oriental and Neotropical regions
Pr revert eevee Oocyclus Sharp, 1882
ACKNOWLEDGMENTS
My sincere thanks to Dr Chris Watts for his very
important suggestions regarding the new genus, and to
the Diplom-Biologist Lars Hendrich from the Freie
Universitat, Berlin for donating specimens. Special
thanks are due to Prof. Garth N. Foster, Scotland for
critically reading the manuscript.
114
F HEBAUER
REFERENCES
Erichson, WF. 1837 (1837-1839). Die Kafer der Mark
Brandenburg. Vol. I. viii + 740 pp. (only pp. 1-384
issued in 1837). F. H. Morin: Berlin.
Gentili, E. 1980. The genera Laccobius and Nothydrus
(Coleoptera, Hydrophilidae) in Australia and New
Zealand. Records of the South Australian Museum
18(7): 143-154.
Gentili, E. 1993. Paranacaena Blackburn, 1889: a valid
genus (Coleoptera, Hydrophilidae). Results of the
German hydroentomological mission No. 4 [in part].
Giornale italiano di Entomologia 6: 285-296.
Gentili, E. 2000. The Paracymus of Australia
(Coleoptera, Hydrophilidae). Records of the South
Australian Museum 33(2): 101-122.
Hansen, M. 1990. Australian Sphaeridiinae (Coleoptera:
Hydrophilidae): A taxonomic outline with
descriptions of new genera and species. Invertebrate
Taxonomy 4: 317-395.
Hansen, M. 1991. The Hydrophiloid beetles. Phylogeny,
classification and a revision of the genera
(Coleoptera, Hydrophiloidea). Biologiske Skrifter.
Det Kongelige Danske Videnskaberners Selskab 40:
1-367.
Hansen, M & Schédl S. 1997: Description of
Hydrophilomima gen. n. from Southeast Asia
(Coleoptera: Hydrophilidae). Koleopterologische
Rundschau, 67: 187-194.
Hebauer, F. 1997. Annotated checklist of the
Hydrophilidae and Helophoridae (Insecta:
Coleoptera) of the Arabian Peninsula with a
description of a new genus and species. Fauna of
Saudi Arabia 16: 255-275.
Hebauer, F & Hendrich, L. 1999: Two new species of
Helochares from Northern Australia (Coleoptera:
Hydrophilidae). Entomological Problems 30(1): 47-
51.
Hebauer, F. 1999. Spercheus wattsi sp. n. — a second
Australian species of the genus (Coleoptera,
Hydrophiloidea). Acta Coleopterologica 15(2): 5-6.
Jia, F. 1998. A new genus Pseudopelthydrus gen. n.
from Hainan Island, China (Coleoptera:
Hydrophilidae: Hydrophilinae). Chinese Journal of
Entomology 18: 225-230.
Mulsant, E. 1844. Description de quelques Palpicornes
inédits. Annales de la Société d‘Agriculture de Lyon
7: 372-382.
Orchymont, A d’. 1919. Contribution a 1“étude des sous-
familles des Sphaeridiinae et des Hydrophilinae (Col.
Hydrophilidae). Annales de la Société
Entomologique de France 88: 105-168.
Sharp, D. 1882. Insecta. Coleoptera. Vol. I, part 2
(Haliplidae, Dytiscidae, Gyrinidae, Hydrophilidae,
Heteroceridae, Parnidae, Georissidae, Cyathoceridae,
Staphylinidae). Jn FD Godman & O Salvin ‘Biologia
Centrali-Americana (16)’. xv + 824 pp. Taylor and
Francis: London (only pp. 1-144 issued in 1882).
Watts, CHS. 1987. Revision of Australian Berosus
Leach (Coleoptera: Hydrophilidae). Records of the
South Australian Museum 21(1): 1-28.
Watts, CHS. 1999. Revision of Australian Hydrochus
(Coleoptera: Hydrochidae). Records of the South
Australian Museum 32(1): 143.
REPAINT THE DRUM
B. CRAIG
Summary
A large slit-drum from Ambrym in Vanuatu was presented to the South Australian Museum in June
1996. This drum became the catalyst for a review of the museum’s collections originating in New
Hebrides (Vanuatu) and for an Adelaide Arts Festival event in March 1998. In order to organise the
Festival event, the author went to Vanuatu for three weeks, also visiting several locations in central
Vanuatu to document items in the museum’s collections and to purchase contemporary objects for
an exhibition, Spirits of Vanuatu.
REPAINT THE DRUM
B CRAIG
CRAIG, B. 2003. Repaint the drum. Records of the South Australian Museum 36(2): 115-133.
A large slit-drum from Ambrym in Vanuatu was presented to the South Australian Museum
in June 1996. This drum became the catalyst for a review of the museum’s collections
originating in New Hebrides (Vanuatu) and for an Adelaide Arts Festival event in March 1998.
In order to organise the Festival event, the author went to Vanuatu for three weeks, also
visiting several locations in central Vanuatu to document items in the museum’s collections
and to purchase contemporary objects for an exhibition, Spirits of Vanuatu.
B Craig, Curator of Foreign Ethnology, South Australian Museum, North Terrace, Adelaide,
South Australia 5000. Manuscript received 2 December 2002.
THE PROJECT
In June 1996 Mrs Claire Murray of Adelaide
donated to the South Australian Museum a
2.8 metre high slit-drum (A.74765, Fig. 1) from
Vanuatu in memory of her late husband and his
deep interest in the music of the Pacific Islands.
Claire and Bryan Murray had bought the drum
from a shop in Port Vila in 1974. The drum had
lost its colours and the Murrays were unable to
determine its exact origin and who had carved it.
The receipt of this drum became a catalyst for
research on the extensive collections from
Vanuatu! held by the South Australian Museum.
By comparing the style of the carving on the drum
with published information (Bonnemaison et al
1996, Fig. 333, second from left; Clausen 1960,
Figs 18-21; Speiser 1990, Plate 105, Nr 6), it
became clear that the drum was from the island of
Ambrym in central Vanuatu.
I read that the slit-drum is likened to the
voyaging canoe. The people of Vanuatu are
believed to have arrived in their present lands by
way of the outrigger canoe some 3200 years ago
(Spriggs 1997: 40). They have maintained contact
among their many islands since then using large
trading vessels.”
Clausen believes it was the dugout that
provided the model for the slit-drum. The same
kind of tree, and the same carving and hollowing
techniques, are used, and the forms are similar.
He wrote (1960: 19):
1
some residents.
. . . just as the canoes transport man over the
ocean and are thus the means by which the ocean
can be used, to the benefit of man, for purposes
of trade (mainly in boars, sows and small
piglets); so also, the slit-drums are like canoes
on the ocean of the spirit world, connecting
mankind with the otherwise unknown world of
the ancestral ghosts whose voices they represent
and who live on - literally feed on — the psychic
essence of the boars that are sacrificed to them.
Slit-drums thus constitute a psychic medium of
communication with the spirit world
corresponding to the trading voyages of the
canoes in external life.
The French ethnographer Joél Bonnemaison
(1994) suggests that the voyaging canoe and the
networks it creates are metaphorically central to
Melanesian concepts of space and time.
Among the northern and central islands of
Vanuatu a wide range of goods were traded
(Huffman in Bonnemaison et al. 1996: 182-185).
These included shell ornaments from the Banks
Islands; pottery from the west coast of Santo; red
dye from south Santo; green paint from Malekula;
woven mats, aprons, belts and baskets from
Malekula, Ambae, Maewo and Pentecost; and
everywhere pigs were an enthusiastically accepted
trade item. Canoes were obtained from northeast
Malekula, Lamen, north Ambrym and south
Pentecost, because not all the islands had trees
large enough to provide suitable hulls. Trade in
pigs, foodstuffs, bows and arrows, and shells also
took place between inland tribes and coastal
Called New Hebrides until, in 1980, independence was gained from the British-French Condominium, sardonically termed the ‘Pandemonium’ by
? For an illustration of one of these vessels, see Bonnemaison et al 1996, Fig. 214.
116 B CRAIG
FIGURE 1. Slit-drum (a-tin-tin) (A.74765);
commissioned by Taimal and carved from breadfruit
tree (pita) by Tin Mweleun (Golele), of Fanla village,
north Ambrym in 1968. Purchased at Port Vila in 1974
by Bryan and Claire Murray, Adelaide. Donated to the
South Australian Museum 8 June 1996 by Claire
Murray in memory of her late husband, Bryan.
Repainted and ritually named ‘Fanla’ by James Taimal
of Fanla and Billy Bong of Ranon, north Ambrym,
12 March 1998, Photo: Trevor Peters, SA Museum.
peoples on the larger islands, facilitated by
strategic intermarriage.
Not only objects and materials, but rituals, ritual
objects, masks, myths, songs and dances, were
traded through a system which respected copyright
and required appropriate payments to be made.
The more complicated economic transactions
involved notions of credit and loans and
compound interest. The basic item of value was
the pig, the most valuable being those bred with
curving tusks, particularly tusks in the form of a
double circle. The Swiss ethnographer Speiser
said (1990: 246), ‘the pig is the standard of value
and all other values are related to the pig’.
Thus, in Vanuatu the slit-drum links ritual with
canoes and trading voyages; and also masked
ceremonies and grade figures with the production
and exchange of trade goods (eg pigs and their
spiral tusks, shell valuables, and woven mats, pots
and pigments),
It occurred to me that the slit-drum donated by
Claire Murray could act as a catalyst for the
revival of the relationship between South
Australia and Vanuatu implicit in the collections
held by the Museum. Up until now, South
Australians (eg Reverend William Gray, a
Presbyterian missionary who served on Tanna,
1882-1895) had gone to Vanuatu and brought
back material embodiments of their encounters
with the people and cultures of that tropical
archipelago. Perhaps now we could invite a ni-
Vanuatu man to come to Adelaide to restore the
pigments on the drum and ritually install it in the
foyer of the Museum.
This would be in accordance with the
Museum’s current practice of having people from
cultures represented by its collections come to the
Museum and present aspects of their culture
directly to the public. It has happened many times
in relation to Aboriginal Australian cultures but
only once before in relation to Melanesian
cultures — when masked dancers came from New
Ireland and East New Britain for the Sth
International Pacific Arts Symposium hosted by
the South Australian Museum in April 1993
(Chance & Zepplin 1993; Craig 1993, 1994,
1995; Zepplin 1993).
I approached the Friends of the South
Australian Museum for a grant to fund the project
and this was successful. Enquiries through
Dr Darrell Tryon, a linguist at the Research
School of Pacific and Asian Studies at the
Australian National University in Canberra,
provided me with the understanding that the drum
could be refurbished and beaten only by a man of
REPAINT THE DRUM 117
the correct chiefly lineage. In due course I was
provided with the name of an Ambrym man
working for AustAid at Port Vila who was of the
correct lineage. Over the next few months I
attempted to arrange for him to come to Adelaide
to repaint the drum, but his work commitments
led to deferral of the project.
In the meantime, I had urged the Museum to
consider supporting exhibition projects consistent
with the theme of the 1998 Adelaide Festival of
Arts, which was ‘Sacred and Profane’. Around
the middle of 1997 I was asked if I could organise
the repainting of the Ambrym slit-drum as an
official Museum event for the Festival. I had
realised by then that the only way that such a
project could become a scheduled event would be
by going to Vanuatu to identify who could come
for that particular date, make all the
accommodation and travel arrangements, and find
out what needed to be provided to make it a
successful presentation of Vanuatu culture. I
proposed a modest budget to supplement the
funds committed by the Friends and this was
accepted.
THE OBJECTIVES
The opportunity to seek out the correct man or
men? for this work would enable me to do other
things as well. My fieldtrip proposal therefore had
four objectives:
* To establish a working relationship with the
Vanuatua Cultural Centre at Vila by providing
for its archives a set of photographs and a
computer print-out of around 580 of the South
Australian Museum’s Vanuatuan objects.‘
¢ To add to the documentation of the South
Australian Museum’s Vanuatuan collections
by using these photographs to obtain further
cultural information.
* To purchase, and document with notes,
photographs and audio tape recordings, and
contemporary ethnographic material in
Vanuatu to supplement the present collections
in the South Australian Museum, and to use
these objects in the redevelopment of the
Vanuatu exhibits in the Museum’s Pacific
Gallery.
¢ To identify, and arrange for, one or two ni-
Vanuatu men to travel to Adelaide for the
Adelaide Festival of Arts in March 1998 to
repaint the Vanuatu slit-drum and perform the
relevant rituals prior to its installation in the
main foyer of the South Australian Museum.
I also thought it might be possible to find out
more about this particular drum by showing a
photograph of it to Ambrym men. It happened
that in late October 1997 the volunteer
fieldworkers of the Vanuatu Cultural Centre
would be attending a workshop run by Darrell
Tryon and Ralph Regenvanu, the Director of the
Cultural Centre. For many years these workshops
have been held annually, each year having a
different theme.° The volunteer fieldworkers meet
for two weeks in Vila, bringing videotapes, audio
tapes, photographs and information on each year’s
particular theme gathered from the knowledgable
people in their areas. This information and
supporting materials are then archived for future
reference and research.
There would be men from Ambrym at the
workshop; I would be able to show them the
photograph of the drum for identification and they
would be able to suggest the appropriate persons
to come to Adelaide. The fieldworkers also would
be able to suggest an itinerary for two weeks of
travel through the islands of central Vanuatu for
the purpose of gathering information and
purchasing contemporary objects for the
Museum’s collection. Darrell Tryon assured me
that my facility in New Guinea Pidgin English
would enable me to be understood quite well;
Bislama, the Vanuatuan creole, is quite similar to
PNG Pidgin. As well, in many of the islands,
Vanuatuans have a serviceable ability in English.
In preparation for the trip, Scott Bradley was
contracted to photograph the entire collection
from Vanuatu. Maria Troiano was engaged as a
research assistant for a short time to bring together
all the documentation relating to the collections,
develop a working bibliography of the history and
ethnography of Vanuatu, and identify the main
collectors (Table 1). It was clear that a three-week
fieldtrip and a modest budget would not be
sufficient to visit all the places from which the
collections had come (see map, Fig. 2). I decided,
therefore, that I should visit:
Although the repainting could probably be done by one man, it is my experience that village-based Melanesians generally feel uncomfortable
travelling in foreign countries, or anywhere outside their own daily sphere of interaction, by themselves.
The actual total appears to be around 670 items.
See Sam, and Huffman, in Bonnemaison et al 1996: 288-293; Fig. 366 shows fieldworkers gathered for such a workshop in 1994.
118 B CRAIG
TABLE 1. Main South Australian Museum collections from Vanuatu.
Collector Year(s) Number of items
‘Old Collection’ Mostly late 19th century 159
Rev. W. Gray Collected 1882-1895 about 90
Bishop Cecil Wilson Early 20th century 66
J.H. Johnson (ex-Young Collection) Probably late 19th century 49
R.J. Etheridge Early 20th century 46
Rev. J. Palmer Late 19th century 35
G.L. Pretty 1971 25
Douglas Mawson 1903 at least 23
Stacey Collection Late 19th century 22
Dr R.J. Roach (ex-Theodore Thomas, an ‘early planter’) Probably late 19th century 18
A. Adamson Early 20th century 15
M.I. Savage Early 20th century 14
Australian Board of Missions (Rev. A.S. Webb collection) Probably early 20th century 11
Other sources Late 19th—20th centuries about 100
TOTAL at least 670
the tiny islands of Wala and Vao (Layard
1942) off the northeast coast of Malekula,
which were once thriving bases for canoe
trading voyages throughout central Vanuatu;
Wuss (nowadays called Wusi), a village on
the west coast of Santo from where Douglas
Mawson purchased three clay pots and other
objects in 1903 (Mawson 1957) and where the
skills persist to this day (Galipaud in
Bonnemaison et al 1996: 97-99);
* Lolowai on east Ambae, where there was an
industrious community of women mat-
weavers and basket makers (Bolton in
Bonnemaison et al 1996: 112-119);
« Ambrym, to see the village from which the
Museum’s slit-drum came and make
arrangements for the repainting event in
Adelaide.
THE JOURNEY
We® spent four days in Vila. I attended the
fieldworkers’ workshop and recorded information
about objects in the South Australian Museum’s
collections on the basis of the photographs I had
brought with me. I was informed that the slit-drum
had come from Fanla, a village on the north coast
of Ambrym, not far from Ranon. James Taimal
told me that his father, Chief Taimal, had
6
I was accompanied by my eight-year-old son, Sai, at my own expense.
commissioned the carving of the drum by Golele
in 1968. James and Billy Bong volunteered to
come to Adelaide to do the repainting of the
drum. This was agreed to by all concerned. So
that I could visit the place where the drum was
carved, I made arrangements for a launch to pick
me up at Craig Cove to take me to Ranon. Billy
and James would have returned to Ambrym by
that time. Arrangements also were concluded for
the visits to the other places on the itinerary.
Malekula
The first stop was northeast Malekula (Norsup)
then by road and launch to Wala Island. There I
saw a canoe with a carved prow attached,
featuring a bird (soliip) and flying-fish
(nuwawalades) motif (cf. Bonnemaison et al
1996, Fig. 51). Although I sought to purchase this,
the owner did not want to sell and I later bought a
newly-carved one (A.74721) from Malili Kami, a
Wala Island Guest House guide (Fig. 3). There
were no canoe prows in the collections of the
South Australian Museum so this was a
significant acquisition, particularly as Malili told
me that the soliip bird is featured on the prow
because it is this bird which navigators use as a
guide to land if they get lost out at sea.
The Museum also has two identical masks
(A.7430, A.7431, obtained from Reverend Gray,
1895) each topped with a model of a white bird
with long narrow wings, a long forked tail and a
REPAINT THE DRUM 119
Faget Banke Is.
ESPIRITU SANTO
MALEKULA
ee
EPI
y TONGOA
a
SMAKURA
9
ve
vias, Y EFATE
ERROMANGA|
ANIWA
‘
Weasisi
TANNA o
FUTUNA
FIGURE 2. Map of Vanuatu. SAMO2.03 kilometres ANEITYAM ()
FIGURE 3. Canoe prow (A.74721) featuring bird (soliip) and flying fish (nwwawalades). Purchased by B. Craig
from Malili Kami of Wala Island, northeast Malekula, 1997. Photo: B. Craig.
120 B CRAIG
FIGURE 4. Mask (A.7430) with tern (soliip) on top;
obtained from Rev. W. Gray 1895. Northeast Malekula.
Photo: B. Craig.
black mark on its head (Fig. 4). I asked about this
type of mask and was told it was from northeast
Malekula, it is called bang-lulu and the bird is
soliip, the same species as on the canoe prow. On
return to Adelaide, on the basis of the colour,
markings and other characteristics of the bird on
the masks, I identified it as most likely the
Roseate Tern (Sterna dougalli) (Bregulla 1992:
162-163; duPont 1976: 60, Plate 12, E). This
7
information is contrary to Kaufmann’s hypothesis
(in Bonnemaison et al 1996: 33) and Tilley’s
conviction (1999: 109-111) that the carved bird
on the canoe prow represents the frigate bird. I,
too, had suggested this to my informants but they
assured me that this was not so.
At the ‘Small Nambas kastom village’ on
Malekula just opposite Wala Island, the people
put on a two-hour spectacle of dances, explaining
the arrangement of the dance ground (namel).
There was a spirit guardian figure at the west end
(Fig. 5) and a row of ten family shrines (Fig. 6),
each featuring a carved post and a carved bird
(nmbel)'’ with outstretched wings at the peak of
FIGURE 5. Spirit guardian figure at dance ground
(namel) of Small Nambas Kastom Village, northeast
Malekula. Photo: B. Craig.
Coiffier in Bonnemaison et al 1996: 222 (see also Fig. 41) identifies this bird as the sparrow-hawk.
REPAINT THE DRUM 121
FIGURE 6. Part of a row of family shrines at dance ground of Small Nambas Kastom Village, northeast Malekula.
Photo: B. Craig.
the gable (also a feature of men’s cult houses on
the middle Sepik River in Papua New Guinea —
see Craig 1987: Plate 30).
There were several large standing slit-drums,
which are beaten with coconuts, and small
horizontal slit-drums, which are beaten with short,
thick wooden sticks. Several drums were played
as an ensemble and the rhythms were quite
complex, which surprised me as I am accustomed
to the relatively monotonous rhythms of the New
Guinea hand-drum.
Some of the dances referred to the planting of
yams and of other protective plants around the
yam mound. One dance featured the men holding
carved and painted paddles, commemorating the
first crossing of the people from the Malekula
mainland to the offshore islands of Wala, Atchin
and Vao. Another dance reminded me of
Australian Aboriginal dances as it entailed bird-
like movements and gestures, and the kicking-
back steps, which raised a lot of dust. The dancers
emphasised the rhythm by stomping short bamboo
tubes vertically on the ground, Yet another
performance featured a pantomime, with one man
chasing and beating another who was covered
with black ash and hobbling ‘painfully’ with the
aid of a stick, causing men, women and children
to shriek with laughter. The women and girls
danced in a group separate from the men and boys
but it was noticeable that children, even toddlers,
were encouraged to join in with the adults.
Although the dances were put on for us as
tourists, everyone had a good time and of course
they were paid, via a charge levied through the
Wala Guest House. A few artefacts were offered
for sale, which also provided a source of income.
I was assured that the dance ground was used also
for traditional grade-taking ceremonies and was
therefore not just a tourist attraction.’
The next day, on Vao Island I saw partly over-
grown nasara, ancient ceremonial dance grounds
with huge stones set up. Some were still being
used for ceremonies, with several large slit-drums
in place (Fig. 7).
An interesting cultural feature I noted was the
presentation of yams tied to a row of leaning
poles, set up for a circumcision ceremony. The
likeness to yam presentations among the Abelam
his visit a few years before mine.
Christopher Tilley (1990; 239-259) provides an extended description and analysis of the ‘Small Nambas’ dance ground and performances, based on
122
FIGURE 7. Slit-drums at dance ground of Vao Island, northeast Malekula. Photo: B. Craig.
of the East Sepik Province of Papua New Guinea
immediately sprang to mind (cf. Hauser-Schaublin
1989, Abb. 141).
After photographing the yam displays I was
taken to a nearby village house, and Paul Malep
showed me a range of carved wooden hand-held
masks for sale. These were reminiscent of a mask
in the South Australian Museum (A.7760, Fig. 8)
mistakenly attributed to Santa Cruz.’ According to
Huffman (in Bonnemaison et al 1996: 23-24), this
type of mask from Vao is called narut (generic
term) and is ‘used in tragicomedy mime sketches
interspersing stages in the extensive grade rituals’.
I was told that some of these masks are named
melo’ombuli and were used by men to enforce
presentation of food by the women during
ceremonies. This reminded me of the function of
certain vanis masks on the Tabar Islands of New
Ireland Province, and of the Sulka keipa masks of
East New Britain Province, Papua New Guinea.
Back on Wala I purchased a stone janus head
(A.74723), recently carved by Franco Siptiley,
complementing a similar object (A.74720) I had
bought at the ‘Small Nambas kastom village’.
Both are called dimetsmiel and represent a spirit
that can be induced to make rain, or other desired
outcomes, depending on the owner’s rights to, and
knowledge of, particular spells. Some stone heads
are used for pig magic, according to Rodman (in
Bonnemaison et al 1996, Figs 195-199).
In the late afternoon I joined a group for a tour
of ancient dance grounds on Wala. They have not
been used for many years and are overgrown but
our guide informed us that there are plans to clear
the saplings and bushes that have sprung up,
restore the sites and use them for ceremonial
9 It is almost identical to the one illustrated in Meyer 1995, Plate 18 (L.4103, Linden-Museum, Stuttgart), and similar to the masks in Speiser 1990,
colour plate xlviii (Vb 4757, Museum fiir Volkerkunde, Basel), and in Bonnemaison et al 1996, Fig. 32 (20933, Musée d’Ethnographie, Genéve).
REPAINT THE DRUM 123
FIGURE 8. Hand-held mask (A.7760), ‘Old Collection’;
probably Vao Island, northeast Malekula. Photo: B.
Craig.
occasions. The old trees and stones lining one side
of each dance ground were impressively large,
creating an atmosphere of ancient ancestral power.
If they revive ritual activities in such places, not
only would visitors be impressed, but also the
initiates themselves.
Espiritu Santo
The next flight was from Norsup to Luganville
on the island of Espiritu Santo. Luganville is the
only town in Vanuatu other than the capital, Port
Vila. From there we travelled west by road to
Tasiriki and by launch up the west coast to Wusi.
The west coast of Santo is steep and rocky, with
few places to go ashore. Wusi is located on a
broad flat area formed by alluvium from a large
stream that has cut a valley deep into the
mountains. This is one of the few places in the
volcanic islands of Vanuatu where clay suitable
for making pots could be found. Pots made here
therefore were traded widely throughout central
Vanuatu.
In 1903 Douglas Mawson spent six months on
a geological field trip in Vanuatu. His original
field note books and some photographs he took
are part of the Mawson Collection, now located in
the South Australian Museum. I found that he
recorded information of cultural relevance only
when he was on the west coast of the island of
Espiritu Santo. These references, under the date
16 July 1903, include detailed notes on pot-
making (which he later published, see Mawson
1957), a story about a skull he collected (which I
have not yet tracked down), and a brief note
recording the purchase of a few ethnographic
objects: ‘Curios: 2 conches, 1 bow & 10 arrows —
bone pointed, 1 mat, 1 piece of turtle shell, 3 pots,
1 plate (broke)’.
In the diary it is implied these items were
purchased at Wuss (Wusi) as the pot-making was
observed there and the note is followed by the
comment, ‘Had a bad passage down to Tasiriki,
landing at 9.55.’ However, the 25 Vanuatu items
Mawson gave to the South Australian Museum in
1955 only partly correspond to the note quoted
above. His donation consisted of the following
items:
One mask (no specific location); one basket
(Santo); one apron, ‘worn behind to sit upon’
(Efate); two spears (no data); one bow (no data);
two bows and fourteen arrows (only seven bone-
pointed) from Banks Is, obtained from Dr
Bowie" of the chief mission station on Espiritu
Santo who collected them ‘long before 1903’;
two pots (Wuss village, Santo); one rat trap
(Aoba).
A donation of 86 objects by Lady Mawson after
Sir Douglas Mawson’s death in 1958 included
‘© Reverend F.G. Bowie of the Presbyterian mission, based at Tasiriki.
124 B CRAIG
around 50 pieces from Vanuatu. While many of
Mawson’s pieces have labels attached, with
collection details in his handwriting, others appear
to have lost their labels; further research will be
necessary to identify all the material from
Vanuatu.
Although he does not mention it in his field
diaries, the labels confirm that Mawson collected
material from locations other than on the west
coast of Santo and, to further confuse matters,
some pieces may have been lost or given away.
For example, there are two Santo pots from
Mawson in the Museum (A.48082, -3) and a
similar pot (A.29997) from Howchin, a friend and
respected senior colleague of Mawson. Perhaps
Mawson gave a Wusi pot to Howchin. It is
therefore quite possible that these three pots are
the three referred to in Mawson’s diary.
During the next two days at Wusi, I purchased
21 pots from five women (A.74724-38, 74740—5),
nine of which were made by Vera Mei-u (Fig. 9)
who is illustrated making pots in Bonnemaison et
al 1996, Figs 106-107. I recorded six pot types. I
showed Vera Mei-u photographs of Santo pots in
the South Australian Museum (from Mawson,
Howchin, Gray and Macmillan) and obtained
information on what the pots are called, what the
designs are called, and what types of food are
cooked in them. Information on contemporary
FIGURE 9. Vera Mei-u, potter of Wusi, Espiritu Santo.
Photo: B. Craig.
[a B85 ey
+ 95 cem—>*—105 SSE: LE a Ld 60 cme+—1 05 cm—>
a
Pea AUC UCU UI RTE
fen
Aureee acta
FIGURE 10. Plan of typical outrigger canoe, Wusi, Espiritu Santo. a. outrigger attachment; b. attachment of boom
to gunwale.
REPAINT THE DRUM 125
pottery has been published by Galipaud (in
Bonnemaison et al 1996: 97-99).
There are no longer any of the large trading
canoes to be found in Vanuatu but plenty of small
outrigger fishing canoes can be seen. Eight were
pulled up on the beach at Wusi so I photographed
and measured them all. I used the average of these
measurements to draw a plan of the ‘typical’
outrigger canoe of west Santo (Fig. 10). It is
interesting that, based on his observations during
1910-12, Speiser wrote (1990: 224), ‘In northern
Santo...boats are very rare...[and people] on the
west and southwest coast of Santo hardly ever
venture onto the water’.
Ambae (Aoba)
Returning to Luganville, we flew to Longana
on east Ambae and were driven to Lolowai where
accommodation had been arranged. Several
women gathered to demonstrate their basket-
making and mat-weaving skills. We were invited
to Lolovoli village to see a drum and dance
performance the next day.
This performance perfectly illustrated Crowe’s
description in Bonnemaison et al (1996: 157):
In east Ambae slit-gong ensembles, the largest
gga
eo
gong is called ratahigi, the middle gong simbegi
and the small gong valagi. The ensemble is
likened to a voyaging canoe, where the gongs
are ‘captain’, ‘helmsman’ and ‘crew’
respectively — the ‘crew’ may be several small
gongs — and on the dance ground the ratahigi
controls the ritual sequencing (items, stops and
starts), the simbegi directs the speed of the items
in sync with the dancers and the valagi provides
rhythmic embellishment.
The dance we witnessed at Lolovoli, called
tikor, was accompanied by five slit-drums — a
large ratahigi over 2 metres in length; a simbegi
just over a metre and a half in length; two valogi
about a metre in length and a small valogi just
over half a metre long. They were arranged in a
horizontal position in an open-sided hut next to
the dance ground and were undecorated (Fig. 11).
The ‘captain’, Joseph Maori, was an old man,
strong and steady, laying down the basic rhythms.
The ‘helmsman’ was Edward Garai, wiry, full of
vigour, flashing his teeth, his whole upper body
animated with the complex beats by which he
directed the tempo of the dozen dancers led by
Aaron Ang’ga. The three ‘crew’ — David Boi,
Moses Tafoa and another man — ornamented the
progress of the work.
FIGURE 11. Drum ensemble performing at Lolovoli, west Ambae. Photo: B. Craig.
FIGURE 12. Women weaving mats, Lolowai, west
Ambae. Photo: B. Craig.
The drummers’ and dance leader’s names
reflect the history of Christian missionary activity
in these islands but ‘kastom’ persists alongside
the new ways, and there is no conflict in their
minds between the notion of respect for the
ancestors and respect for the Christian God.
The next day I was presented with a written
program of activities demonstrating the processes
of weaving and dyeing mats.'' Apart from pigs
and pig tusks, perhaps the most important trade
items in central Vanuatu were the mats woven by
women (Fig. 12) from strips of pandanus leaf
(Pandanus tectorius), often with abundant fringes
and using designs dyed a brownish-red. This dye
used to be obtained from the bark of Ventilago
neocaledonica, but the women said that this plant
B CRAIG
is increasingly difficult to find so nowadays they
buy imported red, purple and blue dyes from the
trade store. They still use a yellow dye from the
grated rhizome of a plant called ang’or
(turmeric?). In the southern half of Vanuatu it
would appear that tapa cloth performed some of
the same functions as mats in the northern half,
but tapa is rarely made today.
To prepare a mat for dyeing, it is first tied
around a log of suitable circumference. Linear
geometric designs are produced by binding short
strips cut from the stems of Heliconia indica over
the mat using a rope that is permeable to the dye
to produce white motifs on a coloured ground;
this type of mat is called singo on east Ambae.
More complex, curvilinear motifs are achieved by
binding on stencils cut from layers of the trunk of
a banana plant; this type of design is used on mats
called gwana. Long mats, either uncoloured or
dyed in a single block of colour, are called
maraha.
When the mat has been prepared it is then laid
in a galvanised iron trough of hot dye which
simmers over the flames for 15 to 30 minutes.
The mat is then taken out of the trough, the
stencils are removed and the mat is dried in the
sun.
The gwana mats may be worn by women as
clothing or may function as blankets and floor
mats; maraha may be used to wrap the dead;
singo are worn by men and indicate status in the
grade system. Gwana, and especially maraha, are
used as items of exchange, functioning as
traditional ‘money’. They are most important as
marriage gifts from bride’s family to bridegroom’s
family (Bonnemaison et al 1996, Figs 122, 123,
129), symbolising the fertility of women in
opposition to the curved pigs’ teeth which
represents men’s reproductive substance (Walter
in Bonnemaison et al 1996: 108).
Baskets of all shapes and sizes, some with
intricate coloured designs — including names —
woven into them, are also of great importance as
containers and carry-alls, there being no tradition
here of looped string net bags as in Papua New
Guinea.
Following the demonstration of weaving and
dyeing, dozens of mats and baskets were laid out
for me, from which I chose seven mats (A.74748,
74750-55) and four baskets (A.74746, -47, -49,
-56) of different types for the Museum.
"For a brief description of the social significance of mats and of mat-making and dyeing on Ambae, see Bolton in Bonnemaison et al 1996: 112-119;
and for an extended study, see Bolton 1993. Eleanor Williams (1928) reported mat-making on Pentecost Island.
REPAINT THE DRUM 127
FIGURE 13. Dance ground at Fanla, north Ambrym, showing slit-drums, grade figures and men’s house. Photo: B.
Craig.
Ambrym
We flew back to Luganville and caught the
plane to Craig Cove, west Ambrym, for the final
stage of the fieldtrip. An outboard-powered
launch took us to Ranon on the north coast, where
we were met by Billy Bong and shown to a little
Church-run guest house. I noticed a carvers’
workshop on the beach with several unfinished
slit-drums and grade figures inside. I arranged
with Billy to visit Fanla, a village up on a ridge a
few kilometres east of Ranon, the next day. This
was where the slit-drum bought by Claire and
Bryan Murray had come from. That night we slept
with the sulphurous fumes of Mt Benbow drifting
through the village.
The next day we walked up to Fanla and found
James Taimal, and I obtained further information
about the slit-drum (a-tin-tin) at the South
Australian Museum. It had been carved by Golele
(also known as Tin Mweleun) under commission
from Chief Taimal (James’s father) around 1968
from a breadfruit tree log (pita). I photographed
the dance ground with its slit-drums, grade figures
and men’s house (Fig. 13), and purchased for the
Museum one of the unpainted grade figures
(mage) carved from tree-fern (palang) by Alili
Molkaun about 1990 (A.74757).
The sacrifice of pigs is essential for all ritual
occasions, especially when men seek to move
upwards in the competitive grading systems. A
visible marker of grade-taking is the tree-fern or
wood figure carved by the grade-taker and erected
on the dance ground. Bonnemaison says of grade-
takers in south Malekula (Bonnemaison et al
1996: 209),
As he rises, the man of high grade becomes a
supernatural being, hedged about with numerous
tabus and kept carefully apart from the world of
the ‘living’...the man of high grade here is a man
who has joined the community of his ancestors.
FIGURE 14. Chief Pong Randi of Ranon, north
Ambrym, playing mouth-bow. Photo: B. Craig.
128 B CRAIG
We returned to Ranon and arrangements were
concluded with Billy and James for their travel to
Adelaide in March to repaint the slit-drum. They
were to bring red, white and black pigments, a
mallet and chisel for demonstration carving, and
powdered kava for the feast to follow the
installation of the drum. I agreed to supply a pig,
taro, yam and sweet potato for the feast.
Before returning to Craig Cove the next day,
we were invited to hear Chief Pong Randi
demonstrate his musical skills using a mouth-bow
(yutoto) and a long, end-blown bamboo flute
(liblabo). 1 photographed the Chief playing a few
songs on each instrument (Fig. 14) and was able
to purchase them for the Museum (A.74759 and
A.74758 respectively). These instruments were
virtually identical to those obtained by the
Museum from Reverend Gray in 1895 (A.29998
and A.8387 respectively).
At Craig Cove I was handed a letter by Ramel
Bong for the Director of the South Australian
Museum regarding the concerns of the men of
west Ambrym about a rom mask in the
Museum’s collections (cf. Bonnemaison et al
1996: 327-329, Fig. 18). This mask (A.7433 —
see the cover of Ling 1982) was collected by
Douglas Mawson in 1903. It is not currently on
display although it used to be, at least from 1949
until around 1992. The men of west Ambrym
stated categorically it should not be placed on
public display and must not be seen by anyone
not of the proper grade, although they had no
concern about the display of photographs of it.
However, the letter proposed that we could pay
50,000 vatu (approx. Aust. $600) to obtain the
right to exhibit the mask.
The rom mask’s specific name is bati pasel
and it is normally destroyed after the ceremony
in which it is used. I took the opportunity to
explain the SA Museum’s policy, and facilities,
for dealing with Aboriginal secret—sacred
material and suggested that we could do the
same sort of thing for this rom mask if the
Director decided not to purchase the right to
display it.
In Vila I spent the next two days packing
the collection, getting it fumigated by
Quarantine and obtaining export permits from
the Vanuatu Cultural Centre. Arrangements
were made with Ralph Regenvanu, the
Director of the Cultural Centre, for ensuring
that the trip to Adelaide by Billy Bong and
James Taimal would proceed smoothly. I
reflected with surprise that the whole trip had
gone like clockwork.
THE RESULTS
Establish a Working Relationship between SA
Museum and the Vanuatu Cultural Centre
Before departing for Vanuatu, almost the entire
collection of around 580 Vanuatuan objects, both
on display and in storage, was photographed and
the prints placed in two photo albums. Reference
numbers and collection registration numbers were
written beside each photograph and a computer
print-out was included.
The album provides an understanding for the
Vanuatu Cultural Centre of what types of objects
we have in our collections in Adelaide. This may
be of assistance for planning exhibitions in
Vanuatu of material not held in the Centre’s own
collections but which could be sent on loan for
that purpose. It may also be useful for identifying
material for repatriation should that become an
issue. Reference to individual photographs may
also be of assistance in gaining further
information, by email and correspondence, about
the objects depicted in them.
Documentation of SA Museum pieces on the
basis of photographs
The photograph albums were circulated among
the Cultural Centre fieldworkers during the last
few days of their workshop, which I attended. The
photographs excited a great deal of interest and
several people provided information about the
objects depicted. This has added considerably to
knowledge of the origins and significance of the
pieces in the collections.
There wasn’t sufficient time during the
workshop to go through all the photographs to
document all of the 580 pieces in the collections.
However, I did manage to check all of the woven
mats and baskets with Mrs Jean Tarisese of the
Vanuatu Cultural Centre. She explained the
apparently incorrect provenances of some of the
mats; for example, two mats collected in
Erromango (A.63021, -2) were most likely made
by an Ambae woman whose family was relocated
to Erromango by Europeans, and a mat collected
in Malekula (A.42469) was almost certainly
traded from Ambae.
The tapa cloths were checked with a
fieldworker from Erromango, who also corrected
provenances. For example, three cloths (A.60480-2)
recorded to be from Banks Islands, collected by
Archdeacon E.A. Codd and donated in 1970, are
definitely not Vanuatuan, as blue-dyed tapas are
unique to the Solomon Islands (cf. Neich and
REPAINT THE DRUM 129
Pendergrast 1997: 128).'* Codd ran a Melanesian
Mission boarding school on Banks Islands but
was also for a time Warden of the Teachers’
Training College at Seota on Florida Island so he
could have obtained the tapas from a Solomon
Islands student attending either of those
institutions. Three other cloths are definitely not
Vanuatuan. Two stencilled tapas (A.37472,
37504), obtained from F. Whitby in 1900 and
recorded to be from Havannah Harbour, Efate, are
Samoan or early Tongan in type (cf. Neich &
Pendergrast 1997: 35, 40) and a third (A.37473)
is clearly Tongan (cf. Neich & Pendergrast 1997:
48 bottom). Neich and Pendergrast (1997: 22-23,
155) have noted that tapa cloths often were
collected in places far from their geographical or
cultural origin, for example when items were
moved by trade or when Polynesian mission
families were posted to Melanesia.
Five tapas were recognised to be from
Erromango in southern Vanuatu — two from the
northwest coast (A.56589a, 63020) and three from
the southeast coast (A.56589b, 63018, -19). A
repeated lozenge design (nirom) on the tapas from
the northwest was associated with warfare. The
designs on the other three were said to represent
certain birds (unkil and menuk roya) and flowers
(niyor), but the significance of these motifs was
not stated.
These tapa cloths from Erromanga, called
nemas-itse, were used ‘as women’s clothing and
for local barter as well as for carrying babies’
(Lawson 1994: 64). Huffman in Bonnemaison et
al (1996: 129-140) provides further information
about bark cloth in Vanuatu, how it was made and
used, and its sociocultural importance.
The photographs of the clay pots were shown to
women at the village of Wusi on Santo, who
provided additional information. These included
the two pots (A.48082, -3 — uro-turi and uro-vela
respectively) collected and described by Douglas
Mawson (Mawson 1957), the one (A.29997)
donated to the Museum by Howchin and probably
collected by Mawson, one from Rev. William
Gray (A.8351) and six from Rev. T. Macmillan
(A.8349, 8350, 8352-5), who took over on Tanna
when Gray left.
Some information was recorded regarding the
circular ‘stone money’ of Erromango (A.8452)
and the crescent-shaped lumps of clam-shell
(A.8453-—5). I was informed by James Atnelo that
the rings of stone were called navela, and were
cut from soft limestone then buried for a few years
until they hardened up to resemble marble. Speiser
(1990: 244-245), who records them as navilah,
reports that they were not quite like ‘money’ in
that they had no fixed value and were not used in
daily trading. I was told they could be used for
bridewealth, to pay blood debts and funerary
debts, and to make peace. The round ones
(navela) represent the full moon; the crescent-
shaped clam-shell and stone equivalents (navelong
kone) represent the crescent moon; the former are
used only by chiefs and the latter by lower ranks.
A navela is known by the names of the important
women it has been used to ‘pay for’.
A canoe model (A.8037) was identified by a
workshop participant as coming from Makura in
the Shepherd Islands. After I returned to Adelaide,
I came across a handwritten list of the collection
bought in 1895 from Rev. William Gray. This list
includes a model canoe from Tongoa, which is in
the Shepherd Islands only 25 kilometres from
Makura. This data had not been transferred to the
register. Another model canoe in the Gray
Collection list is from ‘Aneiva’, which is
undoubtedly Aniwa. This must be A.8039, which
appears in the Museum’s register as ‘Old
Collection, New Hebrides’. A photograph of this
canoe model was not available for inspection by
Cultural Centre fieldworkers to confirm the Aniwa
provenance (and by implication that it is part of
the Gray Collection), but comparison with
Haddon and Hornell’s sketch of a canoe from
nearby Futuna (1937, Fig. 9) supports this
identification.
Photographs of six of the masks in the
Museum’s collection were shown to a number of
men to elicit information about them. Two masks
(only one photographed) with the white bird on
top (A.7430, 7431) from Rev. Gray in 1895 have
been mentioned above. A similar mask, but
without a bird, from Rev. F. Whitby in 1900
(A.7429) has been on display for at least 50 years.
Although documented as from ‘Vote Island’
(presumably Vaté, ie Efate), it is from ‘Small
Nambas’ (northeast Malekula) according to
informants, and is called ben’gelo. It seems to
be the same type of mask as that described by
Huffman (in Bonnemaison et al 1996: 21, Fig. 20)
as the ‘round head’ (botmolmoli) type.
Two masks from Malekula — A.7432 from Rev.
The SA Museum has a similar blue-dyed tapa (A.8270) from Santa Isabel in the Solomons collected by Bishop Cecil Wilson.
This could be the same as the term I heard, slightly differently, for A.7430- bang lulu.
130
F. Whitby, 1900, and A.7758 from the ‘Old
Collection’, 19th century — may be compared to
Speiser 1990, Plate 99, Nr 2 and Plate 94, Nr 6
respectively. The only information I could gather
was that they were from southern Malekula.
Concern was expressed about the rom mask,
A.7433, as noted above (but not about A.52465
that appears also to be an Ambrym rom mask,
nineteenth century, transferred to the South
Australian Museum from the Port Adelaide
Institute). When I returned to Adelaide I
discovered that the former had been given to the
Museum around 1906 by Douglas Mawson after
he took up a position teaching geology at the
University of Adelaide. I read through Mawson’s
New Hebrides field diaries, which indicate that he
travelled through the archipelago by boat and on
12 August 1903 made a few observations, from
the deck, at Dip Point (West Ambrym) but there is
no mention of going ashore or of collecting the
mask there. In one notebook there is a list of
things for him to do and on the list is ‘Obtain a
mask’. It is likely, therefore, that he obtained one
in Port Vila from another collector or a trader. In
the Mawson archives there is a photograph of him
wearing the mask in front of the southeastern
corner of the Quadrangle at the University of
Sydney during a graduation day charade. Standing
on a horse-drawn wagon, his skin blackened,
Mawson wears the mask and a grass skirt, and a
‘missionary’ stands beside a large cooking pot
(Pharaoh & Craig 2001).
The South Australian Museum has 17
overmodelled and painted skulls from southern
Malekula (A.9756, 11461-75, 12165). Speiser
says of northern Vanuatu, ‘the head was regarded
as the seat of life and the soul, and consequently,
after death, the skull was treated with very special
reverence’ (1990: 319). When a high-ranking man
died, his skull was cleaned and overmodelled with
a mixture of coconut fibre, clay and fig tree sap to
produce a portrait; the head was then painted with
the pattern representing the man’s rank in the
grade system (Speiser 1990: 275). These
memorials of the dead were placed on a pole
carved with anthropomorphic features (Speiser
1990: Plate 81, Nr 13; Plate 82, Nr 2); or, in the
case of the highest-ranking men, the whole body
was modelled in plant materials, with the portrait
skull set on its neck, and kept in the men’s house
(Bonnemaison et al 1996, Fig. 243; Speiser 1990:
349, Plate 80, Nr 3). These memorial effigies are
called rambaramp.
Because of the concerns of Australian
Aboriginal people about museums holding
B CRAIG
Aboriginal remains, I asked the Director of the
Vanuatu Cultural Centre whether the display of
portrait skulls was a problem for Vanuatuans and
he replied that he had never heard such concern
expressed. Consistent with this was the response
from the Vanuatu Cultural Centre’s previous
Director when Michael Quinnell of the
Queensland Museum asked about whether there
would be any objections to displaying the
Malekulan rambaramp figure in that museum’s
FIGURE 15. Grade figure (A.7448), New Hebrides,
‘Old Collection’; collected by Rev. T.W. Leggatt from
Barabitam Asing of Sah Sun Bay, south of Aulua,
southeast Malekula, and passed on to Rev. W. Gray.
Photo: Scott Bradley.
REPAINT THE DRUM 13]
collections (Hamlyn-Harris 1915) and only
encouragement was given (M. Quinnell, pers.
comm. 25 June 1998).
These results confirm the value of returning to
places where artefacts have come from, even a
century ago, to recover more information about
the objects from the memories of people living
today and to check whether exhibition of certain
material continues to be permissible.
Acquisitions for future exhibits
I visited specific locations in Vanuatu to
purchase objects equivalent to certain pieces in
the South Australian Museum’s collections. I
obtained 21 clay pots from the village of Wusi on
Espiritu Santo which are smaller than, but in other
ways comparable to, those from around a century
ago. I also purchased seven mats and four baskets
from Lolowai on the island of Ambae, to compare
with the excellent old pieces we have from that
island and from Pentecost and Maewo.
Previously we did not have an example of a
carved canoe prow and I was able to obtain one.
The flute (cf. Bonnemaison et al 1996: 150-153)
and mouth-bow from Chief Pong Randi of Ranon,
Ambrym, are comparable to the mouth-bow from
Ambrym" and the end-blown flute from Malekula
mentioned above.
Of considerable interest too is the carved
‘black-palm’ (tree-fern) grade figure (cf.
Bonnemaison et al 1996, Figs 325, 335)
purchased from the dance ground at Fanla from
which the slit-drum came. It complements the late
19th century grade figure (A.7448, Fig. 15) of
carved and painted wood which almost certainly
was collected by Rev. T.W. Leggatt in southeast
Malekula and is part of the Gray Collection (see
Craig, in press).
These comparative materials formed the basis
for a special exhibition, ‘Spirits of Vanuatu’, in
the South Australian Museum’s Pacific Gallery
commencing March 1998. This exhibition brings
ES
FIGURE 16. James Taimal repainting the slit-drum. at the South Australian Museum on the occasion of the
Adelaide Festival of Arts, 1998. Photo: Andrew Hughes.
The old handwritten list of items obtained from Rev. William Gray includes ‘1 Malecula flute’ and ‘1 Harp (Ambriam)’. This list apparently was
not seen by the person who registered the mouth-bow in 1941, as the provenance is given as ‘Espiritu Santo’ and a reference to Edge-Partington,
Series III, p.60 is provided in the Remarks column. This reference is to a British Museum specimen from Espiritu Santo, Speiser (1990) illustrates
one, which he calls a Jew's Harp, from Ambrym in Plate 102, Nr 5.
132
to the attention of the Museum visitor the
continuity of tradition in a context of change."
Repaint the Drum - the Festival event
James Taimal and Billy Bong had nominated
themselves to go to Adelaide to repaint the drum.
James had the rights to carve and paint and Billy
could assist. The fieldworkers at the workshop
had agreed with this proposition.
The cost of passports and visas for the two men,
boat travel, meals and accommodation, and an
honorarium for each man were met from the
project budget. Free air travel was provided for
them by Vanair, Airvanuatu and Ansett Airlines.
The repainting event was scheduled for
Thursday 12th March. Billy and James arrived in
Adelaide Tuesday morning, 10th March. This
provided two days to inspect the slit-drum, to look
through the Pacific Gallery — especially the
Vanuatu exhibits — and become familiar with the
venue, to ensure all the necessary equipment and
materials were available, to cut a 1.5 metre length
of pine for James to demonstrate the carving of a
grade figure, and to provide advice about the
cooking of the pig and vegetables in a ‘ground
oven’ and the preparation of kava drink from the
powdered form they had brought with them from
Vanuatu. We were also assisted in the preparation
of the food and drink by a number of Melanesian
volunteers living in Adelaide.
The carving, painting (Fig. 16) and ground oven
were of considerable interest to school students,
staff of the Museum and curious passers-by, and
elicited many spontaneous and favourable
comments. One example was the family from
Adelaide’s northern suburbs who had come in to
the city to see what was happening and stumbled
on the event by chance. They commented that it
was a pleasant surprise to come across an event
which belied the commonly held belief that
museums are storehouses of dead things.
A couple of youths with colourful tattoos on
their arms and on their shaved heads attracted the
favourable interest of James and Billy, who fell
into conversation with them. As a result of being
treated with respect by people whose culture
accepts tattoos as a sign of high status, these
B CRAIG
youths offered their help in clearing up the
grounds afterwards.
A special guest at the repainting event was
Xavier Minniecon, a well-known Adelaide
television identity. Minniecon’s great grandfather
had been ‘blackbirded’ from Craig Cove to work
on the Queensland sugar plantations and had not
returned home. Instead he had married a European
woman and settled in Australia. Minniecon spoke
of his childhood ‘on the wrong side of the tracks’
and of his determination to make a go of it. He
succeeded but felt a gap in his knowledge and
experience regarding Vanuatu, as he had never
been there. The invitation to be associated with
the ‘Repainting the Drum’ event was for him an
opportunity to explore his cultural and genetic
roots and he spoke eloquently on behalf of racial
and cultural tolerance.
The tables had turned. Previously it was the
white people who went among the Melanesians to
convince them to live in harmony; now it was the
turn of the Melanesians to take that message to
the white people.
ACKNOWLEDGMENTS
This project happened because Claire Murray
generously donated the slit-drum to the South Australian
Museum; and because the Friends of the South
Australian Museum provided funding and the then-
Director of the South Australian Museum, Dr
Christopher Anderson, supported the project as a
Festival event. Dr Darrell Tryon (Australian National
University) and Ralph Regenvanu and his staff at the
Vanuatu Cultural Centre provided information, practical
advice and encouragement for the fieldwork component
of the project. Several ni-Vanuatu volunteer
fieldworkers helped with the logistics and hospitality in
the islands. James Taimal and Billy Bong made the
Festival event a resounding success. Maria Troiano’s
research was invaluable and Scott Bradley’s
photography was crucial to the project. Xavier
Minniecon generously gave of his valuable time to help
with the feast and dedication of the drum at the Festival.
Vanair, AirVanuatu and Ansett Airlines provided fares
for James Taimal and Billy Bong, and Helen and Paul
Dennet looked after them in Sydney. Several Pacific
islanders living in Adelaide volunteered to help cook
the pig and vegetables in the ground with hot stones.
'S The information sheet which accompanies this exhibition may be viewed on the South Australian Museum’s website, at <www.samuseum.sa.gov.au/
info_sheets.htm>, and click on ‘Vanuatu’.
REPAINT THE DRUM 133
REFERENCES
Bolton, L. 1993. ‘Dancing with Mats: Extending
Kastom to Women in Vanuatu’. PhD thesis,
Department of Anthropology, Manchester University:
UK.
Bonnemaison, J. 1994. ‘The Tree and the Canoe’.
University of Hawai’i Press: Honolulu.
Bonnemaison, J, Huffman, K, Kaufmann, C & Tryon, D
(eds). 1996. ‘Arts of Vanuatu’. Crawford House
Publishing: Bathurst, NSW.
Bregulla, HL. 1992. ‘Birds of Vanuatu’. Anthony
Nelson: Oswestry, Shropshire.
Chance, I & Zepplin, P. 1993. Cannibal cultures: The
(un)making of the modern museum. Broadsheet
22(2): 12-13.
Clausen, R. 1960. Slit-drums and ritual in Malekula,
New Hebrides. Jn ‘Three Regions of Melanesian
Art’, pp. 16-22. Museum of Primitive Art: New
York.
Craig, B. 1987. ‘The Sepik’. Robert Brown &
Associates: Bathurst, NSW.
Craig, B. 1993. Sulka Danced Sculpture. Artlink
13(1&2): 46-49.
Craig, B. 1994. Masta bilong faiawud. Paradise 103:
29-31.
Craig, B. 1995. Following the tracks of Edgar Waite in
New Guinea for the Pacific Arts Symposium in
Adelaide. Records of the South Australian Museum
28(1): 33-52.
Craig, B. in press. ‘To ‘paddle our own canoe’: The
Reverend William Gray collection in the South
Australian Museum’. [Papers from the Sixth Pacific
Arts Symposium in Noumea in July 2001.] Crawford
House Publishing: Australia.
duPont, E. 1976. ‘South Pacific Birds’. Delaware
Museum of Natural History: Greenville, Delaware.
Haddon, AC & Hornell, J. 1937. ‘Canoes of Oceania’.
Vol. II. Bernice P. Bishop Museum: Honolulu.
Hamlyn-Harris, R. 1915. Malekula Effigy. Memoirs of
the Queensland Museum 3: 14-15.
Hauser-Schaublin, B. 1989. ‘Leben in Linie Muster und
Farbe’. Birkhauser: Basel.
Lawson, B. 1994. ‘Collected Curios. Missionary Tales
from the South Seas’. McGill University Libraries:
Montreal.
Layard, J. 1942. ‘Stone Men of Malekula. Vao’. Chatto
and Windus: London.
Ling, JK. 1982. ‘Collections in the South Australian
Museum’. Government Printer: Adelaide, South
Australia.
Mawson, D. 1957. Knee moulded pots from the New
Hebrides. Records of the South Australian Museum
13: 83-86.
Meyer, AJP. 1995. ‘Oceanic Art’. 2 vols. K6nemann:
Koln.
Neich, R & Pendergrast, M. 1997. ‘Traditional Tapa
Textiles of the Pacific’. Thames & Hudson: London.
Pharaoh, M & Craig, B. 2001. Douglas Mawson, the
cannibal. [The University of Sydney] Gazette 29(2):
3.
Speiser, F. 1990. ‘Ethnology of Vanuatu: An Early
Twentieth Century Study’. (Translation of 1923
German edition.) Crawford House Press: Bathurst,
NSW.
Spriggs, M. 1997. ‘The Island Melanesians’. Blackwell
Publishers: Oxford.
Tilley, C. 1990. ‘Metaphor and Material Culture’.
Blackwell Publishers: Oxford.
Williams, ES. 1928. Textile work on Pentecost Island,
New Hebrides. The Australian Museum Magazine 3:
278-281.
Zepplin, P. 1993. Pacific Arts Symposium. Art and Asia
Pacific 1(1): 15-18.
TWENTY-FIVE NEW DYTISCIDAE (COLEOPTERA) OF THE GENERA
TJIRTUDESSUS WATTS & HUMPHREYS, NIRRIPIRTI WATTS &
HUMPHREYS AND BIDESSODES REGIMBART FROM UNDERGOUND
WATERS IN AUSTRALIA
C. H. S. WATTS & W. F. HUMPHREYS
Summary
Twenty-five new species of stygobitic Dytiscidae from inland Western Australia and Central
Australia are described: Tyirtudessus bialveus sp. nov., T. cunyuensis sp. nov., T. jundeeensis sp.
nov., T. karalundiensis sp. nov., T. macrotarsus sp. nov., T silus sp. nov., T. sweetwatersensis sp.
nov., T. wilunaensis sp. nov., T. yuinmeryensis sp. nov., Bidessodes limestoneensis sp. nov., B.
gutteridgei sp. nov., Nirripirti darlotensis sp. nov., N. fortisspina sp. nov., N. hamoni sp. nov., N.
killaraensis sp. nov., N. macrocephalus sp. nov., N. melroseensis sp. nov., N. milgunensis sp. nov.,
N. napperbyensis sp. nov., N. newhavenensis sp. nov., N. pentameres sp. nov., N. plutonicensis sp.
nov., N. stegastos sp. nov., N. skaphites sp. nov. and N. wedgeensis sp. nov. The genus Nirridessus
Watts & Humphreys 1999 is synonomised with Tjirtudessus Watts & Humphreys 1999.
TWENTY-FIVE NEW DYTISCIDAE (COLEOPTERA) OF THE GENERA TJIRTUDESSUS
WATTS & HUMPHREYS, NIRRIPIRTI WATTS & HUMPHREYS AND BIDESSODES
REGIMBART FROM UNDERGROUND WATERS IN AUSTRALIA
CHS WATTS & WF HUMPHREYS
WATTS, CHS & HUMPHREYS, WF. 2003. Twenty-five new Dytiscidae (Coleoptera) of the
genera Tjirtudessus Watts & Humphreys, Nirripirti Watts & Humphreys and Bidessodes
Regimbart from underground waters in Australia. Records of the South Australian Museum
36(2): 135-187.
Twenty-five new species of stygobitic Dytiscidae from inland Western Australia and Central
Australia are described: Tjirtudessus bialveus sp. nov., T. cunyuensis sp. nov., T. jundeeensis
sp. nov., T. karalundiensis sp. nov., T. macrotarsus sp. nov., T. silus sp. nov., T.
sweetwatersensis sp. nov., T. wilunaensis sp. nov., T. yuinmeryensis sp. nov., Bidessodes
limestoneensis sp. nov., B. gutteridgei sp. nov., Nirripirti darlotensis sp. nov., N. fortisspina
sp. nov., N. hamoni sp. nov., N. killaraensis sp. nov., N. macrocephalus sp. nov., N.
melroseensis sp. nov., N. milgunensis sp. nov., N. napperbyensis sp. nov., N. newhavenensis
sp. nov., N. pentameres sp. nov., N. plutonicensis sp. nov., N. stegastos sp. nov., N. skaphites
sp. nov. and N. wedgeensis sp. nov. The genus Nirridessus Watts & Humphreys 1999 is
synonomised with Tjirtudessus Watts & Humphreys 1999.
This brings the total of stygobitic Dytiscidae described from Australia to 42 species in three
genera. Two of the new species are placed in the genus Bidessodes Regimbart, representing the
first stygobitic members of the genus. Geographically the new species greatly extend the range
of stygobitic Dytiscidae in Australia to include Central Australia. As before (see Watts &
Humphreys 2001) the stygofauna was found together with a rich stygobitic fauna in those
portions of shallow aquifers that ran through areas of calcrete formation.
CHS Watts. South Australian Museum, North Terrace, Adelaide, South Australia 5000.
WF Humphreys, Western Australian Museum, Francis Street, Perth, Western Australia 6000.
Manuscript received 2 September 2002.
This is the fourth paper in what has become a
series of papers describing the stygobitic
Dytiscidae of Australia (Watts & Humphreys
1999, 2000, 2001). In it we describe the new
species found during fieldwork in Western
Australia and in the Northern Territory in winter
2001 and discuss the associated stygofauna and
chemical profiles of some of the aquifers in which
the species were found.
Twenty-five new species are described, which
significantly extends both the geographic and
taxonomic range of the fauna. A rich fauna has
been discovered in aquifers in the Ngalia Basin
northwest of Alice Springs in central Australia;
and stygobitic members of the genera Bidessodes
Regimbart (Bidessini) and Copelatus Erichson
(Copelatinae) have been discovered as well as
numerous new species of the Hydroporine genus
Nirripirti Watts & Humphreys, previously known
from only one species. The Copelatus is the
subject of a separate paper that also includes
preliminary results of a study of the phylogenetic
relationships between it and other Australian
Copelatus using DNA sequence data (Balke et al
2003). A similar but separate study has been
undertaken on the relationships of the
Hydroporine stygobites and potential above-
ground relatives (Cooper et al 2002). This study
confirms the close relationship between the
stygobitic bidessine genera Nirridessus Watts &
Humphreys and Tjirtudessus Watts & Humphreys
and the surface genera Limbodessus Guignot and
Boongurrus Larson, as well as the Australian
species of Liodessus Guignot. The study also
suggests that the Hydroporine Nirripirti is close to
Paroster Sharp as we previously suggested (Watts
& Humphreys 2001). This latter placement has
been confirmed by Ignacio Ribera (pers. comm.),
who included Nirripirti hinzeae Watts &
Humphreys in a worldwide study of relationships
within the Dytiscidae using sequence data from
the mitochondrial genome.
Based on sequence data, two of the new
Bidessine species showed little genetic
136
relationship with either Tjirtudessus or
Nirridessus but grouped somewhat distantly with
Australian species of Bidessodes Regimbart.
Mainly on this evidence they are described here as
members of that genus, pending further study and
additional specimens and possibly species.
The sequence data is unequivocal in saying
what was becoming increasingly apparent
morphologically: that any distinction between
Tjirtudessus and Nirridessus is artificial and
appears to be based primarily on size. Equally
unequivocal is the paraphyletic nature of both
these genera together with the Australian
Liodessus species. The sequence data also
includes the genera Boongurrus and Limbodessus
in a very bushy phylogenetic tree. Allodessus
Guignot is only a little more distant. It is clear that
the current taxonomy of this group of genera is
untenable. To sort it out will require considerable
study, beyond the scope of this paper. We have,
however, decided that the existing evidence is too
strong not to synonymise the genera Tjirtudessus
and Nirridessus, which we formally do here,
Tjirtudessus having page priority. We do this in
the knowledge that in all probability they will be
further synonymised with some or all of the
above-ground genera mentioned previously (M.
Balke & I. Ribera, pers. comm.).
The bulk of the new species are evenly split
numerically between the Bidessine Tjirtudessus
and the Hydroporine Nirripirti. Geographically
the two genera appear to have generally different
distributions: Tjirtudessus more southern and
Nirripirti more northern. The two Bidessodes
species are known only from the northern
Gascoyne region and will probably also prove to
have a northern distribution, as do their above-
ground congeners.
As in previous years, the collection includes
additional species, known only from either female
specimens or partial specimens, and larval
specimens of both Tjirtudessus and Nirripirt.
However, these are not reported on at this time,
primarily due to lack of suitable material or, in the
case of larvae, no firm association with adults.
The latter is currently under way utilising genetic
typing.
As for the aquifer systems reported in our
earlier papers, numerous specimens of Crustacea
(bathynellids, harpacticoid and cyclopoid
copepods, ostracods and oniscid isopods) and
some Oligochaeta and Hydracarina were collected.
In addition, some sites in the Northern Territory
yielded a diversity of strongly stygomorphic
Hydrobiidae (Gastropoda). As before, the beetles
CHS WATTS & WF HUMPHREYS
and larger stygofauna were restricted to aquifers
in areas of calcrete, as the stygofauna is largely
found in the northern parts of the western shield
(Poore & Humphreys 1998, submitted;
Humphreys 1999a, 2001). As reported in our
previous paper (Watts & Humphreys 2001),
stygofauna were present both in narrow bore-holes
drilled for geological purposes, water pumping or
aquifer assessment, and in wide hand-dug wells
established for pastoral purposes. The watertable
in calcrete is often only 2-3 m below the surface;
it is frequently exposed by calcrete quarries used
for the purpose of road making or mineral
processing, which, being left unfenced, are readily
grossly contaminated by stock.
MATERIALS AND METHODS
The collection methods and measurements of
physicochemical parameters in the water largely
follow those used previously (Watts & Humphreys
2000). However, the use of a Horiba U22
multiparameter instrument in conjunction with
previous methods permitted vertical profiles of the
physicochemical conditions down some
boreholes. Nitrate and Fe** were recorded using
test strips in the field (Merck: respectively
Merckoquant Nitrate Test 1.0020.001 and
Merckoquant Iron Test 1.10004.0001). On
analysis, mid-point values were used if a range
had been recorded. Hydrogen sulphide was
measured, when its odour indicated its presence,
using a test kit (Chemetrics: CHEMets sulphide
R-9510, range 0-1 and 1-10 ppm).
Abbreviations used:
BES Prefix for field numbers, WAM
Biospeleology.
SAMA South Australian Museum, Adelaide.
WAM _ Western Australian Museum, Perth.
RN Prefix of water bore and well numbers,
Water Resources Division, Department
of Lands Planning and Environment in
the Northern Territory.
NTM _ Northern Territory Museum, Darwin.
SYSTEMATICS
Key to Australian species of stygobitic
Dytiscidae
1. — Body length approximately 1.0 mm;
legs stout, without swimming-hairs on
fore- and mid-legs............ Kintingka
kurutjutu. Watts and Humphreys
2(1)
3 (2)
4 (3)
5 (4)
6 (5)
7 (6)
8 (7)
9 (8)
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 137
Body length > 1.0 mm; legs normal,
all with swimming-hairs ................ 2
Parameres one-segmented; metatibia
approximately the same width
throughout; without pronotal plicae;
(Hydroporini). .......eeeceeeeeeeeeeeee 28
Parameres two-segmented; metatibia
narrow at base then strongly expanding
towards apex; usually with pronotal
Plicde: ..friiiieBiscees (Bidessini) 2
Mesofemur with spines on hind edge
approximately the same strength as
those on mesotrochanter; length >
BO IM. hier titted atiatease 23
Mesofemur with spines on hind edge
much more robust than those on
mesotrochanter; length 1.4-3.6 mm
Lacking sutural line between
abdominal sternites 1 and 2; length
BeQ=—S.OUMMN si essessseswssssonenengiesdocaa cto rtes
Tjirtudessus sweetwatersensis sp.nov.
Abdominal sternites 1 and 2 separated
by sutural line, at leastin inner portion;
length 1.3 —3.2 mM.......... eee 5
Pronotal plicae strong, well marked,
excavated on inside............0....0000. 6
Pronotal plicae weak, difficult to trace,
may be absent, not excavated on inside
shad sch h wspecewueiedeange hdvageedeazesusaaes 10
Mesosternum with posterior portion
triangular in midline ...............6 7
Mesosternum with posterior portion
rounded in midline... eee 8
Prosternal process rounded at tip; tip
of metatrochanter pointed; lobe on
apical segment of paramere short ....
sputter Ar dket Tul iutas dntenateneetess Tjirtudessus
morgani (Watts and Humphreys)
Prosternal process pointed at tip; apex
of metatrochanter rounded (Fig. 5);
lobe on apical portion of paramere
omg’ (E183) asset cesecenta-ceZapetgpveriedenotaiee
re ae Tjirtudessus bialveus sp. nov.
Head broad, deflexed; metatrochanter
round (Fig. 35); setae on mesofemur
long: (Pig 34) sien a ndeaelei
Saetstiae deepest Tjirtudessus silus sp. nov.
With none of above characters ...... 9
Metatarsi with combined length of
segments 1 and 2 > combined length
10 (5)
11 (10)
12 (11)
13 (12)
14 (13)
15 (12)
of segments 3 to 5; eye remnant present;
paramere with long apical lobe........
sheea dasle evs sabiagee Mazalgzcalsanglade es Tjirtudessus
pulpa (Watts and Humphreys)
Metatarsi with combined length of
segments | and 2 approximately equal
to combined length of segments 3 to 5
(Fig. 6); eye remnant reduced to single
short suture; paramere with small apical
lobe (Pig: 9): Sa siceeatthatacsepedttaveetae.
a, Tjirtudessus cunyuensis sp. nov.
Elytron with row of large punctures
adjacent to SUtUTE «0.0... eeeeeeeeeeee 22
Elytron without sutural punctures,
other than a few weak ones near base
sacaas'sveusalsyedansnanatgssncag tenga senadestanagone 11
Eye remnant reduced to a small oval or
triangular structure... 19
Eye remnant reduced to single short
SUTULE soiree sd eigis eon es aseae seated poezege les 12
Mesofemur with six to seven spines on
hind edge in basal half ..........0...0.. 13
Mesofemur with two to four spines on
hind edge in basal half................. 15
Protibia thick; protarsi moderately
expanded, mesotarsi less so; mesotibia
slightly angular oo... eee
Le Bidessodes gutteridgei sp. nov.
Protibia thin; protarsi and mesotarsi
approximately the same size; mesotibia
NOt ANPUTAL-. 2.4425 s5554cesveresereeevarecceees 14
Lobe of paramere as wide as rest of
apical segment, flat on top, expanded
slightly at tip 0... Tjirtudessus
masonensis (Watts and Humphreys)
Lobe of paramere shorter than rest of
apical segment, rounded on top, tip
pointed (Fig. 51) .....ececeeeeeeeeteeeee
Tjirtudessus yuinmeryensis sp. nov.
Mesofemur with four spines near base;
segments 2 and 3 of antenna similar in
length, segment 1 1 approximately 1.5x
segment 10 in length; length>2.0 mm
Shssrdapcssiatt.tontas socenstpe tees Tjirtudessus
cueensis (Watts and Humphreys)
Mesofemur with two to three strong
spines on hind edge near base; segment
2 of antenna large and oval, segment 3
much smaller and thinner than segment
2, segment 11 approaching 2x length
of segment 10; length <2 mm..... 16
138
16 (15)
17 (16)
18 (17)
19 (11)
20 (19)
21 (20)
22 (10)
CHS WATTS & WF HUMPHREYS
Mesofemur with two strong spines on
hind edge near base; apical segment of
paramere with two finger-like
Projections oe Tjirtudessus
pinnaclesensis (Watts and Humphreys)
Mesofemur with three strong spines
on hind edge near base; apical segment
of paramere with one finger-like
PFOJCCHON:.....50..5s cident 17
Metafemur with three spines grouped
together near base ..........ceceeeeeeeeees
ee Tjirtudessus fridaywellensis
(Watts and Humphreys)
Metafemur with two spines near base
and one more distant...............000. 18
Pro- and mesotibia club-shaped;
antenna with middle segments enlarged
a little on inside ........... Tjirtudessus
hinkleri (Watts and Humphreys)
Pro- and mesotibia elongate/triangular
in shape; middle segments of antenna
virtually symmetrical ..... eee
Tjirtudessus karalundiensis sp. nov.
Pronotum not constricted at base (Fig.
48); prosternal process reaching or
almost reaching mesosternum; 1.4 mm
1 (0) 1 seg ee PU aE Ie OR
.... Tjirtudessus wilunaensis sp. nov.
Pronotum moderately constricted at
base (Fig. 18); pronotal process not
reaching mesosternum; >1.8 mm long
canes stmeste eeraessaesstertacn staat: 20
Mesofemur with six spines close to
base on hind edge ........ Tjirtudessus
bigbellensis (Watts and Humphreys)
Mesofemur with three to six spines
spread out along basal half of hind
edge (Figs 16)).sclesstPssseevecds tees 21
Suture line between sternites 1 and 2
well marked; medial lobe of aedeagus
parallel-sided, apex not upturned.....
satya Segtiesseateeeev a ae tisea Tjirtudessus
challaensis (Watts and Humphreys)
Suture lines between ventrites 1 and 2
weak, usually obsolete in lateral half;
medial lobe of aedeagus distinctly
narrower in middle, apex upturned
ETS isexe ce csettss Massacre, MeeScsistesse hosts
.... Tjirtudessus jundeeensis sp. nov.
Distinct oval eye remnant present ....
AEB PN tO Ma see rh Tjirtudessus
windarraensis (Watts and Humphreys)
23:(3)
24 (23)
25 (24)
26 (25)
27 (26)
28 (27)
29 (28)
30 (29)
Eye remnant reduced to single short
SUUUL Cs sist tates ca vidieiees Tjirtudessus
lapostaae (Watts and Humphreys)
Mesofemur with spines on hind edge
arranged in two comb-like rows along
hind edge from base to apex; mesotibia
thin, curved ..............ccccccceeeeeeeeeseeeee
tetas deus B. limestoneensis sp. nov.
Mesofemur spines on hind edge spaced
out, not dense and comb-like;
mesotibia straight... 24
Pro- and mesotarsi with segment 1
much more expanded than other
SC DINCMISs, oise.4 thee h s:5: sts Mec 2
Pro- and mesotarsi with segment 1
only moderately expanded compared
to other segments ..... cee 26
Antenna with segments 8 to 11
noticeably thinner than others, segment
3 longer than segment 2...
ac eh Tere ome a foarte ea, eat Tjirtudessus
magnificus Watts and Humphreys
Antenna with segments 8 to 11 not
noticeably thinner than others, segment
3 same length as segment 2 (Fig. 30)
.. Tjirtudessus macrotarsus. sp. nov.
Pronotum a little narrower than elytra;
length 3.54.8 mM uu... eee 27
Pronotum wider than elytra; length
3.2-3.5 MM... eee Tjirtudessus
eberhardi Watts and Humphreys
Metatrochanters rounded at tip; central
lobe of aedeagus straight, tip pointed;
with smalleye remnant.... Tjirtudessus
raesideensis Watts and Humphreys
Metatrochanters pointed at tip; central
lobe of aedeagus twisted, tip knobbed;
without eye remnant .... Tjirtudessus
hahni Watts and Humphreys
From the Northern Territory ........ 29
From Western Australia ............... 33
Head short, very broad, strongly
deflexed (Fig. 96); pronotum strongly
narrowed at base (Fig. 96); pronotal
process anvil-shaped «0.0.0... cee
... Nirripirti macrocephalus sp. nov.
Head variably shaped, not deflexed,
base of pronotum variable, pronotal
process ‘normally’ shaped ........... 30
Protarsi with segment 3 not bilobed;
pronotum not constricted at base (Fig.
126); antenna thin, segments 1 and 2
31 (30)
32 (31)
33 (28)
34 (33)
35 (34)
36 (35)
37 (36)
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 139
SUBEQUAL .sssiscersscnecceiseuts dguadsssgenggedeees
ta tavters Nirripirti pentameres sp. nov.
Protarsi with segment 3 bilobed;
pronotum weakly to moderately
constricted at base; antenna thick,
segment 2 much broader than segment
1.8 mm long; body well chitinised ..
saat Nirripirti napperbyensis sp. nov.
1.2-1.6 mm long; body weakly
ChHIMINISCE a wera saudi wceisgerssetescte 32
1.2 mm long; body only slightly
constricted at junction of pronotum
and elytra (Fig. 150) oo... eee
Tin cocerere nese N. wedgeensis sp. nov.
1.5 mm long; body quite strongly
constricted at junction of pronotum
and elytra (Fig. 120)... cece
.... Nirripirti newhavenensis sp. nov.
Antenna with segment 2 larger and
more oval than segment 1; < 2.5 mm
TOMB. jusrsesstesuversepasseciesestaygenades ante 38
Antenna with segment 2 more or less
the same shape as segment | or smaller;
D> DED MM LONG ajc csp cescscaszeesecas eee 34
Elytron in ventral aspect, with visible
portion broad except close to apex ..
ee ecede ry Nirripirti stegastos sp. nov.
Elytron in ventral aspect, with visible
portion narrow except in basal quarter
gieahestat ieobnalinda fhibenlad spaced tin, colts 35
Metasternal plate parallel-sided; eight
toten metafemur spines, closely placed,
very strong (Fig. 76); metatrochanter
long and thin about 4x as long as wide
CE TD) asics tous ecedennnsttnceeeaageReseses nds
Metasternal plate narrowing towards
rear; four to eight metafemur spines,
weak to moderately strong;
metatrochanter moderately elongate 2
to 2.5x as long as wide ................ 36
Metasternal plate without wings ......
wrteed Nirripirti plutonicensis sp. nov.
Metasternal wings obvious but short
Ssgtacsssqc0egsVogedan tary drenhecgiaptacsepaesbasncey 37
Metafemur with moderately strong
spines; metacoxal plate nearly reaching
MESOCOXAE ....seesceeseeseeeees Nirripirti
hinzeae Watts and Humphreys
— Metafemur with thin spines (Fig. 70);
metacoxal plate at least the width of
metafemur from mesocoxae.............
38 (33) — Elytron with shoulder flared outwards
(Fig. 84); tip of metatrochanter pointed
(Fig. 83).....Nirripirti hamoni sp. nov.
— Elytron with shoulder not flared;
metatrochanter squat, tip rounded
(Fig Oi Nic ect fostscat satin dtesreceettat. 39
39 (38) — Eye remnant absent; metatrochanters
large, squat (Fig. 107); hind legs stout;
metasternal plate V-shaped; 1.2 mm
LOMPR.Sielededseranlssdancersaannencagdeteveregegiiass
alee Nirridessus milgunensis sp. nov.
— Eye remnant represented by a short
suture at side of head; metatrochanters
elongate; hind legs elongate;
metasternal plate U-shaped; 1.5-
P1100 (6) 1a en 40
40 (39) — Head narrower than base of pronotum,
body boat-shaped (Fig. 138) ........ 41
— Head broader than base of pronotum,
body not boat-shaped (Fig. 102) ......
spines Nirripirti melroseensis sp. nov.
41 (40) — 2.1-2.3 mmlong; metatrochanter with
tip sharply pointed (Fig. 137) ..........
stgpasatades Nirripirti skaphites sp. nov.
— 1.5—1.9 mmlong; metatrochanter with
tip rounded (Fig. 89) ........ cece
yal Nirripirti killaraensis sp. nov.
The following species descriptions are grouped
in alphabetical order under genus, which are
placed in the order Tjirtudessus, Bidessodes,
Nirripirti.
Tjirtudessus Watts & Humphreys, 1999
Tjirtudessus bialveus sp. nov.
Types
Holotype: m: ‘BES 8118, Cunyu Station, Site
289, mineral exploration bore, 25°46'51"S
120°06'27"E, 24/8/2001, coll. W.F. Humphreys,
T. Karanovic & J.M. Waldock’, WAM. 32866.
Slide mounted.
Paratypes: 17; 9, as for holotype, 6 WAM
32867-32872, 3 SAMA; 3, as for holotype
except ‘BES 8115’, SAMA; 2, as for holotype
except ‘BES 8601, site 288’, WAM 32873-
32874; 3, as for holotype except ‘BES 8602, site
288’, SAMA.
140
Description (number examined, 18) Figs 1-7
Habitus. Length 1.4-1.9 mm; elongate,
relatively flat, weakly constricted at junction of
pronotum/elytra; uniformly light testaceous;
hindwing vestigial, about one-quarter length of
elytron.
Head. A little narrower than elytra; smooth,
reticulation strong, punctures sparse, very small;
subparallel in posterior half, widest just behind
eye remnant; eye remnant reduced to short dark
suture. Antenna stout, basal segment cylindrical,
segment 2 oval, segment 3 shorter and narrower
and narrowing towards base, segments 4 to 10
subequal, segment 11 about twice as long as
segment 10. Maxillary palpus relatively stout,
segment 4 about as long as segments 1 to 3
combined, oblique row of long setae on outer
side, tip truncated.
Pronotum. Almost as wide as elytra;
anteriolateral angles projecting strongly forward;
cS
‘Se
SSE
4 HAR
CHS WATTS & WF HUMPHREYS
base quite strongly narrowed, posterolateral angles
acute; smooth, with sparse, very weak punctures
and a row of stronger punctures along front
margin; basal plicae strongly marked, curved,
reaching to about halfway along pronotum, deeply
excavated inwards; with row of long setae
laterally, denser towards front.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, widest behind middle,
smooth, strongly reticulate, evenly but sparsely
covered with small punctures each with a small
seta, row of widely spaced larger punctures close
to inner edge; row of long setae near lateral edge,
a few additional larger punctures with long setae,
more frequent towards sides; underside of elytron
with a few setiferous micropunctures towards
apex and sides. Epipleuron undifferentiated, that
part of elytron visible ventrally broad in anterior
fifth, then rapidly narrowing to be virtually absent
along rest of elytron.
()
4
0
*
FIGURES 1-6. Tjirtudessus bialveus: 1, lateral view of central lobe of aedeagus; 2, ditto dorsal view; 3, paramere;
4, mesotrochanter and mesofemur; 5 metatrochanter and metafemur; 6, dorsal view. Scale bar represents 1 mm
(habitus only).
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 14]
Ventral surface. Prosternal process relatively
broad, strongly narrowed between coxae, almost
reaching mesothorax, apical half narrow, almost
parallel-sided, tip with long elongate point,
strongly arched in lateral view with highest point
(viewed ventrally) between coxae. Mesocoxae
almost in contact at midline. Metasternum sharply
triangular in front in midline; wings short, narrow;
triangular in midline behind not reaching halfway
to metacoxae. Metacoxal plates large, metacoxal
lines weak, moderately widely spaced, reaching to
about halfway to metasternum, evenly diverging;
a few small setae-bearing punctures towards
midline; closely adpressed to first abdominal
ventrite. Ventrites 1 and 2 fused, sutural lines
distinct, ventrites 3 to 5 mobile, sparsely covered
with small seta-bearing punctures, ventrites 3 and
4 with a long central seta or bunch of long setae;
strongly reticulate.
Legs. Protibia relatively broad, inner edge
straight, outer edge bowed, widest near apex
where it is about four times its basal width;
protarsi moderately expanded, segment 1 round,
segment 2 shorter, segment 3 as long as 1 but a
bit narrower and deeply bifid, segment 4 very
small and hidden within lobes of segment 3,
segment 5 narrow, cylindrical, about 1.5 times
length of segment 3, segments 1 to 3 with
covering of adhesive setae; claws short and
simple. Mesotrochanter elongate with row of setae
on inner edge; mesofemur with two spines close
together at base and one more distant along hind
edge in basal half (Fig. 4); mesotarsi much less
expanded than protarsi. Metatrochanter elongate,
tip rounded, well separated from femur (Fig. 5);
metafemur elongate, lacking spines; metatibia
curved, widening towards apex; metatarsi
elongate, segment 1 longest, segment 5 longer
than 4, segments 1 and 2 in combination about as
long as segments 3 to 5; claws weak.
Male. Pro- and mesotarsi slightly stouter.
Median lobe of aedeagus narrow, tip bluntly
pointed; paramere broad, apical segment with
long, narrow, apical portion well separated from
rest of segment (Figs 1-3).
Etymology
Latin. ‘Bi’ — two, ‘alveus’ — pit, excavation;
alluding to the two very strongly excavated areas
on the pronotum.
Remarks
A relatively small species with strong reticulation
and deep excavations inwards from the pronotal
plicae. These pits partially undercut the plicae and
on their inner edge are ridged for a short distance.
The purpose of these structures—which are much
deeper than we have seen on any other Dytiscid—
are unknown. They do not seem to have any
sensory structures associated with them. They are
often partially filled with a gritty material.
Tjirtudessus cunyuensis sp. nov.
Types
Holotype: m. ‘BES 8156, Cunyu Station,
Sweetwaters Well, 25°35'28"S 120°22'21"E, 23/
8/2001, col. W.F. Humphreys, T. Karanovic &
J.M. Waldock’, WAM 32875.
Paratypes 3: 1, as for holotype, WAM 32876;
2, as for holotype except ‘8107’, SAMA.
Description (number examined, 4) Figs 7-12
Habitus. Length 1.3 mm; narrowly oval,
relatively flat, weakly constricted at junction of
pronotum/elytra; uniformly light testaceous;
hindwing vestigial, about one-half length of
elytron.
Head. Much narrower than elytra; smooth,
reticulation strong, punctures sparse, very small;
subparallel in posterior half, widest just behind
eye remnant; eye remnant reduced to a short
suture. Antenna stout, basal segment cylindrical,
segment 2 oval, segment 3 smaller and narrower,
segment 4 slightly smaller than 3, segments 5 to
10 subequal, segment 11 about 1.5 times length of
segment 10. Maxillary palpus stout, segment 4
about as long as segments 1 to 3 combined,
oblique row of long setae on outer side, tip
truncated.
Pronotum. As wide as elytra; anteriolateral
angles projecting strongly forward; base
moderately narrowed, posterolateral angles
obtuse; smooth, with sparse, very weak punctures
each with a short seta and a row of stronger
punctures along front margin; basal plicae
moderately marked, slightly curved, reaching to
about halfway along pronotum, quite strongly
excavated inwards; with row of long setae
laterally, denser towards front.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, widest behind middle,
smooth, moderately covered with small punctures
each with a short setae, a short row of larger
punctures close to inner edge on disc; a few
additional larger punctures with long setae, more
frequent towards sides; underside of elytron with
numerous setiferous micropunctures towards apex
and near suture. Epipleuron undifferentiated, that
142 CHS WATTS & WF HUMPHREYS
part of elytron visible ventrally narrow except
close to base.
Ventral surface. Prosternal process relatively
broad, strongly narrowed between coxae, not
reaching mesothorax, apical half narrow, almost
parallel-sided, weakly pointed at apex, strongly
arched in lateral view with highest point (viewed
ventrally) between coxae. Mesocoxae in contact at
midline. Metasternum sharply triangular in front
in midline; wings very narrow; broadly rounded
in midline behind; not quite reaching halfway to
metacoxae. Metacoxal plates large, metacoxal
lines weak, widely spaced, almost parallel,
reaching nearly to metasternum; a few small setae-
bearing punctures towards midline; reticulation
moderate, meshes uneven; closely adpressed to
first abdominal ventrite. Ventrites 1 and 2 fused,
sutural lines distinct, ventrites 3 to 5 mobile,
sparsely covered with small seta-bearing
punctures, ventrites 3 and 4 with a long central
seta or bunch of long setae.
Legs. Protibia relatively broad, inner and outer
edges straight, widest past apex where it is about
four times its basal width; protarsi expanded,
segment | broad, segment 2 as broad as and about
one-third length of segment 1, segment 3 as long
as 1 and as broad, very deeply bifid, segment 4
very small and hidden within lobes of segment 3,
segment 5 narrow, cylindrical, about length of
segment 3, segments 1 to 3 with covering of
adhesive setae; claws short and simple.
Mesotrochanter elongate with row of setae on
inner edge; mesofemur with row of four to five
relatively weak spines unevenly spaced along hind
edge in basal half (Fig. 10); mesotarsi less
expanded than protarsi. Metatrochanter tip
pointed, weakly separated from femur at tip (Fig.
11); metafemur relatively broad, lacking spines;
metatibia strongly curved, widening towards apex;
metatarsi elongate, segment 1 longest, segment 5
longer than segment 4, segments 1 and 2 in
combination about as long as others; claws weak.
Male. Median lobe of aedeagus relatively broad,
tip sharply pointed; paramere broad, apical
segment narrow, apical portion well separated
from rest of segment (Figs 7-9).
.
Qn
i)
YQ
WS
4. Hanon
\\
\\
—_
Nh
FIGURES 7-12. Tjirtudessus cunyuensis: 7, lateral view of central lobe of aedeagus; 8, ditto dorsal view; 9,
paramere; 10, mesotrochanter and mesofemur; 11 metatrochanter and metafemur; 12, dorsal view. Scale bar
represents 1 mm (habitus only).
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 143
Etymology
Named after the pastoral station on which it was
collected.
Remarks
A relatively small species with stout antennae
and legs and well-marked pronotal plicae.
Resembles 7. pulpa, from which it differs in lack
of oval eye remnant and short apical lobe to the
paramere.
Tjirtudessus jundeeensis sp. nov.
Types
Holotype: m. “BES 6475, Jundee Station, bore
at Jundee Homestead, 26°21'12"S; 120°38'31"E,
11/5/2001, col. W.F. Humphreys, C.H.S. Watts &
S. Cooper’, WAM 32877. Slide mounted.
Paratypes: 27; 1, as for holotype, WAM 32878;
17, ‘BES 6581, Jundee Station. bore JSP 6, South
Hill Well BF, Jundee Mine, 26°16'58"S
120°40'37"E, 11/5/2001, col. W.F. Humphreys,
C.H.S. Watts & S. Cooper’, 2 WAM 32879-
32880, 15 SAMA; 1, as for holotype except ‘BES
6582’ and ‘JE149’, WAM 32881; 1, as for
holotype except ‘BES 6590’ and ‘JE124’, WAM
32882; 3, as for holotype except ‘BES 6594’ and
‘JE112’, 3 WAM 32883-32885; 3, as for holotype
except ‘BES 6597’ and ‘JE150’, 2 WAM 32886-
32887, 1 SAMA; 2, as for holotype except “BES
6603’ and ‘JE125’, WAM 32888-32889.
Description (number examined, 28) Figs 13-18
Habitus. Length 2.3-2.6 mm; relatively flat,
moderately constricted at base of pronotum;
uniformly very light testaceous; hindwing
reduced, about three-quarters length of elytron.
Head. Narrower than elytra; smooth,
reticulation very weak, punctures sparse, very
small; subparallel in posterior half, widest just
behind eye remnant; eye remnant reduced to
narrowly oval structure. Antenna relatively stout,
segments 1 and 2 cylindrical, segment 3 slightly
shorter than segment 2 narrowing towards base,
segments 4 to 10 subequal but becoming
progressively slightly broader, segment 11 1.5
times longer and slightly thinner than segment 10.
Maxillary palpus moderately elongate, segment 4
a little shorter than segments 1 to 3 combined,
oblique row of long setae on outer side, tip
truncated.
Pronotum. As wide as elytra; anteriolateral
angles projecting strongly forward; base quite
strongly narrowed, posterolateral angles acute;
smooth with sparse, very weak punctures and a
row of stronger punctures along front margin;
basal plicae weakly marked, converging slightly
towards front, reaching to about halfway along
pronotum; with row of long setae laterally, denser
towards front.
Elytra. Not fused, lacking inner ridges;
elongate, almost parallel-sided, smooth, sparsely
covered with very small punctures; row of long
setae near lateral edge, a few additional larger
punctures with long setae, more frequent towards
sides; underside with a few scattered setiferous
micropunctures towards apex. Epipleuron weakly
differentiated, that part of elytron visible ventrally
moderately broad in anterior fifth, thin over rest
of elytron.
Ventral surface. Prosternal process strongly
narrowed between coxae, not reaching
mesothorax, apical half relatively broad, almost
parallel-sided, strongly arched in lateral view with
highest point (viewed ventrally) between coxae.
Mesocoxae in contact at midline. Metasternum
bluntly triangular in front in midline; wings very
narrow; broadly rounded in midline behind.
Metacoxal plates large, metacoxal lines obsolete;
a few small setae-bearing punctures towards
midline; closely adpressed to first abdominal
ventrite. Ventrites 1 and 2 fused, sutural lines
distinct towards midline, becoming indistinct
laterally, ventrites 3 to 5 mobile, sparsely covered
with small seta-bearing punctures, ventrites 3 and
4 with a long central seta or bunch of long setae.
Legs. Protibia relatively narrow, triangular,
widest at apex where it is about 2.5 times its basal
width; protarsi moderately expanded, segment 1
as wide as long, segment 2 about as wide and
about one-half length of segment 1, segment 3 as
long and wide as first, very deeply bifid, segment
4 very small and hidden within lobes of segment
3, segment 5 narrow, cylindrical, about length of
segment 3, segments 1 to 3 with very dense
covering of adhesive setae; claws one-half length
of segment 5. Mesotrochanter elongate with a few
fine setae on inner edge; mesofemur with row of
five to six moderately strong setae along hind
edge in basal half (Fig. 16); mesotarsi similar to
protarsi. Metatrochanter tip rounded, well
separated from metafemur (Fig. 17); metafemur
thin, elongate, lacking spines; metatibia thin,
strongly curved, widening towards apex; metatarsi
elongate, segment 1 longest, segment 5 longer
than segment 4, in combination segments | and 2
about as long as others; claws equal, weak.
Male. Little external difference between median
144 CHS WATTS & WF HUMPHREYS
FIGURES 13-18. Tjirtudessus jundeeensis: 13, lateral view of central lobe of aedeagus; 14, ditto dorsal view; 15,
paramere; 16, mesotrochanter and mesofemur; 17 metatrochanter and metafemur; 18, dorsal view. Scale bar
represents 1 mm (habitus only).
lobe of aedeagus varying slightly in width along
shaft, narrowing towards apex, bluntly pointed;
parameres broad, apical segment relatively broad,
short, with long, narrow, apical lobe well
separated from rest of segment (Figs 13-15).
Etymology
Named after the pastoral station on which it
was collected.
Remarks
A moderate sized, narrowly elongate, weakly
chitinised species with the tip of the
metatrochanter well separated from the femur, and
weak pronotal plicae. Morphologically close to T.
challaensis but with the suture line between first
and second ventrites much less obvious and the
apical lobe of the paramere well separated from
the rest of the segment.
Tjirtudessus karalundiensis sp. nov.
Types
Holotype: m: ‘Karalundi, unlined well, 26°08'S
118°41'E, 28/5/2001. Col. C.H.S.& G.A Watts’.
Field number 339-1. WAM 32890. Slide
mounted.
Paratypes: 14, as for holotype 5, WAM 32891-
32895, 9 SAMA.
Description (number examined, 15) Figs 19-
24.
Habitus. Length 1.3-1.4 mm; relatively flat,
moderately constricted at junction of pronotum/
elytra; elytra relatively broad, uniformly light
testaceous; hindwing reduced, about length of
elytron.
Head. Narrower than elytra; smooth,
reticulation moderate, punctures sparse, very
small; subparallel in posterior half, widest just
behind eye remnant; eye remnant reduced to short
suture. Antenna relatively stout, segment 1
cylindrical, segment 2 oval, segment 3 about one-
half length segment 2 and two-thirds width,
narrowing towards base, segment 4 bit shorter and
narrower than segment 3, segments 5 to 10
subequal and a little wider than 3 and 4, segment
11 about twice length of segment 10. Maxillary
palpus elongate, segment 4 a little shorter than
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 145
segments 1 to 3 combined, oblique row of long
setae on outer side, tip truncated.
Pronotum. Narrower than elytra; anteriolateral
angles projecting strongly forward; base
moderately constricted, posterolateral angles
acute; smooth, moderately reticulate, with sparse,
very weak punctures and a row of stronger
punctures along front margin, sparse covering of
short setae; basal plicae absent, straight; with row
of long setae laterally, denser towards front.
Elytra. Not fused, lacking inner ridges; oval,
widest in middle, smooth, moderately reticulate,
moderately densely covered with short setae,
sparsely covered with very small punctures, row
of widely spaced larger punctures close to inner
edge; row of long setae near lateral edge, a few
additional larger punctures with long setae, more
frequent towards sides; underside of elytron with
numerous setiferous micropunctures towards
apex. Epipleuron only weakly differentiated; that
portion of elytron visible ventrally narrow in
anterior fifth, virtually absent along rest of
elytron.
Ventral surface. Prosternal process strongly
narrowed between coxae, not reaching
mesothorax, apical half relatively broad, almost
23 SD
parallel-sided, strongly arched in lateral view with
highest point (viewed ventrally) between coxae.
Mesocoxae in contact at midline. Metasternum
bluntly triangular in front in midline; wings very
narrow; posterior portion relatively narrow,
rounded at apex. Metacoxal plates large, heart-
shaped in combination, metacoxal lines absent,
surface reticulate, a few small setae-bearing
punctures towards midline; closely adpressed to
abdominal ventrite 1. Ventrites 1 and 2 fused,
sutural lines distinct, ventrites 3 to 5 mobile,
moderately rugose, sparsely covered with small
seta-bearing punctures, ventrites 3 and 4 with a
long central seta or bunch of long setae.
Legs. Protibia triangular, widest at apex where
it is about three times its basal width; protarsi
moderately expanded, segment 1 about twice as
long as wide, segment 2 a little broader and about
one-half length of segment 1, segment 3 as long
as first slightly broader, very deeply bifid, segment
4 very small and hidden within lobes of segment
3, segment 5 narrow, cylindrical, about twice
length of segment 3, segments 1 to 3 with
adhesive setae; claws short and simple.
Mesotrochanter elongate with a few setae on inner
edge; mesofemur with row of three relatively
i> SS
ps _/ Wa
Fy CR
| |
IN \*
NN ZeaN
K F\
24 IR ZA
FIGURES 19-24. Tjirtudessus karalundiensis: 19, lateral view of central lobe of aedeagus; 20, ditto dorsal view;
21, paramere; 22, mesotrochanter and mesofemur; 23 metatrochanter and metafemur; 24, dorsal view. Scale bar
represents | mm (habitus only).
146
strong setae along hind edge in basal half (Fig.
22); mesotarsi about one-half breadth of protarsi.
Metatrochanter tip pointed, (Fig. 23); metafemur
elongate, lacking spines; metatibia moderately
curved, widening towards apex; metatarsi
elongate, segment 1 longest, other segments
approximately equal in length, in combination
segments 1 and 2 about as long as others; claws
weak.
Male. No external differences between the
sexes. Median lobe of aedeagus parallel-sided
narrowing towards apex, tip bluntly pointed;
paramere broad, apical segment relatively long,
with narrow apical lobe moderately separated
from rest of segment, about one-half width of
segment (Figs 19-21).
Etymology
Named after type locality.
Remarks
A small elongate/oval species moderately
constricted at the base of the pronotum and with
three stout spines on the mesofemur. It most
closely resembles T. hinkleri, from which it is
most easily separated by the smaller apical lobe
on the paramere and the symmetrical rather than
slightly asymmetrical middle antennal segments.
Tjirtudessus macrotarsus sp. nov.
Types
Holotype: m: ‘BES 8118, Cunyu Station, Site
289, mineral exploration bore, 25°46'51"S
120°06'27"E, 24/8/2001 col. W.F. Humphreys, T.
Karanovic & J.M. Waldock’, WAM 32896. Slide
mounted.
Paratypes: 7: 5, as for holotype, 3 WAM
32897-32899, 2 SAMA; 2, as for holytype except
‘BES 8115’ SAMA.
Description (number examined, 8) Figs 25-30
Habitus. Length 4.2-4.4 mm; elongate,
relatively flat, slightly depressed in midline,
moderately constricted at junction of pronotum/
elytra; uniformly light testaceous; hindwing
vestigial, about one-half length of elytron.
Head. A little narrower than elytra; slightly
deflexed; smooth, reticulation weak, punctures
sparse, very small; subparallel in posterior half,
widest just behind eye remnant; eye remnant
reduced to a short suture. Antenna thin, segments
1 and 2 cylindrical, segments 3 and 4 as long as
segment 2 but narrower and slightly narrowing
towards base, segments 5 to 9 subequal but
CHS WATTS & WF HUMPHREYS
becoming progressively shorter, each weakly
expanded inwards near apex, segment 10
cylindrical, segment 11 about 1.5 times as long as
segment 10. Maxillary palpus elongate, segment 4
a little shorter than segments 1 to 3 combined,
oblique row of long setae on outer side, tip
truncated.
Pronotum. Short, almost as wide as elytra;
anteriolateral angles projecting strongly forward;
base quite strongly narrowed, posterolateral angles
acute, overlapping elytra; smooth, with sparse,
very weak punctures and a row of stronger
punctures along front margin, reticulation weak;
basal plicae moderately marked, straight, short,
reaching to about one-third way along pronotum,
slightly excavated inwards; with row of long setae
laterally, denser towards front.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, widest behind middle,
smooth, sparsely covered with very small
punctures, a loose row of larger punctures with
long setae near centre of each elytron, a moderate
number of additional large punctures with long
setae, more frequent towards sides. Underside of
elytron with a few setiferous micropunctures near
base and some on epipleuron near base.
Epipleuron very weakly differentiated, that part of
elytron visible ventrally broad in anterior fifth,
then rapidly narrowing to be virtually absent along
rest of elytron.
Ventral surface. Prosternal process relatively
broad, strongly narrowed between coxae, not
reaching mesothorax, apical half broad, triangular,
strongly arched in lateral view with highest point
(viewed ventrally) between coxae. Mesocoxae in
contact at midline. Metasternum triangular in front
in midline; wings very narrow; broadly rounded
in midline behind; reaching well past halfway to
metacoxae. Metacoxal plates large, metacoxal
lines very weak, relatively close, reaching to about
halfway to metasternum, evenly diverging; a few
small setae-bearing punctures towards midline;
closely adpressed to first abdominal ventrite.
Ventrites 1 and 2 fused, sutural lines distinct
towards midline, becoming indistinct laterally,
ventrites 3 to 5 mobile, sparsely covered with
small seta-bearing punctures, ventrites 3 and 4
with a long central seta or bunch of long setae;
reticulation very weak.
Legs. Protibia relatively narrow, inner edge
straight, outer edge bowed, widest past middle
where it is about three times its basal width;
protarsi expanded, segment 1 large broadly
rounded, segment 2 much narrower, about one-
third length of segment 1, segment 3 about half
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 147
25 26
cA
28
ae
FIGURES 25-30. Tjirtudessus macrotarsus: 25, lateral view of central lobe of aedeagus; 26, ditto dorsal view; 27,
paramere; 28, mesotrochanter and mesofemur; 29 metatrochanter and metafemur; 30, dorsal view. Scale bar
represents | mm (habitus only).
as long as segment 1, narrower than segment 2,
very deeply bifid, segment 4 very small and
hidden within lobes of segment 3, segment 5
narrow, cylindrical, about length of segment 3,
segments 1 to 3 with dense covering of adhesive
setae; claws short, relatively robust.
Mesotrochanter elongate with row of setae on
inner edge; mesofemur with row of 10 to 15
weak spines along hind edge in basal half only
slightly stronger than the setae on
mesotrochanter (Fig. 28); mesotarsi a little less
expanded than protarsi. Metatrochanter relatively
small, broadly oval, tip rounded (Fig. 29);
metafemur thin, lacking spines; metatibia
strongly curved, widening towards apex;
metatarsi elongate, segment 1 longest, segment 5
much longer than segment 4, segments 1 and 2
in combination about as long as others; claws
weak.
Male. No external differences between the
sexes. Median lobe of aedeagus variable in width
along shaft, tip bluntly pointed; paramere broad,
apical segment relatively large with long, narrow,
apical lobe moderately separated from rest of
segment (Figs 25—27).
Etymology
Alluding to the large basal tarsal segment of the
pro- and mesotarsi.
Remarks
A large narrow species recognised by the large
basal segment of the pro- and mesotarsi, thin
antenna and broadly oval metatrochanters.
Tjirtudessus silus sp. nov.
Types
Holotype: m: ‘BES 8107, Cunyu Station,
Sweetwaters Well, 25°35'38"S 120°22'21"E, 23/
8/2001, col. W.F. Humphreys, T. Karanovic &
J.M. Waldock’, WAM 32900. Slide mounted.
Paratypes: 25; 10, ‘BES 8107, Cunyu Station,
Sweetwaters Well, 25°35'38"S 120°22'21"E, 23/
8/2001, col. W.F. Humphreys, T. Karanovic &
148 CHS WATTS & WF HUMPHREYS
J.M. Waldock’, 5 WAM 32901-32905, 5
SAMA; 4, ditto except ‘BES 8156’, WAM
32906-32909; 11, ditto except ‘BES 8589’, 5
WAM 32910-32914, 6 SAMA.
Description (number examined, 26) Figs 31-36
Habitus. Length 1.7-2.1 mm; relatively flat,
head somewhat deflexed, weakly constricted at
junction of pronotum/elytra; uniformly very light
testaceous; hindwing vestigial, about one-third
length of elytron.
Head. Short, about as wide as elytra, bulbous in
lateral view; smooth, reticulation moderate,
punctures sparse, very small; subparallel in
posterior half, widest just behind eye remnant; eye
remnant reduced to small triangular or oval
structure on ventral surface near edge. Antenna
relatively stout, segments 1 and 2 cylindrical,
segment 3 shorter than segment 2, segments 4 to
10 subequal, slightly expanded at their apexes on
inside, more so on middle segments, segment 11 a
SMamond
oOo
bit longer and narrower than segment 10.
Maxillary palpus elongate, segment 4 longer than
segments 1 to 3 combined, oblique row of long
setae on outer side.
Pronotum. Short, as wide as or a bit wider than
elytra; anteriolateral angles projecting strongly
forward; base weakly constricted, posterolateral
angles obtuse; smooth, with sparse, very weak
punctures and a row of stronger punctures along
front margin; reticulation very weak; basal plicae
well marked, slightly sinuate, reaching to about
halfway along pronotum, very strongly excavated
inwards; with row of long setae laterally, denser
towards front.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, widest behind middle,
smooth, sparsely covered with very small
punctures; row of long setae near lateral edge, a
few additional larger punctures with long setae,
more frequent towards sides, underside of elytron
with a few setiferous micropunctures towards
FIGURES 31-36. Tjirtudessus silus: 31, lateral view of central lobe of aedeagus; 32, ditto dorsal view; 33,
paramere; 34, mesotrochanter and mesofemur; 35, metatrochanter and metafemur; 36, dorsal view. Scale bar
represents | mm (habitus only).
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS
apex and on epipleuron near base. Reticulation
weak. Epipleuron undifferentiated, that portion of
elytron visible ventrally broad in anterior fifth,
then rapidly narrowing to be virtually absent along
rest of elytron.
Ventral surface. Prosternal process relatively
broad, strongly narrowed between coxae, not
reaching mesothorax, apical half narrow, weakly
triangular, tip rounded, strongly arched in lateral
view with highest point (viewed ventrally)
between coxae. Mesocoxae in contact at midline.
Metasternum bluntly triangular in front in midline;
wings very narrow; broadly rounded in midline
behind. Metacoxal plates large, metacoxal lines
weak, moderately widely spaced, reaching about
halfway to metasternum, subparallel; a few small
setae-bearing punctures towards midline; closely
adpressed to first abdominal ventrite. First and
second ventrites fused, sutural lines indistinct
towards midline, absent laterally, ventrites 3 to 5
mobile, sparsely covered with small seta-bearing
punctures, ventrites 3 and 4 with a long central
seta or bunch of long setae; weakly reticulate.
Legs. Protibia elongate, narrow, inner edge
straight, outer edge weakly bowed, widest near
apex where it is about three times its basal width;
protarsi moderately expanded, segment 1 rounded,
segment 2 about one-half length of segment 1,
segment 3 as long as segment 1 and very deeply
bifid, segment 4 very small and hidden within
lobes of segment 3, segment 5 narrow, cylindrical,
about length of segment 3, segments | to 3 with
dense covering of adhesive setae; claws short and
simple. Mesotrochanter elongate with row of setae
on inner edge; mesofemur with row of five to six
relatively long spines along hind edge in basal
half (Fig. 34); mesotarsi much less expanded than
protarsi. Metatrochanter short (Fig. 35);
metafemur thin, lacking spines; metatibia strongly
curved, widening towards apex; metatarsi
elongate, relatively robust, segment 1 longest,
segment 5 a little longer than segment 4, segments
1 and 2 in combination about as long as others;
claws weak.
Male. Little external difference between the
sexes. Median lobe of aedeagus variable in width
along shaft, tip bluntly pointed; paramere broad,
apical segment with long, narrow, apical portion
well separated from rest of segment (Figs 31-33).
Etymology
Latin. ‘Silus’ — pug-nosed.
Remarks
A medium sized species easily recognised by its
149
broad pug-nosed head as well as thin legs, round
metatrochanters, strong pronotal plicae and long
spines on the mesofemurs.
Tjirtudessus sweetwatersensis sp. nov.
Types
Holotype: m: ‘BES 8107, Cunyu Station,
Sweetwaters Well, 25°35'38"S 120°22'21"E, 23/
8/2001, col. W.F. Humphreys, T. Karanovic and
J.M. Waldock’, WAM 32915. Slide mounted.
Paratypes: 11; 6, as for holotype, SAMA; 2, as
for holotype except ‘BES 8156’, WAM 32916-
32917; 3, as for holotype except ‘BES 8589’,
WAM 32918-32920.
Description (number examined, 12) Figs 37-42
Habitus. Length 3.2-3.6 mm; elongate,
relatively flat, moderately constricted at junction
of pronotum/elytra; uniformly light testaceous;
hindwing vestigial, about one-half length of
elytron.
Head. About as wide as elytra; smooth,
reticulation moderate, punctures sparse, very
small; subparallel in posterior half, widest just
behind eye remnant; eye remnant reduced to
narrowly oval structure on underside of head
behind antennal bases. Antenna relatively stout,
segments 1 and 2 cylindrical, segments 3 and 4
similar, a little shorter than segment 2, segments 5
to 10 subequal, narrower at their bases, segment
11 a bit longer and narrower than segment 10.
Maxillary palpus elongate, segment 4 a little
shorter than segments 1 to 3 combined, oblique
row of long setae on outer side, tip truncated.
Pronotum. As wide as elytra; anteriolateral
angles projecting strongly forward: base quite
strongly narrowed, posterolateral angles acute,
slightly overlapping elytra; smooth, with sparse,
very weak punctures and a row of stronger
punctures along front margin; basal plicae
moderately marked, slanted inwards, reaching to
about halfway along pronotum, with row of long
setae laterally, denser towards front.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, widest behind middle,
smooth, sparsely covered with very small
punctures, row of widely spaced larger punctures
close to inner edge; row of long setae near lateral
edge, a few additional larger punctures with long
setae, more frequent towards sides; underside of
elytron with numerous setiferous micropunctures
towards apex and near suture. Epipleuron
undifferentiated, that part of elytron visible
150
4 Mama,
37 38 39
ae:
CHS WATTS & WF HUMPHREYS
mie
A
Be
GR | =
O|\a
Al
Yi
Y!
FIGURES 37-42. Tjirtudessus sweetwatersensis: 37, lateral view of central lobe of aedeagus; 38, ditto dorsal view;
39, paramere; 40, mesotrochanter and mesofemur; 41, metatrochanter and metafemur; 42, dorsal view. Scale bar
represents 1 mm (habitus only).
ventrally quite broad in anterior quarter, virtually
absent along rest of elytra.
Ventral surface. Prosternal process rather
narrow, strongly narrowed between coxae, not
reaching mesothorax, apical half almost parallel-
sided, strongly arched in lateral view with highest
point (viewed ventrally) between coxae.
Mesocoxae in contact at midline. Metasternum
triangular in front in midline; wings very narrow;
broadly rounded in midline behind. Metacoxal
plates large, metacoxal lines weak, moderately
widely spaced, reaching to about halfway to
metasternum, almost parallel; a few small setae-
bearing punctures towards midline; closely
adpressed to first abdominal ventrite. Ventrites 1
and 2 fused, sutural lines absent, ventrites 3 to 5
mobile, sparsely covered with small seta-bearing
punctures, ventrites 3 and 4 with a long central
seta or bunch of long setae; moderately reticulate.
Legs. Protibia relatively elongate, inner edge
straight, outer edge bowed, widest past middle
where it is about three times its basal width;
protarsi weakly expanded, segment 1 broad,
segment 2 about one-third length of segment 1,
segment 3 a little longer than segment 2 and
deeply bifid, segment 4 very small and hidden
within lobes of segment 3, segment 5 narrow,
cylindrical, about twice length of segment 3,
segments 1 to 3 with covering of adhesive setae;
claws short and simple. Mesotrochanter elongate
with row of setae on inner edge; mesofemur with
row of seven to nine relatively weak spines along
hind edge in basal half (Fig. 40); mesotarsi a little
less expanded than protarsi. Metatrochanter tip
bluntly pointed (Fig. 41); metafemur elongate,
lacking spines; metatibia strongly curved,
widening towards apex; metatarsi elongate,
segment 1 longest, segment 5 a little longer than
segment 4, segments 1 and 2 in combination about
as long as others; claws weak.
Male. No external differences between the
sexes. Median lobe of aedeagus a little variable in
width along shaft, tip bluntly pointed; paramere
broad, apical segment relatively short, with long,
narrow, apical portion close to rest of segment
(Figs 37-39).
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 151
Etymology
Named after the type locality.
Remarks
A relatively large species recognised by the lack
of a sutural line between the first and second
ventrites, the similarity of the basal two antennal
segments and a relatively large oval eye remnant.
Tjirtudessus wilunaensis sp. nov.
Types
Holotype: m: ‘BES 6433, Wiluna Gold, Lake
Violet Borefield bore XPIOB, 26°40'30"S
120°13'S5"E, 9/5/200, col. W.F. Humphreys,
C.H.S. Watts & S. Cooper’. WAM 32921. Slide
mounted.
Paratype: 1, ‘BES 5640, Millbillillie Pastoral
station. Bore nr. Bubble Well, 26°33'39"S
120°02'27"E, 8/5/2001 coll. W.F. Humphreys,
C.H.S. Watts & S. Cooper’, SAMA. There is
some doubt regarding this locality: the field notes
suggest that it could have come from the same
locality as the holotype.
Description (number examined, 2) Figs 43-48
Habitus. Length 1.4 mm; relatively flat, very
weakly constricted at junction of pronotum/elytra;
uniformly light testaceous; hindwing reduced,
about three-quarters length of elytron.
Head. Slightly narrower than elytra; smooth,
reticulation weak, punctures sparse, very small;
subparallel in posterior half, bulging just behind
eye remnant; eye remnant reduced to a small
triangular structure. Antenna stout, segment 1
large, cylindrical, segment 2 larger, barrel-shaped,
segment 3 a bit shorter, about one-half as wide as
long narrowing towards base, segment 4 bit
narrower and one-half the length of segment 3,
segments 5 to 10 subequal, segment 11 twice
length of segment 10, thinner. Maxillary palpus
stout, segment 4 a little shorter than segments 1 to
3 combined, oblique row of long setae on outer
side, tip truncated.
Pronotum. About as wide as_ elytra;
anteriolateral angles projecting strongly forward;
base very slightly narrowed, posterolateral angles
obtuse; smooth, with sparse, very weak punctures
and a row of stronger punctures along front
oO S
MLA
i |
1 2
INS
48
FIGURES 43-48. Tjirtudessus wilunaensis: 43, lateral view of central lobe of aedeagus; 44, ditto dorsal view; 45,
paramere; 46, mesotrochanter and mesofemur; 47, metatrochanter and metafemur; 48 dorsal view. Scale bar
represents 1 mm (habitus only).
152
margin; basal plicae if present not visible on the
two mounted specimens; with row of long setae
laterally, denser towards front.
Elytra. Possibly fused, lacking inner ridges;
elongate, widest in front of middle, smooth,
covered with very small punctures, sparse row of
large punctures near suture; row of long setae near
lateral edge, a few additional larger punctures
with long setae, more frequent towards sides.
Epipleuron undifferentiated, that portion of elytra
visible ventrally relatively broad in anterior fifth,
then rapidly narrowing to be virtually absent along
rest of elytron.
Ventral surface. Prosternal process strongly
narrowed between coxae, almost reaching
mesothorax, apical half relatively broad, triangular
with blunt tip, strongly arched in lateral view with
highest point (viewed ventrally) between coxae.
Mesocoxae slightly separate. Metasternum sharply
triangular in front in midline; wings very narrow;
slightly pointed in midline behind. Metacoxal
plates large, metacoxal lines obsolete; a few small
setae-bearing punctures towards midline; closely
adpressed to first abdominal ventrite. Ventrites 1
and 2 fused, sutural lines distinct, ventrites 3 to 5
mobile, sparsely covered with small seta-bearing
punctures, ventrites 3 and 4 with a long central
seta or bunch of long setae.
Legs. Protibia triangular, widest at apex where
it is about three times its basal width; protarsi
expanded, segments 1 to 3 broad, segment 2
about one-half length of segment 1, segment 3 as
long as segment 1, very deeply bifid, segment 4
very small and hidden within lobes of segment 3,
segment 5 narrow, cylindrical, about twice length
of segment 3, segments | to 3 with a covering of
adhesive setae; claws short and simple.
Mesotrochanter elongate with a few setae on
inner edge; mesofemur elongate/oval with two
strong spines near base on hind edge (Fig. 46);
mesotarsi much less expanded than protarsi.
Metatrochanter tip elongate/oval (Fig. 47);
metafemur relatively broad, lacking spines;
metatibia moderately curved, widening towards
apex; metatarsi elongate, segment 1 longest,
segment 5 a little longer than segment 4,
segments 1 and 2 in combination about as long
as others; claws weak.
Male. No external differences between the
sexes. Median lobe of aedeagus relatively broad,
sharply narrowing to apex, tip bluntly pointed;
paramere broad, apical segment moderately long,
with long, club-shaped apical lobe tending to
overlap rest of segment, slightly wider than
adjacent part of apical segment (Figs 43-45).
CHS WATTS & WF HUMPHREYS
Etymology
Named after the type locality.
Remarks
A very small almost parallel-sided species with
almost no pronotal constriction and a short
fourth segment of the antenna which is only a
little more than one-half the length of the third.
So far unique among the Australian dytiscid
stygofauna in having the tip of the pronotal
process meeting, or almost meeting, the forward
extension of the mesosternum, slightly separating
the mesocoxae.
The eye remnant is littke more than a short
bifurcation of the more usual suture line on the
ventral surface. In the key it has been scored as
present. The species will run to 7. pinnaclesensis
if it is considered absent, from which the separate
mesocoxae and lack of pronotal constriction will
separate it.
Tjirtudessus yuinmeryensis sp. nov
Types
Holotype: m: ‘BES 6654, Yuinmery Station,
New Well, 28°32'62"S 119°05'28"E, 15/5/2001,
col. W.F. Humphreys, C.H.S. Watts & S. Cooper’,
WAM 32922. Slide mounted.
Paratypes: 53; 7, as for holotype, WAM
32923-32929; 46, as for holotype except ‘BES
6653’, 20 WAM 32930-32949, 26 SAMA; 1,
‘BES 8063, Yuinmery Station, Nine Mile Well,
28°32'35"S_ 119°08'00"E, 15/5/2001, col. W.F.
Humphreys, C.H.S. Watts & S. Cooper’, WAM
32950.
Description (number examined, 54) Figs 49-54
Habitus. Length 1.6-2.0 mm; relatively flat,
narrow. Moderately constricted at junction of
pronotum/elytra; uniformly light testaceous;
hindwing vestigial, about one-half length of
elytron.
Head. Narrower than elytra; smooth,
reticulation very weak, punctures sparse, very
small; subparallel in posterior half, widest just
behind eye remnant; eye remnant reduced to
single suture tending to widen or thicken
ventrally. Antenna relatively stout, segment 1
cylindrical, segment 2 barrel-shaped, segment 3 a
little shorter and much narrower and narrowing
towards base, segment 4 shorter than segment 3,
segments 5 to 10 subequal, segment 11 about
twice length of segment 10. Maxillary palpus
elongate, segment 4 about length of segments 1 to
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 153
3 combined, oblique row of long setae on outer
side, tip truncated.
Pronotum. Almost as wide as elytra;
anteriolateral angles projecting strongly forward;
base quite strongly narrowed, posterolateral angles
acute; smooth, with sparse, very weak punctures;
basal plicae moderately marked, straight, reaching
to about halfway along pronotum, slightly
excavated inwards; with row of long setae
laterally, denser towards front.
Elytra. Not fused, lacking inner ridges;
elongate, widest behind middle, smooth, sparsely
covered with very small punctures; row of long
setae near lateral edge, a few additional larger
punctures with long setae, more frequent towards
sides; underside of elytron with a few setiferous
micropunctures near base and on epipleuron near
base. Epipleuron not differentiated, that part of
elytron visible ventrally broad in anterior fifth,
then rapidly narrowing to be virtually absent along
rest of elytron.
Ventral surface. Prosternal process strongly
narrowed between coxae, not reaching
mesothorax, apical half moderately broad, almost
parallel-sided, strongly arched in lateral view with
highest point (viewed ventrally) between coxae.
Mesocoxae in contact at midline. Metasternum
49 50 51
52 Si >
53 a 5
sharply triangular in front in midline; wings very
narrow; rounded in midline behind. Metacoxal
plates large, metacoxal lines moderately widely
spaced, reaching to about halfway to metasternum,
diverging slightly towards front; a few small
setae-bearing punctures towards midline; closely
adpressed to first abdominal ventrite. First and
second ventrites fused, sutural lines distinct
towards midline, becoming indistinct laterally,
ventrites 3 to 5 mobile, sparsely covered with
small seta-bearing punctures, ventrites 3 and 4
with a long central seta or bunch of long setae.
Legs. Protibia relatively broad, inner edge
straight, outer edge bowed, widest near apex
where it is about four times its basal width;
protarsi weakly expanded, segment 1
subrectangular, segment 2 as wide and about one-
half length of segment 1, segment 3 as long as
segment 1 but a little narrower and very deeply
bifid, segment 4 very small and hidden within
lobes of segment 3, segment 5 narrow, cylindrical,
about length of segment 3, segments 1 to 3 with
dense covering of adhesive setae; claws short and
simple. Mesotrochanter elongate/oval with a few
setae near apex; mesofemur with row of five to
six relatively strong spines along hind edge in
basal half (Fig. 52); mesotarsi similar to protarsi.
SI ELA
WY
im
Ze aS
54 If i,
FIGURES 49-54. Tjirtudessus yuinmeryensis: 49, lateral view of central lobe of aedeagus; 50, ditto dorsal view;
51, paramere; 52, mesotrochanter and mesofemur; 53, metatrochanter and metafemur; 54 dorsal view. Scale bar
represents 1 mm (habitus only).
154
Metatrochanter tip rounded (Fig. 53); metafemur
elongate, widest beyond middle, lacking spines;
metatibia thin, strongly curved, widening towards
apex; metatarsi elongate, segment 1 longest,
segment 5 longer than segment 4, segments 1 and
2 in combination about as long as others; claws
weak.
Male. Little external difference between the
sexes. Median lobe of aedeagus relatively narrow
and narrowing to blunt point; paramere broad,
apical segment with long, narrow, apical lobe well
separated from rest of segment except near tip
(Figs 49-51).
Etymology
Named after the station property on which the
species was collected.
Remarks
A relatively small, pale, narrowly elongate
species with five to six relatively strong
mesofemural spines. Closely resembles T.
masonensis, from which it can only be separated
by a slightly shorter apical lobe to the paramere
and by DNA sequencing.
Bidessodes Regimbart
Bidessodes gutteridgei sp. nov.
Types
Holotype: m.: ‘BES 8651, Three Rivers Station,
Limestone Well, 25°16'59"S_ 119°10'33"E, 26/8/
2001, col. W.F. Humphreys, T. Karanovic & J.M.
Waldock’, WAM 32952. Slide mounted.
Paratypes: 18; 2, ‘BES 8605, Three Rivers
Station, bore MB4 Plutonic Borefield, 25°16'43"S
119°11'00"E, 26/8/2001, col. W.F. Humphreys, T.
Karanovic & J.M. Waldock’, 1 WAM 32953, 1
SAMA; 2, ‘BES 8613, Three Rivers Station, Site
312, Old production bore, Plutonic Borefield,
25.26745°S 119.16398°E, 26/8/2001, col. W.F.
Humphreys, T. Karanovic & J.M. Waldock’,
WAM 32954-32955; 1 (partial), ‘BES 8620,
Three Rivers Station, bore MBS, Plutonic
Borefield, 25.26730°S 119.16417°E, 26/8/2001,
col. W.F. Humphreys, T. Karanovic & J.M.
Waldock’, WAM 32956; 5, ‘BES 8625, Three
Rivers Station, Limestone Well, 25.28313°S
119.175773°E, 26/8/2001, col. W.F. Humphreys,
T. Karanovic & J.M. Waldock’, 2 WAM 32957-—
32958, 3 SAMA; 3, Ditto except, ‘BES 8651’,
SAMA; 2 (1 partial), ‘BES 8633; Three Rivers
Station, bore MB3, Plutonic Borefield,
CHS WATTS & WF HUMPHREYS
25.26943°S 119.17202°E, 26/8/2001, col. W.F.
Humphreys, T. Karanovic & J.M. Waldock’,
WAM 32959-32960; 3, ‘BES 8656/7, Three
Rivers Station, bore MB2, Plutonic Borefield,
25.27360°S 119.17200°E, 26/8/2001, col. W.F.
Humphreys, T. Karanovic & J.M. Waldock’, 2
WAM 32961-32962, 1 SAMA.
Description (number examined, 19) Figs 55-60
Habitus. Length 1.3-1.5 mm; broadly oval,
relatively flat, weakly constricted at base of
pronotum; uniformly light testaceous; hindwing
vestigial, about one-quarter length of elytron.
Head. A little narrower than elytra; smooth,
reticulation strong, punctures sparse, very small;
subparallel in posterior half, widest just behind
eye remnant; eye remnant reduced to single suture.
Antenna relatively stout, segment 1 cylindrical,
segment 2 oval, segment 3 much smaller and
narrower, segments 4 to 10 equal in length
becoming progressively wider, segment 11 about
twice length of segment 10. Maxillary palpus
stout, segment 4 a little shorter than segments 1 to
3 combined, oblique row of long setae on outer
side, tip truncated.
Pronotum. Almost as wide as elytra;
anteriolateral angles projecting strongly forward;
base quite strongly narrowed, posterolateral angles
obtuse; smooth, with sparse, very weak punctures
and a row of stronger punctures along front
margin; strongly reticulate; basal plicae absent;
with row of long setae laterally, denser towards
front.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, widest in middle, smooth,
sparsely covered with small punctures each with a
short seta; row of long setae near lateral edge, a
few additional larger punctures with long setae,
more frequent towards sides; underside of elytron
with a few setiferous micropunctures towards
apex and sides. Epipleuron undifferentiated;
portion of elytron visible ventrally thin except for
extreme shoulder.
Ventral surface. Prosternal process relatively
broad, strongly narrowed between coxae, not
reaching mesothorax, apical half almost parallel-
sided, tip with small point, strongly arched in
lateral view with highest point (viewed ventrally)
between coxae. Mesocoxae in contact at midline.
Metasternum sharply triangular in front in
midline; wings very narrow; broadly rounded in
midline behind. Metacoxal plates large, metacoxal
lines relatively well marked, quite widely spaced,
reaching nearly to metasternum, weakly diverging
towards front; a few small setae-bearing punctures
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 155
ae
55
59
FIGURES 55-60. Bidessodes gutteridgei: 55, lateral view of central lobe of aedeagus; 56, ditto dorsal view; 57,
paramere; 58, mesotrochanter and mesofemur; 59, metatrochanter and metafemur; 60 dorsal view. Scale bar
represents | mm (habitus only).
towards midline; strongly reticulate; closely
adpressed to first abdominal ventrite. Ventrites 1
and 2 fused, sutural lines distinct towards midline,
becoming indistinct laterally, ventrites 3 to 5
mobile, sparsely covered with small seta-bearing
punctures, ventrites 3 and 4 with a long central
seta or bunch of long setae; strongly reticulate.
Legs. Protibia broad, inner edge straight, outer
edge bowed, widest near apex where it is about
four times its basal width; protarsi quite strongly
expanded, segment 1 broad, narrowing at base,
segment 2 a little wider and a little shorter than
segment 1, segment 3 as long as first and a bit
wider, very deeply bifid, segment 4 very small
and hidden within lobes of segment 3, segment 5
narrow, cylindrical, about twice length of segment
3, segments | to 3 with quite dense covering of
adhesive setae; claws short and simple.
Mesotrochanter elongate with row of three to four
spines on inner edge; mesofemur with row of six
short spines along hind edge in basal half (Fig.
58); mesotibia broad, slightly angular; mesotarsi
narrower than protarsi. Metatrochanter tip
rounded, well separated from femur (Fig. 59);
metafemur stout, lacking spines; metatibia
strongly curved, widening towards apex; metatarsi
elongate, segment 1 longest, segment 5 a little
longer than segment 4, segments 1 and 2 in
combination about as long as others; claws weak.
Male. No external differences between the
sexes. Median lobe of aedeagus variable in width
along shaft, tip bluntly pointed; paramere broad,
apical segment hook-shaped (Figs 55-57).
Etymology
Named after Rob Gutteridge, who has very ably
illustrated many of these beetles.
Remarks
A small species best recognised by the stout
antenna, slightly angular mesotibia and large
metatrochanter with its tip well separated from the
metafemur. Its placement in Bidessodes is based
primarily on evidence from DNA sequence data
which suggest a relationship with B.
limestoneensis and, more distantly, with B. bilita
156
Watts and B. mjobergi (Zimmermann.) (See also
under B. limestoneensis.). There are no
morphological characters that would negate its
placement in Bidessodes as currently defined.
Bidessodes limestoneensis sp. nov.
Types
Holotype: m: ‘BES 8625, Three Rivers Station,
Limestone Well, 25°16'59"S_ 119°10'33"E, 26/8/
2001, W.F. Humphreys, T. Karanovic & J.M.
Waldock’, WAM 32951. In spirit.
Description (number examined, 1) Figs 61-66
Habitus. Length 4.2 mm; relatively flat,
strongly constricted at junction of pronotum/
elytra; uniformly light testaceous; hindwing
vestigial, about one-half length of elytron.
Head. About as wide as elytra; smooth,
moderately reticulate with small meshes,
punctures sparse, very small; subparallel in
posterior half, widest in middle behind eye
remnant; eye remnant reduced to two well-
separated short sutures at side of head. Antenna
very thin, segments subequal, apical segment a bit
longer than penultimate (Fig. 66). Maxillary
palpus thin, elongate, apical segment about same
length as segments 1 to 3 combined.
Pronotum. As wide as elytra; anteriolateral
angles projecting strongly forward; base quite
strongly narrowed, posterolateral angles obtuse;
smooth, moderately reticulate, meshes small;
punctures sparse, weak; basal plicae weak,
straight, reaching to about one-quarter way along
pronotum; with row of long setae laterally, denser
towards front.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, widest behind middle,
smooth, sparsely covered with small shallow
punctures, row of long setae near lateral edge, a
few additional larger punctures with long setae,
more frequent towards sides. Epipleuron weakly
differentiated, that portion of elytron visible
ventrally broad in anterior fifth, then rapidly
narrowing to be virtually absent along rest of
elytron.
Ventral surface. Prosternal process moderately
broad, strongly narrowed between coxae, not
reaching mesothorax, apical half almost parallel-
sided, tip rounded, strongly arched in lateral view
with highest point (viewed ventrally) between
coxae. Mesocoxae in contact at midline.
Metasternum bluntly triangular in front in midline;
wings short, very narrow; broadly rounded in
CHS WATTS & WF HUMPHREYS
midline behind; reaching a little beyond midway
to metacoxae. Metacoxal plates large, metacoxal
lines weakly defined, relatively close, moderately
widely spaced, reaching nearly to metasternum,
evenly diverging; a few small setae-bearing
punctures towards midline; finely reticulate;
closely adpressed to first abdominal ventrite.
Ventrites 1 and 2 fused, sutural lines distinct
towards midline, becoming indistinct laterally,
ventrites 3 to 5 mobile, sparsely covered with
small seta-bearing punctures, weakly reticulate,
ventrites 3 and 4 with a long central seta or bunch
of long setae.
Legs. Protibia very narrow, slightly bowed,
widest past middle where it is about three times
its basal width; protarsi expanded, segment 1
round, segment 2 a little broader and a little
shorter, segment 3 about twice as long and as
broad as segment 1 and very deeply bifid, segment
4 very small and hidden within lobes of segment
3, segment 5 narrow, cylindrical, about length of
segment 3, segments 1 to 3 with very dense
covering of adhesive setae; claws short and
simple. Mesotrochanter elongate with row of setae
on inner edge; mesofemur with two comb-like
rows of spines along hind edge (Fig. 64);
mesotibia narrow, more strongly bowed than
protibia; mesotarsi narrower than protarsi.
Metatrochanter tip rounded (Fig. 65); metafemur
elongate, lacking spines; metatibia thin, curved,
widening towards apex; metatarsi elongate,
segment | longest, segment 5 a little longer than
segment 4, segments | and 2 in combination about
as long as others; claws weak.
Male. Female not known. Median lobe of
aedeagus progressively narrowing to near apex
where it rapidly narrows to blunt tip; paramere
narrow, apical portion without well separated
apical lobe, apical segment with inner half with
different surface texture to outer (Figs 61-63).
Etymology
Named after the type locality.
Remarks
A relatively large species with numerous
characters setting it apart from other Australian
stygobitic Bidessini. Most noticeably the long thin
antenna, bowed mesotibia and unusually thin legs.
The species will key to Bidessodes in Bistrom
(1988) and the male genitalia resemble B
flavosignatus (Zimmermann). DNA sequence data
(Cooper et al 2002) somewhat distantly groups it
with the previous species, B. gutteridgei sp. nov.,
and with B. bilita and B. mjobergi. Its large size
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 157
Hamat
t
é
Gt
64
on
OK
66 |T!
FIGURES 61-66. Bidessodes limestoneensis: 61, lateral view of central lobe of aedeagus; 62, ditto dorsal view; 63,
paramere; 64, mesotrochanter and mesofemur; 65, metatrochanter and metafemur; 66 dorsal view. Scale bar
represents | mm (habitus only).
and thin prolegs readily separate it from B.
gutteridgei. Additional studies incorporating more
specimens of Australian Bidessodes (which DNA
sequence data strongly suggest are not closely
related to the South American Bidessodes) and
additional specimens are needed to confirm the
placement of B. limestoneensis with the
Australian Bidessodes.
Nirripirti Watts & Humphreys
Nirripirti darlotensis sp. nov.
Types
Holotype: m: ‘BES 6635, Melrose Station (Lake
Darlot), mineral exploration bore near Halfpenny
Well, 27°41'48"S 121°20'22"E, 13/5/2001, coll.
W.F. Humphreys, C.H.S. Watts & S. Cooper’,
WAM 32963. Slide mounted.
Paratypes: 11, 7 (2 partial) as for holotype, 5 (2
partial) WAM 32964-32968, 2 SAMA; 2, as for
holotype except ‘BES 6636’, WAM 32969-—
32970; 2, as for holotype except ‘BES 6639’,
SAMA.
Description (number examined, 12) Figs 67-72
Habitus. Length 3.5-4.1 mm; elongate,
relatively flat, slightly pug-nosed, moderately
constricted at junction of pronotum/elytra;
uniformly light testaceous; hindwing reduced to
one-third length of elytron.
Head. Large, almost as wide as elytra; smooth,
very weakly reticulate, scattered small punctures
and dense band of setiferous punctures across
rear; sides subparallel in posterior half; eye
remnant reduced to a small suture in middle near
edge. Antenna thin, segments 1 and 2 cylindrical,
segments 3 to 10 subequal with segment 7 largest,
segment 11 a bit longer than segment 10.
Maxillary palpus thin, elongate, segment 4 a little
longer than segment 3.
Pronotum. About as wide as_ elytra;
anteriolateral angles thin, projecting strongly
forward; moderately narrowed before base, sides
slightly sinuate; posterolateral angles obtuse;
158 CHS WATTS & WF HUMPHREYS
virtually impunctate except for band of strong
punctures along front margin; long lateral setae
restricted to apical third.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate/oval, widest behind middle,
smooth, a few scattered very small punctures, a
row of punctures adjacent to suture; a few
additional larger punctures with long setae, more
frequent towards sides. Setiferous micropunctures
over most of underside, denser at base, apex and
along suture line. Epipleuron not differentiated
from rest of elytron, that part of elytron visible
ventrally relatively broad for almost the whole
length of elytron.
Ventral surface. Prosternal process very narrow
between coxae, not reaching mesothorax, apical
half narrowly spatulate, point rounded, strongly
arched in lateral view with highest point (viewed
ventrally) between coxae. Mesocoxae in contact at
midline. Metasternum triangularly pointed in front
in midline; wings very narrow, short; broadly
rounded in midline behind. Metacoxal plates
large, metacoxal lines absent; virtually
impunctate; closely adpressed to first abdominal
ventrite. Ventrites 1 and 2 fused, sutural lines
distinct in inner half indistinct towards sides,
ventrites 3 to 5 mobile, virtually impunctate
except for a few long central seta or bunch of
long setae.
Legs. Protibia narrow, widest a little past
middle where it is about four times its very narrow
basal width; protarsi moderately expanded,
segment 1 transversely oval, segment 2 about size
of segment 1, segment 3 about twice length of
segment 2, deeply bifid, segment 4 very small and
hidden within lobes of segment 3, segment 5
narrow, cylindrical, about length of segment 3,
segments | to 3 with dense covering of adhesive
setae; claws short and simple. Mesotrochanter
elongate with a few fine setae at apex; mesofemur
with row of seven to eight relatively long but
weak spines along hind edge in basal half;
mesotarsi less expanded than protarsi.
Metatrochanter elongate/oval, tip rounded;
metafemur thin, lacking spines; metatibia weakly
curved, widening slightly towards apex; metatarsi
elongate, segment 1 longest, segments 2 to 4
subequal, in combination segments | and 2 about
same length as others, segments 2 to 5 without
spines other than at apex; claws weak.
Male. Antennae of male slightly stouter than
female. Median lobe of aedeagus broad, flat,
widening at apex; paramere relatively narrow, apex
rounded with small flap of tissue (Figs 67-69).
Y id ¥. \ {
\ ys
72 ZN YN
; YN
FIGURES 67-72. Nirripirti darlotensis: 67, lateral view of central lobe of aedeagus; 68, ditto dorsal view; 69,
paramere; 70, mesotrochanter and mesofemur; 71, metatrochanter and metafemur; 72 dorsal view. Scale bar
represents | mm (habitus only).
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS
Etymology
Named after the type locality.
Remarks
A large species with the elytra tending to wrap
around the abdomen, and with thin antennae with
segment 3 a bit longer than segment 2. The only
other species to have a broad band of small
setiferous punctures across the back of the head is
the much smaller N. melroseensis which was
collected from the same bore hole.
Nirripirti fortisspina sp. nov.
Types
Holotype: m: ‘BES 6645, Pinnacles Station,
Site 432, 28°15'27"S 120°07'37"E, 14/5/2001, col.
W.F. Humphreys, C.H.S. Watts & S. Cooper’,
WAM 32971. Slide mounted.
Paratypes. 15; 13, as for holotype, 7 WAM
32972-32978, 6 SAMA; 2, as for holotype except
‘BES 6646’, SAMA.
73 74 res)
LLLZ_-
76 SS
77 ac
159
Description (number examined, 16) Figs 73-78
Habitus. Length 2.5-3.0 mm. elongate,
relatively flat, weakly constricted at junction of
pronotum/elytra; uniformly light testaceous;
hindwing vestigial, reduced to small flap.
Head. Large, nearly as wide as elytra; smooth,
weakly reticulate with small even meshes, a few
small scattered punctures; sides subparallel in
posterior half; eye remnant reduced to a short
suture near edge. Antenna thin, segments 1 and 2
almost cylindrical, segments 3 to 10
approximately same length, widening slightly
towards their apexes, segments 3 and 4 narrowest,
segment 11 a bit longer and narrower than
segment 10. Maxillary palpus elongate, thin,
segment 4 a little longer than segment 3.
Pronotum. About as wide as _ elytra;
anteriolateral angles projecting strongly forward;
wider anteriorly, evenly narrowing towards rear,
posterolateral angles obtuse; very weakly
reticulate, virtually impunctate except towards
front margin, numerous long setae at side towards
front.
FIGURES 73-78. Nirripirti fortisspina: 73, lateral view of central lobe of aedeagus; 74, ditto dorsal view; 75,
paramere; 76, mesotrochanter and mesofemur; 77, metatrochanter and metafemur; 78 dorsal view. Scale bar
represents 1 mm (habitus only).
160
Elytra. Not fused but tightly locked, lacking
inner ridges; elongate, widest a bit anterior of
middle, smooth, covered with fine reticulation;
moderate number of relatively large punctures
laterally; underside with dense setiferous
micropunctures at apex and along suture line.
Epipleuron not differentiated from rest of elytron,
that part of elytron visible ventrally broad in
anterior quarter, then gradually narrowing, absent
near apex of elytron.
Ventral surface. Prosternum very narrow, not
much wider than procoxae; anterior half of
prosternal process almost perpendicular to body,
strongly narrowed between coxae, not reaching
mesothorax, apical half spatulate, strongly arched
in lateral view with highest point (viewed
ventrally) between coxae. Mesocoxae in contact at
midline. Metasternum only weakly extended
forward in midline; wings very short, narrow;
main portion almost parallel-sided; rounded in
midline behind. Metacoxal plates large, metacoxal
lines absent; weakly reticulate, impunctate; closely
adpressed to first abdominal ventrite. Ventrites 1
and 2 fused, sutural lines distinct, ventrites 3 to 5
mobile, weakly reticulate, virtually impunctate
except for a few long central seta or bunch of
long setae.
Legs. Profemur with small peg-like seta on hind
edge adjacent to trochanter; protibia narrow,
widest past middle where it is about twice its
basal width; protarsi quite strongly expanded,
segment 1 broadly elongate not symmetric, basal
half expanded backwards, apical half more
expanded forwards, segment 2 about one-half
length of segment 1, outer lobe more expanded;
segment 3 as long as segment 1, deeply bifid,
lobes slightly asymmetric; segment 4 very small
and hidden within lobes of segment 3; segment 5
narrow, cylindrical, about length of segment 3,
segments 1 to 3 with dense covering of adhesive
setae; claws short and simple. Mesotrochanter
elongate with a few fine setae at apex; mesofemur
with row of eight to nine very strong spines
closely spaced along hind edge in basal half;
mesotarsi symmetric, less expanded than protarsi.
Metatrochanter narrowly elongate, apical half well
separated from femur; metafemur thin, elongate,
lacking spines; metatibia thin, weakly curved,
approximately the same width throughout;
metatarsi thin, elongate, segment 1 and others
subequal in length, in combination segments 1 and
2 much shorter than others, segments 2 to 5
without spines other than at apex; claws weak.
Male. Little external difference from female.
Median lobe of aedeagus narrowing rapidly in
CHS WATTS & WF HUMPHREYS
apical quarter; paramere broadest in middle, apical
quarter thin, apex with a bunch of short stout setae
(Figs. 73-75).
Etymology
Latin. ‘Forte spina’ — strong spines.
Remarks
A relatively large distinctive species easily
recognised by the row of strong spines on the
mesofemur and the peculiarly asymmetric protarsi,
as well as the thin elongate metatrochanters and
thin elongate antenna. The prosternum is short
with little area in front of the mesocoxae, resulting
in a very perpendicular anterior portion to the
prosternal process.
Nirripirti hamoni sp. nov.
Types
Holotype: m: ‘BES 8662, Milgun Station,
Earrie Well, 25°07'22"S 118°05'44"E, 28/8/2001,
col. W.F. Humphreys, T. Karanovic & J.M.
Waldock’, WAM 32979. Slide mounted.
Paratypes: 3; 2, as for holotype, SAMA; 1, as
for holotype except ‘BES 8661, 27/8/2001’,
WAM 32980.
Description (number examined, 4) Figs 79-84
Habitus. Length 1.7 mm.; relatively broad, flat,
strongly constricted at base of pronotum; elytra
slightly flared at shoulders; uniformly light
testaceous; hindwing vestigial, reduced to tiny flap.
Head. Relatively small, less than width of
elytra; smooth, moderately strong reticulation with
small even meshes, virtually impunctate except a
few near antennae bases; subparallel in posterior
half; eye remnant reduced to a dark suture in
middle near edge. Apical half of antenna relatively
thick, segment 1 cylindrical, segment 2 oval,
segments 3 to 4 much thinner than rest, segments
6 to 7 subequal, broader than segment 5, apical
segment a bit longer and narrower than
penultimate. Maxillary palpus elongate, segment 4
a little longer than segment 3.
Pronotum. A little narrower than elytra;
anteriolateral angles projecting strongly forward
to sharp point, sides strongly curved outwards;
base strongly narrowed, posterolateral angles
acute; strongly reticulate, virtually impunctate
except towards front margin and laterally.
Numerous long setae at sides towards front.
Elytra. Not fused but strongly locked, lacking
inner ridges; elongate, widest in front of middle,
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS
slightly constricted behind shoulders, smooth,
covered with strong reticulation; moderately and
evenly covered with small punctures; underside of
elytron with a few additional larger punctures with
long setae, more frequent towards sides; with
numerous setiferous micropunctures densest
towards apex and along suture line. Epipleuron
not differentiated from rest of elytron, broad in
anterior fifth, then rapidly narrowing to middle,
virtually absent along rest of elytron.
Ventral surface. Prosternal process broad,
strongly narrowed between coxae, not reaching
mesothorax, apical half oval, strongly arched in
lateral view with highest point (viewed ventrally)
between coxae. Mesocoxae in contact at midline.
Metasternum sharply pointed in front in midline;
wings short, very narrow; narrowly rounded in
midline behind. Metacoxal plates large, metacoxal
lines absent; virtually impunctate, strongly
reticulate with large meshes; closely adpressed to
first abdominal ventrite. Ventrites 1 and 2 fused,
sutural lines distinct except close to sides, ventrites
3 to 5 mobile, virtually impunctate except for a few
long central setae or bunch of long setae.
ae
ee eS
80
H thm
161
Legs. Profemur noticeably grooved in apical
half to accept protibia; protibia narrow, widest
past middle where it is about three times its basal
width; protarsi expanded, segment 1 broad,
segment 2 about one-half length of segment 1,
segment 3 relatively narrow, as long as segment 1,
deeply bifid, segment 4 very small and hidden
within lobes of segment 3, segment 5 narrow,
cylindrical, about length of segment 3, segments 1
to 3 with dense covering of adhesive setae; claws
short and simple. Mesotrochanter elongate with a
few fine setae at apex; mesofemur with row of
four to five strong spines along hind edge in basal
half; mesotarsi a little less expanded than protarsi.
Metatrochanter relatively small, tip pointed;
metafemur thin, lacking spines; metatibia
relatively stout, very weakly curved,
approximately the same width throughout;
metatarsi relatively stout, segment 1 longest,
segment 5 a little longer than segment 4, segments
1 and 2 in combination much shorter than others,
segments 2 to 5 without spines other than at apex;
claws weak.
Male. Male appendages not known. Median
| HAmoal
FIGURES 79-84. Nirripirti hamoni: 79, lateral view of central lobe of aedeagus; 80, ditto dorsal view; 81,
paramere; 82, mesotrochanter and mesofemur; 83, metatrochanter and metafemur; 84 dorsal view. Scale bar
represents | mm (habitus only).
162
lobe of aedeagus narrowing rapidly in apical
quarter; paramere broad at base, apical half thin,
tip with a bunch of long setae (Figs. 79-81).
Etymology
Named after Harold Hamon, the illustrator of
many of these beetles.
Remarks
A relatively small, strongly chitinised species
easily recognised by its flared shoulders and
strongly constricted pronotum and pointed
metatrochanters.
Nirripirti killaraensis sp. nov.
Types
Holotype: m: ‘BES 5561, Killara Station, Two
Mile Bore, 26°21'11"S; 118°59'34"E, 5/5/2001,
col. W.F. Humphreys, C.H.S. Watts & S. Cooper’,
WAM 32981. Slide mounted.
Paratypes: 19; 1, as for holotype, SAMA; 1,
‘BES 5597, Killara Station, uncased mineral
exploration bore, Site 130, 26.34194°S;
118.96071°E, 6/5/2001, col. W.F. Humphreys,
C.H.S. Watts & S. Cooper’, SAMA; 8, ‘BES
8125, Killara Station, Site 130, 26°20'31"S,
118°57'39"E, 21/8/2001, col. W.F. Humphreys, T.
Karanovic & J.M. Waldock’, WAM 32928-
32989; 9, ditto, except ‘BES 8128’, SAMA.
Description (number examined, 20) Figs 85-90
Habitus. Length 1.5-1.9 mm; boat-shaped,
relatively flat, weakly constricted at junction of
pronotum/elytra; uniformly light testaceous;
hindwing vestigial, reduced to tiny flap.
Head, Narrower than elytra; smooth,
moderately strong reticulation with small even
meshes, virtually impunctate except a few near
antennae bases arranged in lines; sides slightly
curved; eye remnant reduced to a short suture in
middle near edge. Antenna relatively thick,
segment 1 narrow, cylindrical, segment 2 much
larger, rounded, narrower at base, segments 3 and
4 narrow, segments 6 to 8 a bit wider that others,
segment 11 is 1.5 times longer than penultimate.
Maxillary palpus elongate, apical segment about
as long as other segments combined.
Pronotum. Narrower than elytra; anteriolateral
angles projecting strongly forward; sides weakly
sinuate, posterolateral angles obtuse; quite
strongly reticulate, a few small scattered
punctures. Long setae at sides
Elytra. Not fused but tightly closed, lacking
CHS WATTS & WF HUMPHREYS
inner ridges; elongate, widest behind middle,
smooth, covered with fine reticulation; a few
scattered small punctures, a few additional larger
punctures with long setae, more frequent towards
sides, underside with setiferous micropunctures at
base, apex and along suture line. Epipleuron not
differentiated; that portion of elytra visible
ventrally, broad except near tip.
Ventral surface. Prosternal process strongly
narrowed between coxae, tip pointed, nearly
reaching mesothorax, apical half parallel with
plane of body, anterior section perpendicular to
plane of body, prosternum short and not much
wider than procoxae. Mesocoxae in contact at
midline. Metasternum bluntly pointed in front in
midline; wings very narrow; broadly rounded in
midline behind. Metacoxal plates large, metacoxal
lines absent; virtually impunctate, reticulate;
closely adpressed to first abdominal ventrite.
Ventrites 1 and 2 fused, sutural lines distinct in
inner three-quarters and indistinct laterally,
ventrites 3 to 5 mobile, virtually impunctate
except for a few long central seta or bunch of
long setae, strongly reticulate, meshes small.
Legs. Protibia narrow, widest past middle where
it is about twice its basal width; protarsi weakly
expanded, segment 1 broadly triangular, segment
2 about one-half length of segment 1, segment 3
as long as segment 1, deeply bifid, segment 4 very
small and hidden within lobes of segment 3,
segment 5 narrow, cylindrical, a little longer than
segment 3, segments | to 3 with dense covering
of adhesive setae; claws short and simple.
Mesotrochanter elongate with a few fine setae at
apex; mesofemur with row of four to five spines
along hind edge in basal half; mesotarsi much
narrower than protarsi. Metatrochanter elongate/
oval, apex bluntly pointed; metafemur elongate,
lacking spines; metatibia almost straight,
approximately the same width throughout;
metatarsi elongate, segment 1 longest, segments 2
to 4 subequal, segments 1 and 2 in combination
about same length as others, segments 2 to 5
without spines other than at apex; claws weak.
Male. Little difference from female. Median
lobe of aedeagus narrowing rapidly in apical
quarter; paramere broad at base, apical half thin,
tip with a bunch of long setae (Figs. 85-87).
Etymology
Named after the pastoral station on which it
was found.
Remarks
A moderately sized, boat-shaped species with
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 163
Wired
:
85 6
89
87
FIGURES 85-90. Nirripirti killaraensis: 85, lateral view of central lobe of aedeagus; 86, ditto dorsal view; 87,
paramere; 88, mesotrochanter and mesofemur; 89, metatrochanter and metafemur; 90 dorsal view. Scale bar
represents 1 mm (habitus only).
wrap-around elytra, and a pronotal process with a
long point which nearly reaches the extension of
the metasternum. A little smaller than the other
boat-shaped Western Australian species, N.
skaphites, and with the apex of the
metatrochanters more rounded.
Nirripirti macrocephalus sp. nov.
Types
Holotype: male: ‘BES 8089 NT: Napperby
Station; bore RN 1561@ Herbert Well;
22°54'32"S 132°43'45"E; 18/6/2001. Col. W.F.
Humphreys & R. Read.’, NTM, I 001174. Slide
mounted.
Paratype: 1, as for holotype, SAMA.
Description (number examined, 2) Figs 91-96
Habitus. Length 1.9-2.0 mm.; oval, relatively
flat, strongly constricted at junction of pronotum/
elytra; light testaceous, head a little darker;
hindwing vestigial, reduced to tiny flap.
Head. Large, short, broad, deflexed downwards,
as wide as elytra; smooth, weakly reticulate,
virtually impunctate except a few small ones near
antennae bases; sides subparallel in posterior half;
eye remnant reduced to a short suture in middle.
Antenna thin, segments 1 and 2 cylindrical,
segments 3 and 4 much thinner, 5 to 10 triangular,
broader middle segments slightly larger, segment
11 twice length of segment 10. Maxillary palpus
thin, elongate, segment 4 much longer than
segment 5, some long setae towards apex of
segments.
Pronotum. A little wider than elytra, much
broader then long; anteriolateral angles projecting
strongly forward, anterior edge sinuate; strongly
constricted just before base, posterolateral angles
acute; a few scattered very small punctures;
numerous long setae at sides particularly towards
front.
Elytra. Not fused but tightly closed, lacking
inner ridges; broad, widest at shoulders, smooth;
weakly reticulate; a few scattered small
punctures, some arranged in rows; a few
additional larger punctures with long setae, more
frequent towards sides; underside of elytron with
numerous, evenly spaced, _ setiferous
micropunctures denser towards apex. Epipleuron
not differentiated, that part of elytron visible
ventrally broad in anterior fifth, rapidly
164
narrowing to be virtually absent along rest of
elytron.
Ventral surface. Prosternum short, no longer
than postcoxae, anterior portion of prosternal
process rising perpendicularly with both a forward
and a backward projection, anterior projection
broad, rounded, posterior projection (process)
broad, triangular; not reaching mesothorax.
Mesocoxae in contact at midline. Metasternum
bluntly pointed in front in midline; wings absent;
broadly rounded in midline behind. Metacoxal
plates large, reaching episternum, metacoxal lines
absent; virtually impunctate; closely adpressed to
first abdominal ventrite. Ventrites 1 and 2 fused,
sutural lines distinct in inner half indistinct
laterally, ventrites 3 to 5 mobile, virtually
impunctate except for a few long central seta or
bunch of long setae.
Legs. Protibia very narrow, widest near apex
where it is about twice its basal width; protarsi
moderately expanded, segment 1 broadly
triangular, segment 2 a little shorter, segment 3
longer than segment 1, deeply bifid, segment 4
very small and hidden within lobes of segment 3,
segment 5 narrow, cylindrical, about length of
segment 3, segments | to 3 with long adhesive
91 92 wi)
CHS WATTS & WF HUMPHREYS
setae; claws short and simple. Mesotrochanter
elongate/ oval, with a few fine setae at apex;
mesofemur with row of four strong spines along
hind edge in basal half; mesotibia curved,
moderately flanged on inside near apex, mesotarsi
simple, not expanded. Metatrochanter oval;
metafemur elongate, lacking spines; metatibia
stout, curved, moderately widening towards apex;
metatarsi elongate, segment 1 longest, segment 4
shortest, in combination segments 1 and 2 a little
shorter than others, all segments without spines
other than at apex; claws weak.
Male. Little difference from female. Median
lobe of aedeagus broad, narrowing rapidly in
apical quarter to sharp point, apical portion of
paramere twisted, apex rounded (Figs 91-93).
Etymology
Latin. ‘Macrocephalus’— big head; a reference
to its unusually large deflexed head.
Remarks
A distinctive, moderate sized, well chitinised
species, easily recognised by its very broad
deflexed head as well as its thin legs and strongly
constricted pronotum.
p \
(7 \)
\) "
\, ¥
\ &£
wy — LY
Po A Ze,
i 9) \
ef = PNK
4) RR
\
96 JX / /,
FIGURES 91-96. Nirripirti macrocephalus: 91, lateral view of central lobe of aedeagus; 92, ditto dorsal view; 93,
paramere; 94, mesotrochanter and mesofemur; 95, metatrochanter and metafemur; 96 dorsal view. Scale bar
represents 1 mm (habitus only).
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS
Nirripirti melroseensis sp. nov.
Types
Holotype: m: ‘BES 6635, Melrose Station (Lake
Darlot), mineral exploration bore near Halfpenny
Well, 27°41'48"S; 121°20'22"E, 13/5/2001, coll.
W.F. Humphreys, C.H.S. Watts & S. Cooper’,
WAM 32990. Slide mounted.
Paratypes: 23; 10, as for holotype, SAMA; 2,
as for holotype except ‘BES 6639’, WAM 32991 -
32992; 11, as for holotype except ‘BES 6636’,
WAM 33927-33937.
Description (number examined, 24) Figs 97-102
Habitus. Length 1.8-2.0 mm; elongate,
relatively flat, weakly constricted at junction of
pronotum/elytra; uniformly light testaceous;
hindwing reduced to one-third length of elytron.
Head. Much narrower than elytra; smooth,
strongly reticulate with small even meshes,
moderately dense band of setiferous punctures
across rear; sides subparallel in posterior half;
eye remnant reduced to a suture in middle at
side. Antenna relatively thick, segment 1 robust,
(vy
FA
peed
TT \
GoD
165
cylindrical, segment 2 a little wider and more
oval, segments 3 to 10 narrow and shorter,
subequal, segment 11 about as wide and a bit
longer than segment 10. Maxillary palpus
elongate, apical segment about twice as long as
segment 10.
Pronotum. Much narrower than elytra, about
same width as head; anteriolateral angles
projecting strongly forward; sides narrowing
slightly posteriorly, posterolateral angles obtuse;
strongly reticulate, virtually impunctate except
towards front margin and rear corners. Long setae
at sides, more extensive towards front.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, almost parallel-sided,
smooth, covered with fine reticulation; a few
scattered small punctures, several rows of widely
spaced small punctures; a sparse row of large
shallow punctures adjacent to suture; a few
additional larger punctures with long setae, more
frequent towards sides; underside of elytron with
quite dense setiferous micropunctures at apex and
narrowly along suture line. Epipleuron not
differentiated, that part of elytron visible ventrally
Al \—=
j
t\
102
FIGURES 97-102. Nirripirti melroseensis: 97, lateral view of central lobe of aedeagus; 98, ditto dorsal view; 99,
paramere; 100, mesotrochanter and mesofemur; 101, metatrochanter and metafemur; 102 dorsal view. Scale bar
represents | mm (habitus only).
166
moderately broad in anterior quarter, then
gradually narrowing to apex.
Ventral surface. Prosternal process strongly
narrowed between coxae, not reaching
mesothorax, apical half relatively narrow, parallel-
sided, tip pointed, strongly arched in lateral view
with highest point (viewed ventrally) between
coxae. Mesocoxae in contact at midline.
Metasternum bluntly pointed in front in midline;
wings short, very narrow; broadly rounded in
midline behind. Metacoxal plates large, metacoxal
lines absent; strongly reticulate, virtually
impunctate; closely adpressed to first abdominal
ventrite. Ventrites 1 and 2 possibly fused, sutural
lines distinct, ventrites 3 to 5 mobile, moderately
reticulate, virtually impunctate except for a few
long central setae or bunch of long setae.
Legs. Protibia elongate, relatively broad, widest
near apex where it is about three times its basal
width; protarsi weakly expanded, segment 1
cylindrical, segment 2 about one-half length of
segment 1, segment 3 as long as segment 1,
deeply bifid, segment 4 very small and hidden
within lobes of segment 3, segment 5 narrow,
cylindrical, about one-half length of segment 3,
segments 1 to 3 with covering of adhesive setae;
claws short and simple. Mesotrochanter elongate
with a few fine setae at apex; mesofemur with
row of four to five strong spines along hind edge
in basal half; mesotarsi a little less expanded than
protarsi. Metatrochanter elongate/oval, apex
somewhat truncated; metafemur thin, lacking
spines; metatibia moderately curved, widening
somewhat towards apex; metatarsi elongate,
segment 1 longest, segment 4 shortest, in
combination segments 1 and 2 slightly shorter
than others, segments 2 to 5 without spines other
than at apex; claws weak.
Male. Little external difference between the
sexes. Median lobe of aedeagus broad, widening
slightly at apex; paramere broad, narrowing
towards apex, apex bent over (Figs 97-99).
Etymology
Named after the pastoral station on which it
was found.
Remarks
A moderate sized, elongate species, with head
and pronotum about the same width and much
narrower than elytra, rather squat metatrochanters
and thin metafemurs and metatibia which are
strongly curved in Bidessine fashion. Across the
rear of the head is a relatively wide band of small
setiferous punctures which are otherwise only
CHS WATTS & WF HUMPHREYS
present in the much larger N. darlotensis, which
was found in the same bore hole.
Nirripirti milgunensis sp. nov.
Types
Holotype: m: ‘BES 8661 Milgun Station, Earrie
Well, 25°07'22"S; 118°05'44"E, 27/8/2001, col.
W.F. Humphreys, T. Karanovic & J.M. Waldock’,
WAM 32993. Slide mounted.
Paratypes: 4; 1, as for holotype, SAMA; 3 (1
partial), as for holotype except ‘BES 8662, 28/8/
2001’, 2 (1 partial) WAM 32994-32995, 1
SAMA.
Description (number examined, 5) Figs 103-108
Habitus. Length 1.2-1.3 mm; elongate, almost
parallel-sided, relatively flat, very weakly
constricted at junction of pronotum/elytra;
uniformly light testaceous; hindwing vestigial,
reduced to tiny flap.
Head. Large, nearly as wide as elytra; smooth,
moderate reticulation with small even meshes,
virtually impunctate except a few near antennae
bases; subparallel in posterior half; eye remnant
absent. Antenna stout, segment 1 cylindrical,
segment 2 large oval, segments 3 to 5 thinner than
rest, segment 11 about 1.5 times as long as
segment 10. Maxillary palpus stout, segment 4
much longer than segment 3.
Pronotum. About as wide as elytra;
anteriolateral angles projecting strongly forward,
sides straight, base not constricted, posterolateral
angles obtuse; quite strongly reticulate, virtually
impunctate except towards front margin; some
long setae at side towards front.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, parallel-sided, smooth,
covered with strong reticulation; a few scattered
small punctures; additional larger punctures with
long setae, more frequent towards sides; setiferous
micropunctures over most of underside denser
near base, at apex and along suture line.
Epipleuron not differentiated, that part of elytron
visible ventrally broad in anterior fifth, then
progressively narrowing to near apex.
Ventral surface. Prosternal process relatively
narrow, strongly narrowed between coxae, not
reaching mesothorax, apical half spatulate, tip
pointed, strongly arched in lateral view with
highest point (viewed ventrally) between coxae.
Mesocoxae in contact at midline. Metasternum
broadly pointed in front in midline; wings short,
narrow; bluntly triangular in midline behind.
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 167
Metacoxal plates large, metacoxal lines absent;
virtually impunctate; moderately reticulate; closely
adpressed to first abdominal ventrite. Ventrites 1
and 2 fused, sutural lines distinct in inner half
indistinct laterally, ventrites 3 to 5 mobile,
virtually impunctate except for a few long central
seta or bunch of long setae.
Legs. Profemur relatively stout; protibia narrow,
widest at apex where it is about three times its
basal width; protarsi quite strongly expanded,
segment | broadly triangular, segment 2 not much
shorter that segment 1, segment 3 as long as
segment 1, deeply bifid, segment 4 very small and
hidden within lobes of segment 3, segment 5
narrow, broadening towards apex, a little curved,
about length of segment 3; segments | to 3 a little
asymmetric with the outer lobe larger than inner,
with dense covering of adhesive setae; claws short
and simple. Mesotrochanter elongate/oval with a
few fine setae at apex; mesofemur with row of
four to five strong spines along hind edge in basal
half; mesotarsi much less expanded than protarsi.
Metatrochanter large, oval, tip separated from
H. harea eh
metafemur; metafemur stout, lacking spines;
swimming-hairs sparse; metatibia weakly curved,
widening slightly towards apex; metatarsi stout,
elongate, impunctate, segment 1 longest, segment
5 twice the length of segment 4, segments 2 and 3
subequal, segments 1 and 2 in combination about
as long as others, segments 2 to 5 without spines
other than at apex; claws weak.
Male. Little difference from female. Median
lobe of aedeagus narrowing rapidly in apical
quarter; paramere broad at base, apical half thin,
tip with a bunch of long setae (Figs. 103-105).
Etymology
Named after the pastoral station on which it
was found.
Remarks
A very small species, virtually lacking any trace
of an eye remnant, pronotum not constricted,
strong spines on the mesofemur, large
metatrochanters, and metatarsal segment 4 only
about one-half the length of segment 3.
=
2 a%
B R
Y
Wp
K A
RK ZAN
108 //} \
FIGURES 103-108. Nirripirti milgunensis: 103, lateral view of central lobe of aedeagus; 104, ditto dorsal view;
105, paramere; 106, mesotrochanter and mesofemur; 107, metatrochanter and metafemur; 108 dorsal view. Scale
bar represents | mm (habitus only).
168
Nirripirti napperbyensis sp. nov.
Types
Holotype: m: ‘BES 8091. NT: Napperby
Station., Bore RN 1561 at Herbert Well,
22°54'32"S 132°43'45"E, 17/6/2001, Col. W.F.
Humphreys & R. Read’, NTM I 001175. Slide
mounted.
Paratypes: 7; 5, as for holotype, 2 WAM
32996-32997, 3 SAMA; 2, as for holotype except
‘BES 8090’, WAM 32998-32999.
Description (number examined, 8) Figs 109-114
Habitus. Length 1.7-1.8 mm; elongate,
relatively flat, weakly constricted at junction of
pronotum/elytra; light testaceous, head a little
darker; hindwing vestigial, reduced to tiny flap.
Head. Large, broad, a little narrower than
elytra; smooth, very weakly reticulate, a few very
small scattered punctures; sides slightly
converging towards rear; eye remnant reduced to
a very short suture Antenna relatively thick,
.
109
110
112
CHS WATTS & WF HUMPHREYS
segment | cylindrical, segment 2 enlarged towards
apex, segments 3 and 4 much shorter and thinner,
segments 5 to 10 similar in shape, middle ones
slightly larger, segment 11 about twice as long as
segment 10. Maxillary palpus stout, elongate,
segment 4 twice as long as segment 3, some long
setae towards apex of segments.
Pronotum. Almost same width as elytra;
anteriolateral angles projecting strongly forward;
sides weakly curved, weakly constricted before
base; posterolateral angles acute; weakly
reticulate, sparse small punctures, larger punctures
laterally, denser towards front; long setae at sides
in anterior half.
Elytra. Not fused, lacking inner ridges;
elongate, widest behind middle, smooth, very
weakly reticulate, a few scattered small punctures,
several loose rows of widely spaced small
punctures, a few additional larger punctures with
long setae; underside of elytron with numerous
evenly spaced setiferous micropunctures more
frequent towards sides and denser towards apex.
C| [S
7 A
- ®
\
N 4
<<
KER Sew,
SS
LEB
SSS
Uta orc,
114
FIGURES 109-114. Nirripirti napperbyensis: 109, lateral view of central lobe of aedeagus; 110, ditto dorsal view;
111, paramere; 112, mesotrochanter and mesofemur; 113, metatrochanter and metafemur; 114 dorsal view. Scale
bar represents 1 mm (habitus only).
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS
Epipleuron not differentiated, that part of elytron
visible ventrally present only at extreme base.
Ventral surface. Prosternal process strongly
narrowed between coxae, not reaching
mesothorax, apical half broad, diamond shaped,
tip sharply pointed, strongly arched in lateral view
with highest point (viewed ventrally) between
coxae. Mesocoxae in contact at midline.
Metasternal plate bluntly pointed in front in
midline; wings short, narrow; broadly rounded in
midline behind. Metacoxal plates large, metacoxal
lines weak, well separated, diverging in anterior
half, not reaching metasternum; virtually
impunctate, weakly reticulate; closely adpressed
to first abdominal ventrite. Ventrites fused, sutural
lines distinct in inner half absent laterally,
ventrites 3 to 5 mobile, virtually impunctate
except for a few long central seta or bunch of
long setae.
Legs. Protibia narrow, widest near apex
where it is about twice its basal width; protarsi
moderately expanded, segment 1 broadly
triangular, segment 2 about one-half length of
segment 1, segment 3 as long as segment 1,
deeply bifid, segment 4 very small and hidden
within lobes of segment 3, segment 5 narrow,
cylindrical, about 1.5 times length of segment
3, segments 1 to 3 with adhesive setae; claws
short and simple. Mesotrochanter elongate
with a few fine setae at apex; mesofemur with
row of four strong setae/spines along hind
edge in basal half; mesotarsi narrower and
longer than protarsi. Metatrochanter relatively
large, oval, apex well separated from
metafemur; metafemur relatively stout, lacking
spines; metatibia weakly curved, widening
slightly towards apex; metatarsi with segment
1 longest, segment 4 shortest, in combination
segments 1 and 2 much shorter than others,
segments 2 to 5 without spines other than at
apex; claws weak.
Male. Little external difference between the
sexes. Median lobe of aedeagus short, flat,
narrowing rapidly to sharp tip; paramere broad,
apical half relatively broad, apex rounded (Figs
109-111).
Etymology
Named after the type locality.
Remarks
A moderately sized Northern Territory species
/with the ventrally visible parts of the elytra very
short, and a broad pronotal process with a relative
long sharp tip.
169
Nirripirti newhavenensis sp. nov.
Types
Holotype: m: ‘BES 6681: NT: Newhaven
Station, bore RN _ 12787; 22°43'41"S;
131°09'59"E; 15/6/2001. Col. W.F. Humphreys &
A. Russ’, NTM I 001176. Slide mounted.
Paratypes: 9; 4, as for holotype, 2 WAM
33000-33001, 2 SAMA; 2, ditto except ‘BES
6665’ WAM 33002-33003; 3, as for holotype
except “BES 6680’, 1 WAM 33004, 2 SAMA.
Description (number examined, 10) Figs 115-120
Habitus. Length 1.5-1.7 mm; elongate,
relatively flat, moderately constricted at junction
of pronotum/elytra; uniformly very light
testaceous; hindwing vestigial, reduced to tiny
flap.
Head. Large, broader than long, nearly as wide
as elytra; smooth, a few scattered small punctures,
moderately reticulate; sides subparallel in
posterior half; eye remnant reduced to a short
broad suture in middle near side. Antenna stout,
segment 1 wide cylindrical, segment 2 large oval,
segments 3 and 4 much shorter and narrower,
segments 5 and 6 approximately the same shape
but narrower at base, segments 7 to 8 same shape
becoming progressively slightly narrower,
segment 11 nearly twice as long and about same
width as segment 10. Maxillary palpus elongate,
segment 4 longer than segment 3, some long setae
towards apex of segments.
Pronotum. About as wide as elytra;
anteriolateral angles projecting strongly forward;
base moderately narrowed, posterolateral angles
obtuse; moderately reticulate, virtually impunctate
except for some relatively strong punctures
towards sides and front margin. Long setae at
sides particularly towards the front.
Elytra. Not fused, lacking inner ridges;
elongate, sides narrowing slightly towards apex,
smooth, moderately reticulate, disc covered with
moderately sized punctures, absent at sides; a few
additional larger punctures with long setae, more
frequent towards sides; setiferous micropunctures
over much of underside of elytron except towards
sides. Epipleuron not differentiated, that portion
of elytron visible ventrally relatively broad for all
but apical portion of elytron.
Ventral surface. Prosternal process strongly
narrowed between coxae, not reaching
mesothorax, apical half spatulate, strongly arched
in lateral view with highest point (viewed
ventrally) between coxae. Mesocoxae in contact at
midline. Metasternum bluntly pointed in front in
170
midline; wings very short; broadly rounded in
midline behind. Metacoxal plates large, reaching
episternum, metacoxal lines absent; moderately
reticulate, virtually impunctate; closely adpressed
to first abdominal ventrite. Ventrites 1 and 2
fused, sutural lines distinct, ventrites 3 to 5
mobile, virtually impunctate except for a few long
central setae or bunch of long setae.
Legs. Protibia narrow, widest at apex where it is
about twice its basal width; protarsi quite strongly
expanded, segment | broadly oval, segment 2 about
one-half length of segment 1, segment 3 as long as
segment 1, deeply bifid, segment 4 very small and
hidden within lobes of segment 3, segment 5
narrow, cylindrical, about 1.5 times length of
segment 3, segments 1 to 3 with dense covering of
adhesive setae; claws short and simple.
Mesotrochanter narrowly oval with a few fine setae
at apex; mesofemur with row of four to five strong
spines along hind edge in basal half; mesotarsi not
expanded, much narrower and longer than protarsi.
Metatrochanter large, bluntly pointed, apex well
CHS WATTS & WF HUMPHREYS
separated from metafemur; metafemur relatively
broad, lacking spines; metatibia weakly curved,
widening slightly towards apex; metatarsi relatively
stout, segment 1 longest, segment 4 shortest, in
combination segments 1 and 2 much shorter than
others, segments 2 to 5 without spines other than at
apex; claws weak.
Male. Little difference from female. Median
lobe of aedeagus narrowing rapidly in apical
quarter; paramere relatively broad, apex blunt
(Figs 115-117).
Etymology
Named after the type locality.
Remarks
A relatively small, lightly chitinised species
with a large second antennal segment and the
sides of the elytra wrapping over the abdomen for
most of their length. Separated from the relatively
similar N. wedgeensis by its larger size and quite
strongly constricted base of the pronotum.
115 116 =
aw
O iS
118 IG Ss!
KA |
f RO yj;
ae Wat
119 120 | ‘
LN H
FIGURES 115-120. Nirripirti newhavenensis: 115, lateral view of central lobe of aedeagus; 116, ditto dorsal view;
117, paramere; 118, mesotrochanter and mesofemur; 119, metatrochanter and metafemur; 120, dorsal view. Scale
bar represents 1 mm (habitus only).
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 171
Nirripirti pentameres sp. nov.
Types
Holotype: m: ‘BES 6687: NT: Newhaven
Station, Camel Well RN 15494, 22°22'56"S
131°11'23"E, 15/6/2001, col. W.F. Humphreys &
A. Russ’, NTM I 001177. Slide mounted.
Description (number examined, 1) Figs 121-126
Habitus. Length 2.2 mm; elongate, relatively
flat, slightly depressed in sutural region, not
constricted at junction of pronotum/elytra;
uniformly light testaceous; hindwing vestigial,
reduced to tiny flap.
Head. Large, narrower than elytra; smooth, very
weakly reticulate, scattered small punctures; sides
slightly converging in posterior half; eye remnant
reduced to a short suture in middle near edge.
Antenna relatively thin, segment 1 stout
cylindrical, segment 2 slightly oval, segments 3
and 4 much thinner and shorter, segments 5 to 10
triangular, middle segments slightly larger,
segment 11 nearly twice length of segment 10.
Maxillary palpus elongate, segment 4 longer than
segment 3.
eee
Pronotum. About as wide as_ elytra;
anteriolateral angles projecting strongly forward;
sides weakly diverging posteriorly, not narrowed
at base, posterolateral angles acute; scattered small
punctures denser at sides; some long setae at sides
in anterior half.
Elytra. Not fused, lacking inner ridges;
elongate, widest in middle, smooth, a few
scattered small punctures; a few additional larger
punctures with long setae, more frequent towards
sides; underside with scattered setiferous
micropunctures over most of surface, denser
towards apex and along suture line. Epipleuron
weakly differentiated from rest of elytron, that
part of elytron visible ventrally broad in anterior
quarter, then gradually narrowing to middle,
virtually absent along rest of elytron.
Ventral surface. Prosternal process damaged in
specimen, Mesocoxae in contact at midline.
Metasternum sharply pointed in front in midline;
wings very narrow; broadly rounded in midline
behind. Metacoxal plates large, metacoxal lines
absent; with sparse uniform covering of small
punctures; closely adpressed to first abdominal
ventrite. Ventrites 1 and 2 fused, sutural lines
126
FIGURES 121-126. Nirripirti pentameres: 121, lateral view of central lobe of aedeagus; 122, ditto dorsal view;
123, paramere; 124, mesotrochanter and mesofemur; 125, metatrochanter and metafemur; 126, dorsal view. Scale
bar represents | mm (habitus only).
172
distinct, ventrites 3 to 5 mobile, moderate number
of small punctures and a few long setae or small
bunch of long setae in the middle of each
segment.
Legs. Protibia narrow, widest near apex where
it is about twice its basal width; protarsi not
expanded, segments 1 to 3 relatively small,
subequal, segment 3 weakly bilobed, segment 4
about one-third length of segment 3, not hidden in
lobes of segment 3, segment 5 robust, cylindrical,
about twice the length of segment 3, segments 1
to 3 without adhesive setae; claws relatively
strong. Mesotrochanter elongate with a few fine
setae at apex; mesofemur with row of five to six
strong spines along hind edge in basal half;
mesotarsi similar to protarsi. Metatrochanter
elongate/oval; metafemur elongate, lacking spines;
metatibia weakly curved, approximately the same
width throughout; metatarsi elongate, segment 1
longest, segment 4 shortest, in combination
segments 1 and 2 a little shorter than others,
segments 2 to 5 without spines other than at apex;
claws weak.
Male. Female unknown. Median lobe of
aedeagus short, broad, flat with sharp tip;
paramere with relatively broad apical half, apex
rounded (Figs 121-123).
Etymology
Latin. ‘Penta meres’ — five segments; based on
its obviously five-segmented protarsus.
Remarks
A moderate sized, distinctive species, with
narrow protibia, small head and no constriction at
the junction of pronotum and elytra. The pro- and
mesotarsi are elongate, cylindrical, with the third
segment only weakly bifid, exposing the relatively
large fourth segment. This trend is also apparent
in other Northern Territory Nirripirti but is more
pronounced in this species.
Nirripirti plutonicensis sp. nov.
Types
Holotype: m: ‘BES 8606; Three Rivers Station,
bore MB4 Plutonic Borefield; 25°16'43"S
119°11'00"E; 26/8/2001. coll. W.F. Humphreys,
T. Karanovic & J.M. Waldock’, WAM 33005.
Slide mounted.
Paratypes 97; 11, as for holotype, 4 WAM
33006-33009, 5 SAMA; 8, ‘BES 8651, Three
Rivers Station, Limestone Well, 25°16'43"S
119°11'00"E, 26/8/2001, coll. W.F. Humphreys,
CHS WATTS & WF HUMPHREYS
T. Karanovic & J.M. Waldock’, 7 WAM 33010—
33016, 1 SAMA; 7 ditto except ‘BES 8625’, 3
WAM 33017-33019, 4 SAMA; 9, ‘BES 8620,
Three Rivers Station, MB5, Plutonic Borefield,
25°16'43"S 119°11'00"E, 26/8/2001, coll. W.F.
Humphreys, T. Karanovic & J.M. Waldock’, 5
WAM 33020-33024, 4 SAMA; 41, ‘BES 8611/2,
Three Rivers Station, Site 312, disused production
bore, Plutonic’ Borefield, 25.26745°S
119.16398°E, 26/8/2001, coll. W.F. Humphreys,
T. Karanovic & J.M. Waldock’, 10 WAM 33793-
33802, 31 SAMA; 2, ‘BES 8639, Three Rivers
Station, bore MB1, Plutonic Borefield,
25.29213°S 119.18107°E, 26/8/2001, coll. W.F.
Humphreys, T. Karanovic & J.M. Waldock’,
SAMA; 16, ‘BES 8656/7, Three Rivers Station,
bore MB2, Plutonic Borefield, 25.27360°S
119.17200°E, 26/8/2001, coll. W.F. Humphreys,
T. Karanovic & J.M. Waldock’, 10 WAM 33803-—
33812, 6 SAMA; 3 (1 partial), ‘BES 8642, Three
Rivers Station, new unused bore next to Gascoyne
River; 25.11780°S 119.15115°E, 27/8/2001, coll.
W.F. Humphreys, T. Karanovic & J.M. Waldock’,
SAMA.
Description (number examined, 98) Figs 127-132
Habitus. Length 3.0-3.5 mm; elongate oval,
relatively flat, moderately constricted at junction
of pronotum/elytra; uniformly testaceous;
hindwing vestigial, reduced to tiny flap.
Head. Large about same width as pronotum;
smooth, moderately strong reticulation with small
even meshes, virtually impunctate except a few
near antennae bases; subparallel in posterior half;
eye remnant reduced to short faint suture, not
always visible. Antenna relatively thin, segments
3 to 4 thinner than rest, segment 11 a bit longer
and narrower than segment 10. Maxillary palpus
elongate, segment 4 a little longer than segment 3.
Pronotum. A little narrower than elytra;
anteriolateral angles projecting strongly forward;
base weakly narrowed, posterolateral angles
obtuse; quite strongly reticulate, moderate number
of scattered punctures and row along front margin.
Sides with numerous long setae particularly
towards front.
Elytra. Not fused but tightly closed, lacking inner
ridges; elongate, nearly parallel-sided, smooth,
covered with moderately strong reticulation;
sparsely covered with small punctures, several
indistinct rows of widely spaced small punctures; a
few additional larger punctures with long setae,
more frequent towards sides, underside covered
with setiferous micropunctures, denser towards
apex and along suture line. Epipleuron not
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 173
differentiated from rest of elytron, that part of
elytron visible ventrally broad in anterior fifth, then
rapidly narrowing to middle.
Ventral surface. Prosternal process quite
narrow, strongly narrowed between coxae, not
reaching mesothorax, apical half spatulate, tip
rounded; strongly arched in lateral view with
highest point (viewed ventrally) between coxae.
Mesocoxae in contact at midline. Metasternum
bluntly pointed in front in midline; wings absent;
broadly rounded in midline behind. Metacoxal
plates large, metacoxal lines absent; virtually
impunctate; strongly reticulate; closely adpressed
to first abdominal ventrite. Ventrites 1 and 2
fused, sutural lines distinct in inner half indistinct
laterally, ventrites 3 to 5 mobile, virtually
impunctate except for a few long central seta or
bunch of long setae.
Legs. Profemur with weak peg-like seta on hind
edge adjacent to trochanter; protibia narrow,
almost parallel-sided in apical half; protarsi
expanded, segment 1 broad, segment 2 about one-
half length of segment 1, segment 3 as long as
4. WAReg
segment 1, deeply bifid, segment 4 very small and
hidden within lobes of segment 3, segment 5
narrow, cylindrical, about length of segment 3,
segments | to 3 with dense covering of adhesive
setae; claws short and simple. Mesotrochanter
elongate with a few fine setae at apex; mesofemur
with row of six to eight strong spines along hind
edge in basal half; mesotarsi a little less expanded
than protarsi. Metatrochanter elongate/oval;
metafemur thin, elongate, lacking spines;
metatibia very weakly curved, approximately the
same width throughout; metatarsi elongate,
segment 1 much longer than others, segment 5
about 1.5 times length of segment 4, segments 2
and 3 subequal in length, segments 1 and 2 in
combination a little longer than others, segments
2 to 5 without spines other than at apex; claws
weak.
Male. Little external difference between sexes.
Median lobe of aedeagus sinuate in lateral view,
narrowing to sharp point in apical half; paramere
broad at base, apical half thin, tip with a bunch of
long setae (Figs 127-129).
H.W Amon,
1327 \
FIGURES 127-132. Nirripirti plutonicensis: 127, lateral view of central lobe of aedeagus; 128, ditto dorsal view;
129, paramere; 130, mesotrochanter and mesofemur; 131, metatrochanter and metafemur; 132, dorsal view. Scale
bar represents | mm (habitus only).
174
Etymology
Named after the borefield in which it was
found.
Remarks
A large strongly chitinised species with elytra
not wrapping around abdomen, without
metasternal wings, long thin hind legs and
narrowly oval metatrochanters.
Nirripirti skaphites sp. nov
Types
Holotype: m: ‘Karalundi, unlined well, 26°08'S;
118°41'E, 28/5/2001, coll.# 339-2 C.H.S. & G.A.
Watts’, WAM 33813. Slide mounted.
Paratypes: 3, as for holotype, 2 SAMA, 1
WAM 33814.
Description (number examined, 4) Figs 133-138
Habitus. Length 2.1-2.3 mm; elongate, boat-
shaped, relatively flat, not constricted at junction
of pronotum/elytra; uniformly light testaceous;
hindwing vestigial, reduced to tiny flap.
Os
0 =S—>
137
CHS WATTS & WF HUMPHREYS
Head. Small, about half width of elytra;
smooth, moderately strong reticulation with small
even meshes, virtually impunctate except a few
near antennae bases and on disc; sides slightly
curved in posterior half; eye remnant reduced to a
short suture in middle near anterior edge. Antenna
moderately thick, segment 1 cylindrical, segment
2 widening towards apex, segments 3 to 10
approximately equal in length, widening
progressively to segment 5, segment 11 about
twice length of segment 10. Maxillary palpus
elongate, segment 4 about twice length of segment
3.
Pronotum. Narrower than elytra; anteriolateral
angles projecting strongly forward; sides slightly
diverging towards rear; posterolateral angles
obtuse; strongly reticulate, a few small scattered
punctures; numerous long setae at sides towards
front.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, widest in middle, smooth,
covered with fine reticulation; a few scattered
small punctures, underside with a few setiferous
micropunctures at apex, a few additional larger
punctures with long setae, more frequent towards
FIGURES 133-138. Nirripirti skaphites: 133, lateral view of central lobe of aedeagus; 134, ditto dorsal view; 135,
paramere; 136, mesotrochanter and mesofemur; 137, metatrochanter and metafemur; 138, dorsal view. Scale bar
represents 1 mm (habitus only).
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 175
sides. Epipleuron not differentiated, that part of
elytron visible ventrally very broad until close to
apex of elytron.
Ventral surface. Prosternal process strongly
narrowed between coxae, not reaching
mesothorax, apical half broadly spatulate, weakly
pointed, strongly arched in lateral view with
highest point (viewed ventrally) between coxae.
Mesocoxae in contact at midline. Metasternum
pointed in front in midline; wings short; broadly
rounded in midline behind. Metacoxal plates
large, metacoxal lines absent; a few small
scattered very small punctures; closely adpressed
to first abdominal ventrite. Ventrites 1 and 2
fused, sutural lines distinct in inner two-thirds but
absent laterally, ventrites 3 to 5 possibly
immobile, virtually impunctate except for a few
long central seta or bunch of long setae.
Legs. Protibia narrow, widest near apex
where it is about twice its basal width; protarsi
weakly expanded, segment 1 rectangular,
segment 2 about one-half length of segment 1,
segment 3 about as long as segment 1, deeply
bifid, segment 4 very small and hidden within
lobes of segment 3, segment 5 narrow,
cylindrical, about twice length of segment 3,
segments 1 to 3 with covering of adhesive
setae; claws short and simple. Mesotrochanter
elongate, rather angular, with a few fine setae
at apex; mesofemur with row of five to six
strong spines along hind edge in basal half;
mesotarsi slightly less expanded than protarsi.
Metatrochanter relatively broad, sharply
pointed; metafemur elongate, lacking spines;
metatibia weakly curved, widening a little
towards apex; metatarsi elongate, segment 1
longest, segment 4 shortest, in combination
segments 1 and 2 same length as others,
segments 2 to 5 without spines other than at
apex; claws weak.
Male. Antenna a little stouter. Median lobe of
the aedeagus narrow, narrowing in apical quarter;
paramere broad at base, apical half thin, tip with a
long setae (Figs 133-135).
Etymology
Latin. “Skaphites’ — boat-like.
Remarks
A moderate sized species with small head and
no pronotal constriction, which give it a
pronounced boat-like shape. The sharply pointed
metatrochanters are also distinctive and separate it
from the rather similarly shaped but smaller N.
killaraensis.
Nirripirti stegastos sp. nov.
Types
Holotype: m: ‘Karalundi, un-lined well; 6°08'S;
118°41'E, 28/5/2001, coll. C.H.S. & G.A. Watts’,
WAM 33815.
Paratypes: 2, as for holotype, 1 WAM 33816, 1
SAMA.
Description (number examined, 3) Figs 139-144
Habitus. Length 3.6-3.8 mm; elongate,
relatively flat, slightly depressed in sutural region,
weakly constricted at junction of pronotum/elytra;
uniformly light testaceous; hindwing vestigial,
reduced to tiny flap.
Head. A little narrower than elytra; smooth,
moderate reticulation with very small even
meshes, a few scattered small punctures; sides
subparallel in posterior half; eye remnant reduced
to a small suture in middle near anterior edge.
Antenna thin, segments 1 and 2 cylindrical,
segment 3 about same length as segment 2 but
much narrower, segment 4 a little shorter,
segments 5 to 9 broader with narrow bases,
segment 6 widest, segment 11 1.5 times length of
segment 10. Maxillary palpus elongate, segment 4
a little longer than segment 3.
Pronotum. A little narrower than elytra;
anteriolateral angles projecting strongly forward;
sides slightly converging towards rear, weakly
constricted just before base, posterolateral angles
obtuse; weakly reticulate, virtually impunctate
except for a row of strong punctures along front
margin; long setae at sides in anterior third;
moderately strongly reticulate with very small
even meshes.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, almost parallel-sided,
smooth, covered with fine reticulation; virtually
impunctate except for a few moderate sized
punctures with long setae, more frequent towards
sides; underside of elytron with dense setiferous
micropunctures towards apex. Epipleuron very
weakly differentiated from rest of elytron, that
part of elytra visible ventrally very broad along
almost the entire length of elytron, tightly
enclosing body.
Ventral surface. Prosternal process strongly
narrowed between coxae, not reaching
mesothorax, apical half narrowly triangular, tip
rounded, strongly arched in lateral view with
highest point (viewed ventrally) between coxae.
Mesocoxae in contact at midline. Metasternum not
produced forward in midline; wings relatively
short, very narrow; broadly rounded in midline
176
H. Hamors.
41
f
139 140 1
ES
143 >
CHS WATTS & WF HUMPHREYS
KIKIDIOO
9299900.
=,
g
Ee
Cd
s
—
i}
Y
= |]
7 S
a)
\ y J
—\ \ SS |)
AW. Hamoek. //
vy
144
FIGURES 139-144. Nirridessus stegastos: 139, lateral view of central lobe of aedeagus; 140, ditto dorsal view;
141, paramere; 142, mesotrochanter and mesofemur; 143, metatrochanter and metafemur; 144, dorsal view. Scale
bar represents 1 mm (habitus only).
behind. Metacoxal plates large, metacoxal lines
absent; virtually impunctate; closely adpressed to
first abdominal ventrite. Ventrites 1 and 2 fused,
sutural lines distinct in inner half, indistinct
laterally, ventrites 2 and 3 possibly fused, ventrites
4 to 5 mobile, virtually impunctate except for a
few long central seta or bunch of long setae; finely
reticulate with small even meshes.
Legs. Protibia very narrow, widest just past
middle where it is about twice its basal width;
protarsi expanded, segment 1 short, broadly
triangular, segment 2 about one-half length of
segment 1, segment 3 about as long as segment 1
but narrower, deeply bifid, segment 4 very small
and hidden within lobes of segment 3, segment 5
narrow, cylindrical, relatively stout, about length
of segment 3, segments 1 to 3 with dense covering
of adhesive setae; claws short and simple.
Mesotrochanter elongate, bluntly pointed, with a
few fine setae at apex; mesofemur with row of
nine strong spines along hind edge in basal two-
thirds; mesotarsi a little narrower and more
elongate than protarsi. Metatrochanter moderately
large, elongate/oval apex rounded; metafemur
elongate, lacking spines; metatibia weakly curved,
widening slightly towards apex; metatarsi
elongate, segment 1 longest, segment 4 shortest,
in combination segments 1 and 2 slightly shorter
than others, segments 2 to 5 without spines other
than at apex; claws weak.
Male. Middle segments of antenna a little more
expanded than in the female. Median lobe of
aedeagus narrow, narrowing in apical quarter;
paramere narrowing in apical half, apex rounded
(Figs 139-141).
Etymology
Latin. ‘Stegastos’ — enclosed; a reference to the
enclosing elytra.
Remarks
A relatively large well chitinised species with
the elytra wrapping around the abdomen for most
of its length.
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS
Nirripirti wedgeensis sp. nov.
Types
Holotype: m: ‘BES 8066, NT: Central Mt
Wedge Station, bore RN 15504 at Coppocks Bore,
22°46'24"S_ 132°06'50"E, 17/6/2001, coll. W.F.
Humphreys & R. Read’, NT I 001178. Slide
mounted.
Paratypes: 5, as for holotype, 2 WAM 33817-
33818, 3 SAMA.
Description (number examined, 6) Figs 145-150
Habitus. Length 1.2-1.4 mm; elongate,
relatively flat, slightly constricted at junction of
pronotum/elytra; uniformly very light testaceous;
hindwing vestigial, reduced to tiny flap.
Head. Short, broad, narrower than elytra;
smooth, moderate reticulation with small even
meshes, virtually impunctate except a few near
antennae bases; slightly wider behind; eye
remnant reduced to a dark suture in middle near
anterior edge. Antenna relatively thick, segment 1
cylindrical, segment 2 broader towards apex,
segment 3 much shorter and narrower, segment 4
145 147
149
177
shorter, segment 5 about same length as segment
3 but wider, segments 6 to 10 subequal, becoming
progressively a little narrower, segment 11 about
twice length of segment 10. Maxillary palpus
stout, segment 4 about twice as long as segment
10.
Pronotum. As wide as elytra; anteriolateral
angles projecting strongly forward; base weakly
constricted, posterolateral angles acute;
moderately reticulate, virtually impunctate except
towards front margin.
Elytra. Not fused but tightly closed, lacking
inner ridges; elongate, widest near shoulders,
smooth, reticulation weak; numerous scattered
small punctures; a few additional larger punctures
with long setae, more frequent towards sides;
underside with numerous _ setiferous
micropunctures at base, apex and along suture
line. Epipleuron not differentiated from rest of
elytron, that part of elytron visible ventrally broad
in anterior quarter, then gradually narrowing to
near apex.
Ventral surface. Prosternal process strongly
narrowed between coxae, not reaching
H Wrhmeet
“ir.
Oe
oS
=
150
FIGURES 145-150. Nirridessus wedgeensis: 145, lateral view of central lobe of aedeagus; 146, ditto dorsal view;
147, paramere; 148, mesotrochanter and mesofemur; 149, metatrochanter and metafemur; 150, dorsal view. Scale
bar represents 1 mm (habitus only).
178 CHS WATTS & WF HUMPHREYS
mesothorax, apical half broad, spatulate, strongly
arched in lateral view with highest point (viewed
ventrally) between coxae. Mesocoxae in contact at
midline. Metasternum sharply pointed in front in
midline; wings absent; broadly triangular in
midline behind. Metacoxal plates large, metacoxal
lines absent; virtually impunctate; closely
adpressed to first abdominal ventrite. Ventrites 1
and 2 fused, sutural lines distinct, ventrites 3 to 5
mobile, virtually impunctate except for a few long
central setae or bunch of long setae.
Legs. Profemur broad; protibia narrow, widest
near apex where it is about three times its basal
width; protarsi expanded, segment 1 broadly
triangular, segment 2 about one-half length of
segment 1, segment 3 as long as segment 1,
deeply bifid, segment 4 very small and hidden
within lobes of segment 3, segment 5 narrow,
cylindrical, about length of segment 3, segments |
to 3 with covering of adhesive setae; claws short
and simple. Mesotrochanter elongate with a few
fine setae at apex; mesofemur with row of four to
five strong spines along hind edge in basal half;
mesotarsi a little less expanded than protarsi.
Metatrochanter relatively large, tip well separated
from metafemur, bluntly pointed; metafemur
elongate, lacking spines; metatibia curved,
approximately the same width throughout;
metatarsi elongate, segments 1 and 5 longest,
subequal, segments | and 2 in combination much
shorter than others, segments 2 to 5 without spines
other than at apex; claws weak.
TABLE 1. The distribution of stygal species of dytiscids amongst discrete calcrete bodies in the Yilgarn district of
Western Australia and the Ngalia Basin in the Northern Territory. The separate palaeodrainage systems (Fig. 151)
and the Indian Ocean (Western) and inland drainages are indicated.
Calcrete Palaeovalley Species 1
WESTERN DRAINAGES
1, Cue Murchison Tjirtudessus magnificus
2, Austin Downs Murchison Tjirtudessus challaensis
3, Challa North Murchison Tjirtudessus challaensis
4, Killara Murchison Nirripirti killaraensis sp nov.
5, Windimurra Murchison Tjirtudessus sp. 1
6, Karalundi Murchison Tjirtudessus karalundiensis sp. nov.
7, Three Rivers Station Gascoyne Bidessodes gutteridgei sp. nov.
8, Milgun Station Gascoyne Nirripirti hamoni sp. nov.
9, Landor Station Gascoyne
INLAND DRAINAGES
10, Paroo Carey Tjirtudessus eberhardi
11, Lake Violet Carey Tjirtudessus wilunaensis sp. nov
12, Uramurdah Lake Carey Tjirtudessus hahni
13, Hinkler Well Carey Tjirtudessus hinkleri
14, Mount Windarra Carey Tjirtudessus windarraensis
15, Melrose Station (Lake Darlot) Carey Nirripirti darlotensis sp. nov.
16, Depot Springs Raeside Tjirtudessus fridaywellensis
17, Pinnacles Stn Raeside Tjirtudessus pinnaclesensis
18, Lake Mason Raeside Tjirtudessus raesideensis
19, Yuinmery Raeside Tjirtudessus yuinmeryensis sp. nov.
20, Jundee Carnegie Tjirtudessus jundeeensis sp. nov.
21, Cunyu: Sweetwaters Nabberu Tjirtudessus cunyuensis sp. nov
22, Cunyu: SBF Nabberu Tjirtudessus bialveus sp. nov.
23, Napperby
24, Newhaven
25, Central Mount Wedge
Ngalia Basin: NT
Ngalia Basin: NT
Ngalia Basin: NT
Nirripirti macrocephalus sp nov.
Nirripirti newhavenensis sp. nov.
Nirripirti wedgeensis sp nov.
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 179
Male. Little external difference from female.
Median lobe of aedeagus broad, bluntly pointed;
paramere triangular (Figs 145-147).
Etymology
Named after Central Mount Wedge pastoral
station where it was collected.
Remarks
A very small almost parallel-sided species with
the base of the elytra noticeably wider than the
pronotum, which is only slightly constricted.
Separated from the slightly larger N.
newhavenensis from an adjacent calcrete by the
weakly constricted pronotum.
DISCUSSION
Associated fauna
The faunas associated with the Dytiscidae are
largely unworked at this stage with only the
Copepods having been studied in detail. Hence,
only an indication of the associated fauna is given
here. As is typical of stygofaunas, the associated
fauna is predominantly Crustacean including
Bathynellacea (Syncarida), Crangonyctoidea,
Ceinidae and Bogidiellidae (Amphipoda),
Oniscidea (Isopoda, including Haloniscus spp.),
Cyclopoida: Cyclopidae; Harpacticoida:
Diosacchidae, Ameiridae, Canthocamptidae
Species 2 Species 3
Tjirtudessus cueensis
Tjirtudessus cueensis
Tjirtudessus sp. 2
Nirripirti skaphites sp. nov.
Bidessodes limestoneensis sp. nov.
Nirripirti milgunensis sp. nov.
Tjirtudessus pulpa
Tjirtudessus morgani
Tjirtudessus morgani
Undescribed
Tjirtudessus lapostaae
Nirripirti melroseensis sp. nov.
Nirripirti hinzeae
Nirripirti fortisspina sp nov
Tjirtudessus masonensis
Tjirtudessus silus sp nov.
Tjirtudessus macrotarsus sp nov.
Nirripirti napperbyensis sp nov.
Tjirtudessus pentameres sp nov.
Tjirtudessus bigbellensis
Nirripirti. Undescribed sp.
Species 4
Tjirtudessus sp. 3
Nirripirti stegastos sp. nov.
Nirripirti hamoni sp nov.
Nirripirti plutonicensis sp. nov.
Kintingka kurutjutu
? Nirripirti larvae
Tjirtudessus sweetwatersensis sp nov.
180
CHS WATTS & WF HUMPHREYS
TABLE 2. Physicochemical environment recorded for various species of stygal Dytiscidae in the genera Bidessodes,
Nirripirti and Tjirtudessus. A single value or a range of values given. Note that the environment of all sites has not
been recorded.
Species Conductivity Temp. pH DO Depth to/ Calcrete
(mS cm") (°C) (mg L") of water
B. gutteridgei 2.38-3.54 25.1-26.6 7.18-7.96 —- 5-6/7-40 Three Rivers
B. limestoneensis 2.38 25.1 a s)s) - - Three Rivers
N. darlotensis 13.2 25.8 7.70 5.05 - Melrose
N. fortisspina 13.37 23.6 7.43 2.67 ~ Pinnacles
N. hamoni 1.66 25.1 7.78 110.5 Three Rivers
N. killaraensis 3.24 19.6 ~ - ~ Killara calcrete
N. macrocephalus — - - - - - Napperby, NT
N. melroseensis 13:2. 25.8 7.70 5.05 110.5 Melrose
N. milgunensis 1.66 25.1 7.78 - 110.5 Three Rivers
N. napperbyensis - - - - - Napperby, NT
N. newhavenensis 1.98 25.1 2.67/? Newhaven, NT
N. pentameres - — - - - Newhaven, NT
N. plutonicensis 1.82-11.49 25.0-26.6 7.14-7.96 -—- 3.5-5/11-40 Cunyu SBF
N. wedgeensis TAL 24.7 - - 2.5/10 Central Mount
Wedge, NT
T. bialveus 6.63-11.49 25.2-26.4 7.32-7.50 - 3.5/10 Cunyu SBF
T. cunyuensis 8.55 £72 8.30 - 8/0.5 Cunyu Sweetwater
T. jundeeensis - - - - 710.3 Jundee
T. macrotarsus 6.63 25.2 7.32 - 3.5/9.5 Cunyu SBF
T. silus 8.55 17.2 8.30 - 8/0.5 Cunyu Sweetwater
T. sweetwatersensis 8.55 17.2 8.30 - 8/0.5 Cunyu Sweetwater
T. wilunaensis 2.88 18.7 7.30 - - Millbillillie
T. yuinmeryensis 9.39-15.4 21.9-22.2 7.27-7.63 5.22-5.44 2.5/1 Yuinmery
Parastenocaridae (Copepoda) and Ostracoda.
Hydrobiidae (Gastropoda) are important
associates in the Ngalia Basin of the Northern
Territory (Table 3); however, in the Western
Fortescue Plains aquifer in the Pilbara, they occur
with Spelaeogriphacea but no Dytiscidae are
present (Poore & Humphreys 1998). Karanovic
(2003) recently described four new genera and
eight species in five families of Copepoda from
the Yilgarn region of Western Australia collected
as part of this study. Those indicated in Table 3
were directly associated with the dytiscids
collected here. Several species of Haloniscus
occur in some aquifers (Taiti & Humphreys 2001).
Site characteristics and water quality
As in previously reported work on Australian
stygal Dytiscidae, samples were collected from a
range of types of access into the groundwater
calcrete aquifers (Table 1, Fig. 151), including:
monitoring wells in working water borefields,
sometimes within metres of functioning pumps;
piezometers; aquifer exploration bores; uncased
mineral exploration bores; pastoral bores; and
hand dug pastoral wells, some of which would
have been enlarged traditional watering places
(Table 2).
Some of the sites containing stygal dytiscid are
quite saline (22 g L" or greater) (Watts &
Humphreys 2000) whereas others meet salinity
standards for drinking water. Groundwaters in the
Australian arid zone typically have high
concentrations of nitrates (Jacobson 1993); those
recorded in this study had a mean value of
80 mg L" nitrate (range 0-250 mg L”: Fig. 154).
Profiling various groundwaters in the Yilgarn
has not only exposed a great variety of waters but
has also shown that closely adjacent sites are often
quite different, revealing considerable
heterogeneity of groundwater (Table 4; Fig. 153).
Hydrogen sulphide is sometimes encountered in
the water (or disturbed from the sediments). At
Alice Well in the Austin Downs calcrete, greater
than 10 ppm H,S was recorded, far higher even
than that recorded in anchialine systems
containing profuse sulphur bacteria colonies
(Humphreys 1999a,b).
The distribution of the groundwater fauna and
181
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS
Z ‘ds‘u vigospiyoosy “jye seprigoipAH epodonsey ‘7H ‘| ‘ds'u viqoupiys04y ‘Jye sepriqoipAH :epodonsey ‘ds {vayiuaoy :euueoy :ovpliqospAH ‘[# 2] | UWINIOS UT
JoTUUUN x . [G27 . . e ‘aou “ds sisua€sawmuing snssapnialy
JJOLA DVT . CCITT oe 8 © ‘aou ‘ds sisuapunjim snssapnyily,
syayemyaoms nAund snjis *y, ‘sisuankuno *] e 28 e 6‘r ° e « ‘AOU ‘ds sisuassajpmjaams snssapniaty
sJayeMmyaoMg nkund SIsuassajoMjaams ‘J {sisuankuno “ 2 8 ° ee ‘aou “ds snpis snssapnyily
Aas ndunp snaajvig ‘ ° . ee ‘aou ‘ds snsupjosopu snssapnyaily
sopunr ° ‘OL ‘I ° . ‘aou ‘ds sisuaaapunt snssapniaily
slayemyooms nAund SnpIS *], ‘sisuassajoujaams *] 2. 8 . oe ‘aou ‘ds sisuanduno snssapnyaily
Ads ndung SNSADJOAIDUL *T, ° . ee ‘aou “ds snaajnig snssapnyaly
aspom Juno [eNUID T# . ‘aou ‘ds sisuaaspam 1yaidiss1N
Esisuaaiuoinjd "N
SIOATY BOIL ‘laspiuayins “g ‘sisuaauoisaun) “g . 2 ee ‘aou ‘ds sisuaauoinyd yard
UdATYMON, l# . ° ‘aou “ds savaupjuad yaidiin
Aqiadden, ° ‘aou ‘ds sisuauaapymau 141d1dt1N
Aqioddeny, snjoydaz0190U ‘NI . e ° oe ‘aou ‘ds sisuakqsaddou yard
un3|IW 1uowDy ‘N e ee “aou ‘ds sisuaunspiw 1y41d1441N
ISOl2IA sisuajoj4op "N ° ° eo. “aou “ds sisuaasosjau 141d1dsiN
Aqiadden sisuakqsaddpu ‘N ° oe ‘aou ‘ds snjpydasoso0u 1.411441
PIRES 8 ‘9% . ee ‘aou ‘ds sisuansnyyty yardisin
Ipunyesey ‘bp ‘Aou ‘ds sisuaipunjpspy snssapli4iy
SIOATY IY L sisuauns]iu ‘Ny . oe ‘aou ‘ds 1uowpy 14idiiN
sapovuulg € ‘7% . . “aou ‘ds puidssijsof y1di44iN
uONeIS IsO][9 II ‘Z ° ee ‘sou ‘ds sisuajopapp naldiusiN
SIOATY 9OIYL, sisuanuomnjd ‘Ny ‘laspisayins -g . ee - ‘aou “ds sisuaauojsau Sapossapig
SIOATY VOY L, sisuanuojnid ‘Ny ‘sisuaauojsauny “g . ee «ee ‘aou “ds 1aspisajin3 sapossapig
el ai Il O© 6 8 L 9 “8. (P re = oT
“€OOT WAOULILY SIMs snidumosojppvajsny ‘¢] :oepnduesoyjued ‘¢QQZ WAOULIEY 10d bilawuDfinyy ‘Z| ‘EQ6] UeUNee, voLfiond
SIAJSNID] DAYONIN ‘| VOVULIOUY :depLIOUY ‘¢QQZ SAOULIey Jaapunt psadoz1yIg ‘O] {EQOT WAOURIeY ISUMOpUYsnD D4sadozYIg “6 :oeplooeSOIG :eploonoedsey ‘7007
dAourIey mojo sdopako01uoy ‘8 ‘EQOQT WAouRILY snipjnoiaviun sdojakoo01uoy ‘1 “(E9BT SIS) Suvaiuva sdojrks0491 ‘9 “(TOOT Skeyduny{ 2 ddsaq stuamne’q)
isdalf Sdoprdossaly ‘§ EQOT WAOULILY apsijuainy] sdojokoniapw ‘“p ‘g66] SA2IyduINH 2 sINUaINeT] 2dseqg isyoo1g sdojoks0sap ‘¢ :aeutdopoka ‘1907 sAoryduiny
2 99Sag sIusiney] ipapysaga sdojokooH ‘7% tEOOT WAOuLIey wafary sdopokoyoy ‘{ :aveutdopoAoreH :aeptdojoh_ :epodopoAD L uwinjoo ut payouap ssaquinu satseds
“HIND ‘ET foeplosnAq ‘ZI {MIO ‘T] ‘epooenso ‘OT ‘eprodojok_ ‘6 ‘eproonordsey
“*g ‘epodadog ‘zy, ‘snostuojep{ :voplostuQ :epodos] ‘g ‘ovpr[aipisog ‘¢ faeplulag ‘p ‘vaproyoAuoSuelD ‘¢ ‘epodiydury ‘7 ‘epleoudg ‘[ :ajouap siaquinu uwimnjood
‘roded sty) ul poyiodal sussapnyaily pue aidan) ‘sapossapig e1ques oy) Ul seplosH<q [esAjs JO sorsods snorsea JO UONDAT[O YM payeloosse eunejosAIS “¢ ATAVL
CHS WATTS & WF HUMPHREYS
182
“QYONOTWD (OPE O¥e"T) asospapl ‘TT {ao19[eo Our VopUNE OT {a}9I9TE9 [JOM SINVEMIBIME “NAUND “6 ‘o}OIO]w doUa,f JOLUEg a1eIg ‘NAUND “g :9}0I9]89 JO[OLA OAL]
‘1 fajasoeo sapoeuulg ‘9 {9}019[BO YINOs AJOWIUIN A ‘*g ‘o}ID]VO [NUD BITTY “p ‘ajosofeo SIOATY SIL, “E ‘oyoJO]eS Ipunyesmey “7 -d}oI9[eo UNSTIA ‘T ‘Ise 0} SOM WO
poasoid sioquiny ‘eI[eNsny W9}soA4 JO UOITAI WIeS|TA oy) UT (ZuIpeys Joyed) swajsAs advurespoaryed pue (SuIpeys Joyxsep) Svore ajoI9[V Jo UONdO] CYL “1ST HANOI
ray ae
| soupy a
siete seme She {RG 7
dej| s}e19/eD al :
Weert
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 183
Pinnacles 432
Depth m
7.1
7.2
M@ pH
0 20 40
60 80
O Conductivity S/cm
ee ee ee ee ee ee ee eee
0) 1 2
3 4 5 6
@ DOgL-1
foe ge Ng ee oe Ne ht Ne me ee ee ee Nl a ge ee rn ne ee ee ee”
25 25.2
25.4
LC Temperature °C
FIGURE 152. Distribution of physicochemical profiles at the Pinnacles, the type locality of Nirripirti fortisspina
sp. nov.
the physicochemical environment within the
calcrete aquifers appear to be quite heterogeneous,
both within the groundwater profile and between
areas (Figs 152, 153). For example, closely
adjacent bores may yield consistently different
faunas and have different water quality and
profiles (Table 4; Fig. 153). Conversely, waters
with different DO profiles may have rather similar
faunas and provide no clear relationship between
DO concentration and stygofauna (Table 5; Fig.
155). Interpretation of such trends requires a more
detailed knowledge of water quality and
particularly of the section(s) of the profiles
inhabited by the various stygobites. It is possible
that attributes other than water quality, in a
physicochemical sense, are the determinants of
suitability for stygofauna; microbiological
characteristics appear to be important
determinants of the presence of stygofauna in
some German aquifers (H.J. Hahn, pers. comm.,
2002).
ACKNOWLEDGMENTS
We appreciate assistance in the field from J.
Waldock, R. Read, A. Russ, T. Karanovic, S. Cooper
and G. Watts. Numerous pastoralists and mining
companies and their staff provided invaluable
information and access. Field work in the Northern
Territory was enabled by P. Jolly, and material support
was received from the Water Resources Division,
Department of Lands Planning and Environment,
Northern Territory. R. Read provided planning and
logistical support and he and A. Russ accompanied the
fieldwork. K. Mc Phail is thanked for cleaning up late
drafts of the manuscript.
We would particularly like to thank H. Hamon for the
illustrations and for help in setting out the figures.
This work was supported by funds from the
Australian Biological Resources Study.
184 CHS WATTS & WF HUMPHREYS
-10
Depth m
72)
-20
oO
_
N
w
-
un
DO gL-1
Depth m
7.6 7.7 7.8 7.9
Ny
-20
-24
2.8 2.9 3 3.1
Conductivity S/cm
FIGURE 153. Profiles of physicochemical parameters through the water column of bores in the Hinkler calcrete
(Table 4). The two bores, denoted N (north) and S (south), were drilled for the Main Roads Department at the same
time to supply water and are less than 30 m apart. They have consistently yielded different fauna, even before they
were used for water abstraction.
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 185
TABLE 4. The distribution of taxa between the two TABLES. The distribution of taxa between bores in the
adjacent bores depicted in Fig. 153 Lake Violet area, depicted in Fig. 155
Taxon North South Taxon Pumpl1 OB3 OB4 OBS OBI
Amphipoda 4 3 Ostracoda 255 - - 9 66
Bathynellacea 98 431 Amphipoda 16 - 15 - 12
Dytiscidae 99 5 Bathynellacea 2 1 1 2 3
Copepoda 20 0 Dytiscidae 8 - 1 - 13
Copepoda 9 3 4 27 47
Count
Count
0 100 200 300
NO3
FIGURE 154. Distribution of iron (II) and nitrate in water samples from the Yilgarn groundwater calcrete samples.
Upper: iron (II) (mg L" Fe**) and lower: nitrate (mg L” nitrate)
186 CHS WATTS & WF HUMPHREYS
Depth m
FIGURE 155. The vertical distribution of oxygen in the Lake Violet borefield area, an area of major water
abstraction and the type area for Tjirtudessus wilunaensis sp. nov. The profiles are all from monitoring bores
closely adjacent to an actively pumping well-field. P1 is the observation bore (OB1) for Pump | as denoted in
Table 5.
REFERENCES
Bistrom, O. 1988. Generic review of the Bidessini
(Coleoptera, Dytiscidae). Acta Zoologica Fennica
184: 1-541.
Balke M, Watts CHS, Cooper SJB, Humphreys WF &
Vogler AP. 2003 A highly modified stygobiont
diving beetle of the genus Copelatus (Coleoptera,
Dytiscidae): taxonomy and cladistic analysis based
on mitochondrial DNAsequences. Systematic
Entomology 28: 1-9.
Cooper, S, Hinze, S, Leys, R, Watts, CHS &
Humphreys, WF. 2002. Islands under the desert:
molecular systematics and evolutionary origins of
stygobitic water beetles (Coleoptera: Dytiscidae)
from central Western Australia. Invertebrate
Systematics 16: 589-598.
Humphreys, WF. 1999a. Relict stygofaunas living in
sea salt, karst and calcrete habitats in arid
northwestern Australia contain many ancient
lineages. In W Ponder and D Lunney (eds) ‘The
Other 99%. The Conservation and Biodiversity of
Invertebrates’, pp. 219-227. Transactions of the
Royal Zoological Society of New South Wales,
Mosman.
Humphreys, WF. 1999b. Physico-chemical profile and
energy fixation in Bundera Sinkhole, an anchialine
remiped habitat in Northwestern Australia. Journal
of the Royal Society of Western Australia 82: 89-98.
Humphreys, WF. 2001. Groundwater calcrete aquifers
in the Australian arid zone: the context to an
unfolding plethora of stygal biodiversity. Jn WF
Humphreys & MS Harvey (eds) ‘Subterranean
Biology in Australia 2000’, pp. 63-83. Records of
the Western Australian Museum, Supplement No. 64.
Jacobson, G. 1993. High nitrate groundwater in the
Australian arid zone: origin of the nitrate and
possible denitrification technology. Australian
Geological Survey Organisation, Research
Newsletter 16: November 1993.
Karanovic, T. 2003. Subterranean copepods (Crustacea:
Copepoda) from arid Western Australia.
Crustaceana Supplement, in press.
Poore, GCB & Humphreys, WF. 1998. First record of
Spelaeogriphacea from Australasia: a new genus and
species from an aquifer in the arid Pilbara of Western
Australia. Crustaceana 71: 721-742.
Spangler, PJ. 1986. Insecta: Coleoptera. Jn L
Botosaneau (ed) ‘Stygofauna. A Faunistic,
Distributional, and Ecological Synthesis of the World
Fauna Inhabiting Subterranean Waters (Including the
Marine Interstitial).” pp. 622-631. EJ Brill: Leiden.
NEW DYTISCIDAE FROM AUSTRALIAN UNDERGOUND WATERS 187
Taiti, S & Humphreys, WF. 2001. New aquatic Watts, CHS & Humphreys, WF. 2000. Six new species
Oniscidea (Crustacea, Isopoda) from groundwater of Nirridessus and Tyirtudessus (Dytiscidae;
calcretes of Western Australia. /n WF Humphreys & Coleoptera) from underground waters in Australia.
MS Harvey (eds) ‘Subterranean Biology in Australia Records of the South Australian Museum 33: 127-
2000’, Records of the Western Australian Museum, 144.
Supplement No. 64: 133-151. Watts, CHS & Humphreys, WF. 2001. A new genus
Watts, CHS & Humphreys, WF. 1999. Three new and six new species of Dytiscidae (Coleoptera) from
genera and five new species of Dytiscidae underground waters in the Yilgarn palaeodrainage
(Coleoptera) from underground waters in Australia. system of Western Australia. Records of the South
Records of the South Australian Museum 32(2): Australian Museum 34: 99-114.
121-142.
PROVISIONAL CHECKLIST OF THE ASILIDAE (INSECTA : DIPTERA)
OF SOUTH AUSTRALIA, UTILISING AN UPDATED SUBFAMILY
CLASSIFICATION
ROBERT J. LAVIGNE
Summary
A provisional checklist of the Asilidae (robber flies) of South Australia is provided. Distribution
notes for individual species are provided, where available. The higher classification of the Asilidae,
as found in South Australia, is updated.
PROVISIONAL CHECKLIST OF THE ASILIDAE (INSECTA: DIPTERA) OF SOUTH
AUSTRALIA, UTILISING AN UPDATED SUBFAMILY CLASSIFICATION
ROBERT J LAVIGNE
LAVIGNE, RJ. 2003. Provisional checklist of the Asilidae (Insecta: Diptera) of South
Australia, utilising an updated subfamily classification. Records of the South Australian
Museum 36(2): 189-194
A provisional checklist of the Asilidae (robber flies) of South Australia is provided.
Distribution notes for individual species are provided, where available. The higher
classification of the Asilidae, as found in South Australia, is updated.
Robert J. Lavigne [
[email protected]]. Honorary Research Associate.
*Entomology, South Australia Museum, North Terrace, Adelaide, South Australia 5000; and
Professor Emeritus, Entomology, Department of Renewable Resources, College of Agriculture,
University of Wyoming, Laramie, WY 82070, USA; *address for correspondence. Revised
manuscript received 9 January 2003.
The purpose of this paper is threefold: a) to
provide currently known distributions of South
Australian robber flies (Insecta: Diptera:
Asilidae), as recorded in the published literature,
and to add to distributions of these predatory flies;
b) to provide citations for biological/behavioural
information for these same robber flies, where
available; and c) to update the classification of
South Australian Asilidae in line with recent
changes in subfamily classification.
Little is known of the distribution of South
Australian robber flies. The first published
reference dealing with species from South
Australia (SA) appeared in the second volume of
the Transactions and Proceedings and Report of
the Philosophical Society of Adelaide, South
Australia for 1878-9. In that volume Otto Tepper
(1879) wrote as follows: “The Asilidae and their
near allies comprise nineteen species, including
the giants of the order, which inhabit Yorke’s
Peninsula and adjacent parts, and measure one and
three quarter inches in length. All are
carnivorous.” Undoubtedly, he was referring to
members of the genus Phellus, which are the
largest known asilids. Unfortunately, no
individual species were listed.
During the 1950s Frank M Hull, author of the
two volume definitive work on the asilid genera
of the world, visited the SA Museum (SAM). As
a result of his visit, he described several species
of Bathypogon (Hull 1958a, b, c, d, 1959), with
the types of the following species being deposited
in the SA Museum: bidentatus (Holotype), calabyi
(Holotype), douglassi (Holotype), flavifemoratus
(Holotype), ichthyurus (Holotype), macrodonturus
(Holotype), nigrotibiatus (Holotype), ochraceus
(Holotype, Allotype, Paratype), ophiurus
(Holotype), robustus (Paratype), rubidapex
(Paratype), rufitarsus (Holotype, Allotype).
However, only five of these species were
described from South Australian specimens:
calabyi, ichthyurus, ochraceus, ophiurus and
rufitarsus.
In his extensive taxonomic revision of the
widespread Australian tribe Chrysopogonini,
Clements (1985) was only able to record seven
species (out of 49, representing four genera) as
occurring in South Australia. Clements (pers.
comm.), however, did not access the SA Museum
collection. Similarly, Daniels (1987), in his
revision of Neoaratus Ricardo with descriptions
of six allied new genera (58 species), recorded
only four species from South Australia.
In 1989 Daniels published the Family Asilidae,
as part of the Catalog of the Diptera of Australasia
and Oceanic Regions, a version of which may be
accessed on the internet (<http//
:hbs.bishopmuseum.org/aocat/asilidae.html>). In
it he recorded 36 species from South Australia,
without, however, providing data on their
distribution or indicating the basis for noting their
occurrence in SA. A search of the SA Museum
collection in July-August 2002 failed to reveal
any specimens other than types which had been
identified by Daniels. Subsequently, in September
2002, a visit was made to Melbourne to examine
Daniels’s extensive personal asilid collection to
see if it contained specimens from South
190
Australia, other than the collection made by RJ
Lavigne in 1978-79 which is contained therein.
During the visit, it was determined that much of
the material noted as occurring in South Australia
had been loaned to Daniels by the SA Museum.
Specimens had been identified, data recorded and
the specimens returned without identity labels.
This has now been rectified. Daniels kindly
provided access to his ledger and database so that
I might obtain SA records. It should be noted
however that, because of the infant state of
Australian asilid taxonomy, many of the SA
specimens in his collection were only identified to
genus. Consequently, only data dealing with
identified species has been incorporated into this
preliminary checklist.
Little has been accomplished in enumerating the
biology/behaviour of South Australian Asilids. A
start was made by Lavigne (1982a,b, 1984, 1992)
in which the behaviour of three species of
Cerdistus, a species of Neoscleropogon, a species
of Neocerdistus, two species of Colepia and a
species of Mauropteron were described, but
nothing more has since been published.
The classification of asilid subfamilies used in
this paper is an interim one based upon the recent
published works of Papavero (1973), Artigas &
Papavero (1988), and Lehr (2001). As pointed out
by Fisher and Wilcox (unpublished), such a
classification scheme provides a more uniform
system and appears to be a distinct improvement
over previous classification schemes. It is obvious
to many systematists that all available
classifications of Asilidae are flawed (principally
by a general lack of rigorous phylogenetic
analysis): and that it is to be expected that many
changes will be made as a result of future studies.
In 1878-79 only four subfamilies were
recognised: Asilinae, Dasypogoninae, Laphriinae
and Leptogastrinae (Tillyard 1926). Daniels
(1989) still only recognised the same four
subfamilies as occurring in the Australasian and
Oceanic region. Over the years the higher
taxonomy of the Asilidae has evolved
considerably, with new families being established
or tribes (as used by Daniels 1989) being elevated
to the status of subfamily, representatives of ten
of which are known to occur in Australia:
Apocleinae (Papavero 1973), Atomosiini to
Atomosiinae (Lehr 1977), Dioctriini to Dioctriinae
(Lehr 2001), Laphystini to Laphystinae (Papavero
1973), Ommatiini to Ommatiinae (Ricardo 1929),
Stenopogonini to Stenopogoninae (Paramonov
1966) and Stichopogonini to Stichopogoninae
(Artigas & Papavero 1988).
RJ LAVIGNE
Worldwide, 13 subfamilies are now considered
valid by many authors: Apocleinae, Asilinae,
Atomosiinae, Dasypogoninae, Dioctriinae,
Laphriinae, Laphystinae, Leptogastrinae,
Megapodinae, Ommatiinae, Stenopogoninae,
Stichopogoninae and Trigonominae.
The following checklist contains data on 52
species, representing 6 subfamilies and 21
genera, the names of which have appeared in the
published literature over the last 123 years. On
the basis of this census, there has been an
increase of, at least, 33 named species in South
Australia since Tepper’s original paper; however,
it is unclear how many species Tepper
considered to be robber flies and how many to
be carnivorous allies of the Asilidae. This listing
by no means represents the total number of asilid
species to be found in South Australia, but
stands as a base for an enlarged checklist that
will be based on material being currently
identified and stored in the SAM insect
collection, as well as material that is being
acquired by survey teams. Daniels (pers. comm.
2002) has suggested that, based on his studies,
there are well over 100 undescribed species of
Bathypogon alone, Australia-wide.
Within the checklist are included notations of
SA specimens identified by Daniels but which are
deposited in other museums. These abbreviations
used are as follows: AM — Australian Museum,
Sydney; ANIC —- Australian National Insect
Collection, Canberra, BMNH — British Museum
of Natural History; GDC - Greg Daniels
Collection; OX — Oxford University (Hope
Collections); WARI — Waite Agricultural
Research Institute, Adelaide.
CHECKLIST
Apocleinae
Blepharotes coriarius Wiedemann, 1830 [Daniels
1989] [Daniels, pers. comm.: Adelaide
(WARD). 25 Jan]
Blepharotes flavus Ricardo, 1913b [Daniels 1989]
[Daniels, pers. comm.: Adelaide; Parakalyia
Bore, Everard Pk. Stn., Port Lincoln. 2 Nov]
Asilinae
Asiola lemniscata Daniels, 1977 [Daniels 1989]
[Daniels 1977: 48. Paratypes: Immarna;
Kimba; Nundroo (Homestead), 5 mi W. 20-28
Oct] [Daniels, pers. comm.: Maya, 2 mi S.]
Cerdistus armatus (Macquart, 1846) [Lavigne
1982a (ethology, as Neoitamus armatus)}
CHECKLIST OF SOUTH AUSTRALIAN ASILIDAE 191
{Lavigne 1982a: 625. Aldinga Beach; Ferries-
McDonald Conservation Park, S of Monarto.
11 Dec — 31 Jan]
Cerdistus exilis (Macquart, 1838) [Hardy 1935b
(as Asilus exilis): 415. Kangaroo Isl. (South
Australia)] [Daniels 1989]
Cerdistus margitis (Walker, 1849) [Lavigne
1982a (ethology, as Neoitamus margites)]
{Lavigne 1982a: 625. Ferries-McDonald
Conservation Park, S of Monarto; Mortlock
Exp. Stn., Auburn; 3.3 km S of Echunga; 8 km
ENE of Callington. 11 Dec — 1 Mar. Lavigne
1982a]
Cerdistus neoclaripes Hardy, 1921 [Hardy 1935b
(as Neoitamus neoclaripes): 415. “South
Australia”, no date] [Daniels 1989]
Cerdistus rufometatarsus (Macquart, 1855)
{Hardy 1935b (as Asilus rufometatarsus); 416.
Adelaide (South Aust.), no date] [Daniels
1989]
Cerdistus rusticanoides Hardy, 1926 [Hardy
1935b: 410. “South Australia”, no date]
{Daniels 1989]
Cerdistus setifemoratus (Macquart, 1855)
[Daniels 1989]
Cerdistus vittipes (Macquart, 1847) [Lavigne
1982a (ethology, as Neoitamus vittipes)]
[Lavigne 1982a: 617-18. Adelaide; Keyneton,
4.5 km E; Kapunda, 2.7 km S, bank of Light
River; Kingston, 16 km N; Milang, 12 km SE,
3 & 8 km E, 10 km S; Morgan, 11.6 km NW;
Port Gawler; Port Wakefield. 23 Nov — 27
Mar] [Daniels, pers. comm.: Adelaide (GDC);
Virginia, ca. 6 km SW. 25 Nov — 1 Feb]
Colepia abludo Daniels, 1983 [Daniels 1983 (as
Neoaratus abludo): 233. Aldinga, 8.2 km S;
Aldinga Beach; Elizabeth; Hammond;
Lyndoch; Mortlock Exp. Station, Auburn. 30
Dec — 24 Jan] [Lavigne 1992 (ethology, as
Neoaratus abludo); Lawson & Lavigne 1984
(description of eggs)] [Daniels 1989 (as
Colepia)]
Colepia ingloria (Macleay, 1826) [Hardy 1935a
(as Neoaratus ingloria): 182. “South
Australia”, no date] [Daniels 1987 (biology,
pupal description)]
Colepia rufiventris (Macquart, 1838) [Hardy
1935a (as Neoaratus rufiventris): 185. “South
Australia”, no date] [Daniels 1987 (biology,
pupal description); Daniels 1989; Lavigne
1992 (ethology, as Neoaratus rufiventris)]
[Daniels 1987: 500. Belair; Blackwood;
Bridgewater; Engelbrook Reserve; Ferries-
McDonald Conservation Park; Hawthorndene;
Lobethal; Paracombe; Tailem Bend;
Tooborang, nr. Adelaide; Victory; Waitpinga,
no dates] [Lavigne 1992: 261. Kingston,
16km N, opp. Coorong Game Reserve; Mt
Barker. 18 Dec — 2 Mar] [Daniels, pers.
comm.: 1 Jan —7 Mar]
Mauropteron pelago Daniels, 1987 [Ricardo
1913b (as Asilus pelago): 443. Adelaide, no
date] [Hardy 1935a (as Neoaratus pelago):
186. “South Australia”, no date] [Daniels
1987 (biology): 510. Adelaide; Balgowan,
4km NE, nr. Maitland; Benif Station,
Coorong; Ferries-McDonald Conservation
Park; Flinders Isl.; Iron Baron; Kingston,
South-East; Lowan Station, 4 mi S of
Sherlock; Port Lincoln; Purnong, nr. Murray
Bridge; Seal Bay, Kangaroo Isl.; Sedan, 5 km
W; Sleaford Bay; Whyalla; Winceby Isl., no
dates] [Daniels 1989] [Lavigne 1992
(ethology, as Neoaratus pelago): 261. Ferries-
McDonald Conservation Park; Sedan, 5 km
W. 4 Dec — 5 Feb] [Daniels, pers. comm.:
Kimba, 32 km E; Nullarbor. 4 Dec — 4 Apr]
Neoaratus hercules (Wiedemann, 1828) [Daniels
1987 (biology, pupal description) : 513 [Castle
Hill, Kangaroo Isl.; Fleurieu Peninsula;
Kingscote, Kangaroo Isl.; Mt Lofty; Reedy
Creek, SE South Aust.; Tanunda, Upper Sturt;
Adelaide, no dates] [Daniels 1989] [Daniels,
pers. comm.: Norton Summit, nr Ashton;
Westridge (ANIC). 18 Nov — 21 Jan]
Neocerdistus acutangulatus (Macquart, 1847)
[Lavigne 1984: 422. One Tree Hill, E of
Elizabeth, nr. Para Wirra National Park. 5 — 30
Apr] [Lavigne 1984 (ethology); Daniels 1989]
Neoitamus mistipes (Macquart, 1850) [Ricardo
1913b: 433. Mt. Gambier, S. Australia, no
date] [Daniels, pers. comm.: Mt Compass,
Cox’s Scrub Nat. Pk., 12 km SE. 20 Jan]
Dasypogoninae
Apothechyla carbo (Walker, 1851) [Hardy 1934b
(as Rachiopogon carbo): 23. “South
Australia’, no date]
Brachyrhopala (Brachyrhopala) quadricincta
Bigot, 1879 [Clements 2000: 87. Horrocks
Pass, SE of Port Augusta, no date]
Chryseutria amphibola Clements, 1985 [Clements
1985: 82. Holotype 2, Paratype 2, Emu
Field, 300 mi NW of Woomera. Sept — Oct
1953] [Daniels 1989]
Chrysopogon agilis Clements, 1985 [Clements
1985: 8. “S Australia”] [Daniels 1989]
192
Chrysopogon albosetosus Clements, 1985
[Clements 1985: 21. Mt Serle, Flinders
Ranges, no date] [Daniels 1989]
Chrysopogon castaneus Clements, 1985
(Clements 1985: 29. “S. Aust.”, no date]
[Daniels 1989]
Chrysopogon pellos Clements, 1985 [Clements
1985: 58. Holotype ¢, Marla Bore, 30 mi W
of Melbourne Hills Homestead. 23 Mar]
[Daniels 1989]
Chrysopogon pilosifacies Clements, 1985
[Clements 1985: 60. Koonalda, 14 mi E. 17
Oct] [Daniels, pers. comm.: Fisher E-W Line
(AM); Port Augusta, SE of Horrocks Pass. 21
Nov] [Daniels 1989]
Chrysopogon rubidipennis White, 1918 [Clements
1985: 65 [SA “no locality”] [Daniels 1989]
Chrysopogon trianguliferus Clements, 1985
[Clements 1985: 72. Curnamona Station,
Yunta Highway, 7 mi N turn to Erudina
Woolshed, Wirrealpa Station, 1 km N
Marshals Corner Bore. 17 — 19 Feb] [Daniels
1989]
Dakinomyia froggattii Dakin & Fordham, 1922
(Daniels, pers. comm.: Nullarbor roadhouse,
183 km W. 23 Jan] [Daniels 1989]
Questopogon affinis Daniels, 1976 [Daniels,
1976: 229. Kimba, no date, E. Broomhead,
Paratype 2 [Daniels 1989]
Thereutria amaraca (Walker, 1849) [Daniels
1989] [Daniels, pers. comm.: Wilpena Pound,
Flinders Range. 19 — 20 Jan]
Thereutria tessellata (Hardy, 1930) [Daniels
1989] [Daniels, pers. comm.: Milang; Wilpena
Pound, Flinders Range. 8 — 19 Jan]
Laphriinae
Laphria rufifemorata Macquart, 1846 [Ricardo
1913a: 155. Bakewell, “S. Australia’, no date]
[Hardy 1934a: 520. “South Australia”, no
date]
Laphria telecles Walker, 1849 [Daniels, pers.
comm.: Ravine des Cas., Kangaroo Isl. 30
Nov]
Ommatiinae
Ommatius distinctus Ricardo, 1918 [Daniels, pers.
comm.: Flinders Isl., northern Arkaroola. 22
Jan]
Ommatius pilosus White, 1916 [Daniels 1989]
[Daniels, pers. comm.: Mortlock Exp. Stn.,
Auburn; Mt Lofty Botanical Gardens. 17 - 31
Jan]
RJ LAVIGNE
Ommatius queenslandi Ricardo, 1913 [Daniels,
pers. comm.: Wilpena Pound, Flinders Range.
19 Jan]
Stenopogoninae
Amphisbetetus trinotatus Paramonov, 1966
[Daniels 1989] [Daniels, pers. comm.:
Kalabity H.S., Birthday Rd, 5.6 km N. 15 Feb]
Bathypogon aoris (Walker, 1849) [Ricardo 1912:
153. Adelaide (Ent Club) (type female), no
date] [Hardy 1934b: 9. “South Australia”, no
date. (after Ricardo 1912)] [Daniels 1989]
[Daniels, pers. comm.: Adelaide (BMNH)]
Bathypogon calabyi Hull, 1958 [Hull 1958a: 199.
Owieandana, N. Flinders Range. Holotype 3]
[Daniels 1989]
Bathypogon chionthrix Hull, 1958 [Hull 1958c :
161. Kalamunda, no. date. Holotype 6,
Allotype 2] [Daniels 1989] [Daniels, pers.
comm.: Kimba, 32 km E. 21 Jan.]
Bathypogon ichthyurus Hull, 1958 [Hull 1958d:
187. L. Callabonna, no date. Holotype ¢]
[Daniels 1989] [Daniels, Pers. Comm.: Lk.
Callabonna, no date]
Bathypogon microdonturus Hull, 1958 [Hull
1958d: 190. Owieandana, N. Flinders Range,
no date. Holotype ¢] [Daniels 1989]
Bathypogon ochraceus Hull, 1959 [Hull 1959: 18:
Owieandana, N. Flinders R, no date. Holotype
3, Allotype 2, 4 Paratypes]; Daniels 1989]
Bathypogon ophiurus Hull, 1958 [Hull 1958b: 62.
Flinders Isl., no date. Holotype 6] [Daniels
1989] [Daniels, pers. comm.: Flinders Isl., no
date]
Bathypogon rufitarsus Hull, 1958 [Hull 1958b:
64.] Mt Serle, N. Flinders Range. Holotype ¢,
Allotype 2] (Daniels 1989] [Daniels, pers.
comm.: Keyneton, 6.4km E; Monarto; Mt
Serle, Flinders Range; Port Wakefield;
Virginia, ca. 6 km SW. 23 Nov — 11 Dec]
Bathypogon testaceovittatus (Macquart, 1855)
[Hardy 1934b: 8. Adelaide, South Australia]
[Daniels 1989] [Daniels, pers. comm.:
Adelaide (OX)]
Neoscleropogon agave (Walker, 1849) [Hardy
1928 (as Stenopogon agave), Hardy 1934b (as
Stenopogon agave): 15. “South Australia”
Neoscleropogon durvillei (Macquart, 1838)
[Daniels, pers. comm.: Port MacDonnell. 6 Jan]
Neoscleropogon lanatus (Walker, 1849) [Hardy
1928 (as Stenopogon lanatus), Hardy 1934b
(as Stenopogon lanatus): 14. “South
Australia’’}
CHECKLIST OF SOUTH AUSTRALIAN ASILIDAE
Neoscleropogon macquarti Daniels, 1989
[Ricardo 1912 (as Neoscleropogon elongatus):
156. “S. Australia”] [Lavigne 1982b, as
Neoscleropogon elongatus (ethology)]
[Lavigne 1982b: 742-43. Aldinga Beach;
Ferries-McDonald Conservation Park, south of
193
Monarto; Sandy Creek, nr Gawler. 28 Nov —
22 Jan]
Phellus piliferus Dakin & Fordham, 1922 [Barker
& Inns 1976 (ethology); Daniels 1989]
[Daniels, pers. comm.: Hambridge Consv. Pk.,
western boundary; Renmark, 30 mi NNW;
Sleaford Bay, Port Lincoln. 23 Jan — 1 Mar]
REFERENCES
Artigas, JN & Papavero, N. 1988. The American genera
of Asilidae (Diptera): Keys for identification with an
atlas of female spermathecae and _ other
morphological details. I. Key to subfamilies and
subfamily Leptogastrinae Schiner. Gayana Zoologia
§2(1-2): 95-114,
Barker, S & Inns R. 1976. Predation on Stigmodera
(Themognatha) tibialis Waterhouse by a fly. Western
Australia Naturalist 13: 147-148.
Clements, AN. 1985. A taxonomic revision of the
tribe Chrysopogonini (Diptera: Asilidae).
Australian Journal of Zoology, Suppl. Ser. No.
109. 93 pp.
Clements, AN. 2000. A revision of Brachyrhopala
Macquart, an Australian region genus (Diptera:
Asilidae). Invertebrate Taxonomy. Australian
Journal of Scientific Research 14(1): 77-114.
Melbourne.
Daniels, G. 1976. Three new species of Questopogon
Dakin and Fordham (Diptera: Asilidae) from
Australia. Proceedings of the Linnean Society of
New South Wales 100 (4): 223-230.
Daniels, G. 1977. Asiola, a new Australian genus of the
subfamily Asilinae (Diptera: Asilidae). Proceedings
of the Linnean Society of New South Wales 102(2):
43-51.
Daniels, G. 1983. A new species of Neoaratus Ricardo
(Diptera: Asilidae). Journal of the Australian
Entomological Society 22: 233-236.
Daniels, G. 1987. A revision of Neoaratus Ricardo,
with the description of six allied new genera from the
Australian Region (Diptera: Asilidae: Asilini).
Invertebrate Taxonomy 1(5): 473-592.
Daniels, G. 1989. Family Asilidae. Jn NL Evenhuis (ed.)
‘Catalog of the Diptera of Australasia and Oceanean
Regions’, pp. 326-349. Bishop Museum Press & E.J.
Brill: Honolulu & Leiden. (<http//
:hbs. bishopmuseum.org/aocat/asilidae.html>)
Hardy, GH. 1928. Revisional notes on robber flies of
the genus Stenopogon (Diptera, Asilidae).
Proceedings of the Royal Society of Queensland
39(10)(1927): 119-123.
Hardy, GH. 1934a. The Asilidae of Australia. Part 1.
The Annals and Magazine of Natural History, Ser.
10, Vol. 13: 498-525.
Hardy, GH. 1934b. The Asilidae of Australia. Part II.
The Annals and Magazine of Natural History, Ser.
10, Vol. 14: 1-35.
Hardy, GH. 1935a. The Asilidae of Australia. Part III.
The Annals and Magazine of Natural History, Ser.
10, Vol. 16: 161-187.
Hardy, GH. 1935b. The Asilidae of Australia. Part IV.
The Annals and Magazine of Natural History, Ser.
10, Vol. 16: 405-426.
Hull, FM. 1958a. New species of flies of the genus
Bathypogon Loew. Journal of the New York
Entomological Society 65(1957): 199-202.
Hull, FM. 1958b. Some new species of the genus
Bathypogon Loew (Diptera: Asilidae). Bulletin of the
Brooklyn Entomological Society 53(3): 62-65.
Hull, FM. 1958c. Some flies of the family Asilidae
(Diptera) from Australia and Brazil. Proceedings of
the Royal Entomological Society of London B. 27(9-
10): 160-164.
Hull, FM. 1958d. Some species of the genus
Bathypogon Loew. Entomological News 69(7): 187-
191.
Hull, FM. 1959. Some new flies of the genus
Bathypogon Loew. Proceedings of the
Entomological Society of Washington 61(1): 17-21.
Lavigne, RJ. 1982a. Ethology of Neoitamus vittipes
(Diptera: Asilidae) in South Australia. Proceedings
of the Entomological Society of Washington 84:
617-627.
Lavigne, RJ. 1982b. Notes on the ethology of
Neoscleropogon elongatus (Diptera: Asilidae) in
South Australia. Proceedings of the Entomological
Society of Washington 84: 742-745.
Lavigne, RJ. 1984. Ethology of Neocerdistus
acutangulatus (Diptera: Asilidae) in South Australia.
Proceedings of the Entomological Society of
Washington 86: 422-431.
Lavigne, RJ. 1992. Ethology of Neoaratus abludo
Daniels (Diptera: Asilidae) in South Australia, with
notes on N. pelago (Walker) and N. rufiventris
(Macquart). Proceedings of the Entomological
Society of Washington 94: 253-262.
Lawson, FA & Lavigne, RJ. 1984. Oviposition and eggs
of an Australian robber fly, Neoaratus abludo
194 RJ LAVIGNE
Daniels (Diptera: Asilidae). Proceedings of the
Entomological Society of Washington 86: 773-776.
Lehr, PA. 1977. [Robber flies of the subfamilies
Atomosinae and Laphrinae (Diptera, Asilidae) from
Central Asia and Kazakhstan]. Entomologicheskoye
Obozreniye 56(4): 888-898. (In Russian). [English:
Entomological Review 56(4): 123-131]. Moscow
[Washington].
Lehr, PA. 2001. Robber flies of the subfamily
Dioctriinae stat. n. (Diptera, Asilidae) from Asia: 1.
Taxonomy, ecology, and phylogeny [In Russian].
Entomologicheskoye Obozreniye 80(1): 194-208
(English: Entomological Review 81(1): 59-70].
Moscow [Washington].
Papavero, N. 1973. Studies of Asilidae (Diptera)
systematics and evolution. I. A preliminary
classification in subfamilies. Arquivos de Zoologia
do Estado de Sao Paulo 23: 217-274. Sao Paulo.
Paramonov, SJ. 1966. Notes on Australian Diptera (41-
43). Notes on three genera of Australian Asilidae
with the description of seven new species. Annals
and Magazine of Natural History (13)9:137-144.
Ricardo, G. 1912. XVII. A revision of the Asilidae of
Australasia. Annals and Magazine of Natural
History (8)10: 142-160. London.
Ricardo, G. 1913a. XII. A revision of the Asilidae of
Australasia. Annals and Magazine of Natural
History (8)11: 147-166. London.
Ricardo, G. 1913b. XLIX. A revision of the Asilidae of
Australasia. Annals and Magazine of Natural
History (8)11: 429-451. London.
Ricardo, G. 1929. Stratiomyidae, Tabanidae and
Asilidae. Jn ‘Insects of Samoa’, British Museum of
Natural History 6, Part VI, Fasc. 3, pp. 109-122.
Tepper, O. 1879. The insects of South Australia. An
attempt at a census. Jn ‘Transactions and Proceedings
and Report of the Philosophical Society of Adelaide,
South Australia for 1878-9’, pp. 33-59.
Tillyard, RJ. 1926. Family 22. Asilidae. Jn ‘The insects
of Australia and New Zealand’, pp. 362-363.
Sydney.
AUSTRALIAN
MUSEUM
VOLUME 36 PART 2
DECEMBER 2003
ISSN 0376-2750
CONTENTS:
ARTICLES
109 F HEBAUER
Js
IBS
A new genus of water beetle Gentilina gen. nov. from Australia (Coleoptera:
Hydrophilidae).
B CRAIG
Repaint the drum.
CHS WATTS & WF HUMPHREYS
Twenty-five new Dytiscidae (Coleoptera) of the genera Tjirtudessus Watts &
Humphreys, Nirripirti Watts & Humphreys and Bidessodes Regimbart from
underground waters in Australia.
RJ LAVIGNE
Provisional checklist of the Asilidae (Insecta: Diptera) of South Australia, utilising an
updated subfamily classification.
Published by the South Australian Museum,
North Terrace. Adelaide, South Australia 5000.