THE NAUTILUS
6iU
HOi
,AJ3|4-
XA IVZ-
Volume 124, Number 1
April 6, 2010
ISSN 0028-1344
A quarterly devoted
to malacology.
EDITOR-IN-CHIEF
Dr. Jose H. Leal
The Bailey-Mattliews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
BUSINESS MANAGER
Mary |o Bunnell
The Bailey-Mattliews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
EDITOR EMERITUS
Dr. M. G. Harasewych
Department of Invertebrate Zoology
National Museum of
Natural History
Smithsonian Institution
Washington, DC 20560
CONSULTING EDITORS
Dr. Rudiger Bieler
Department of Invertebrates
Field Museum of
Natural History
Chicago, IL 60605
Dr. Arthur E. Bogan
North Carolina State Museum of
Natural Sciences
Raleigh, NC 27626
Dr. Philippe Bouchet
Laboratoire de Biologie des
Invertebres Marins et Malacologie
Museum National d’Histoire Naturelle
55, rue Buffon
Paris, 75005 France
Dr. Robert H. Cowie
Center for Conservation Research
and Training
University of Hawaii
3050 Maile Way, Gilmore 409
Honolulu, HI 96822
Dr. Robert T. Dillon, Jr.
Department of Biology
College of Charleston
Charleston, SC 29424
Dr. Eileen II. Jokinen
8234 E. North Shore Road
Sault Ste. Marie, MI 49783
Dr. Douglas S. Jones
Florida Museum of Natural Histoiy
University of Florida
Gainesville, FL 32611-2035
Dr. Harry G. Lee
4132 Ortega Forest Drive
Jacksonville, FL 32210
Dr. Charles Lydeard
Biodiversity and Systematics
Department of Biological Sciences
University of Alabama
Tuscaloosa, AL 35487
Bruce A. Marshall
Museum of New Zealand
Te Papa Tongarewa
PO. Box 467
Wellington, NEW ZEALAND
Dr. James H. McLean
Department of Malacology
Natural History Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Paula M. Mikkelsen
Paleontological Research
Institution
1259 Trumansburg Road
Ithaca, NY 14850
Dr. Diarmaid O Foighil
Museum of Zoology and Department
of Biology
University of Michigan
Ann Arbor, MI 48109-1079
Dr. Gustav Paulay
Florida Museum of Natural Histoiy
University of Florida
Gainesville, FL 32611-2035
Mr. Richard E. Petit
P.O. Box 30
North Myrtle Beach, SC 29582
Dr. Gary Rosenberg
Department of Mollusks
The Academy of Natural Sciences
1900 Benjamin Franklin Parkway
Philadelphia, PA 19103
Dr. Angel Valdes
Department of Malacology
Natural History Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Geerat J. Vermeij
Department of Geology
University of California at Davis
Davis, CA 95616
Dr. G. Thomas Watters
Aquatic Ecology Laboratory
1314 Kinnear Road
Columbus, OH 43212-1194
SUBSCRIPTION INFORMATION
The subscription rate for volume
124 (2010) is US $54.00 for
individuals, US $88.00 for
institutions. Postage outside the
United States is an additional US
$10.00 for regular mail and US
$28.00 for air delivery. All orders
should be accompanied by payment
and sent to: THE NAUTILUS, P.O.
Box 1580, Sanibel, FL 33957, USA,
(239) 395-2233.
Change of address : Please inform
the publisher of your new address at
least 6 weeks in advance. All
communications should include both
old and new addresses (with zip
codes) and state the effective date.
THE NAUTILUS (ISSN 0028-1344)
is published quarterly by The Bailey-
Matthews Shell Museum, 3075
Sanibel-Captiva Road, Sanibel, FL
33975.
Periodicals postage paid at Sanibel,
FL, and additional mailing offices.
POSTMASTER: Send address
changes to: THE NAUTILUS
P.O. Box 1580
Sanibel, FL 33957
THE0NAUTILUS
CONTENTS
Volume 124, Number 1
April 6, 2010
ISSN 0028-1344
Jason S. Higgs
Maren Watkins
Patrice Showers Corneli
Baldomero M. Olivera
Defining a clade by morphological, molecular, and toxinological criteria:
distinctive forms related to Conus praecellens A. Adams, 1854
(Gastropoda: Conidae) 1
Somsak Panha An anatomical note on Moellendorffia eastlakeuna (Mollendorff, 1882)
Chirasak Sutcharit a camaenid land snail from Vietnam (Gastropoda: Pulmonata:
Dang Ngoc Can Camaenidae) 20
Kristiina Ovaska Terrestrial gastropods from Haida Gwaii (Queen Charlotte Islands),
Lyle Chichester British Columbia, Canada, including description of a new northern
Lennart Sopuck endemic slug (Gastropoda: Stylommatophora: Arionidae) 25
Cleo Dihiei de Castro Oliveira How the number of hinge teeth may induce errors in the taxonomy of
Tatiana Huguenin Morales Nuculidae and Nuculanidae (Bivalvia) 34
Richard E. Petit A new species of Z eadmete (Gastropoda: Cancellariidae) from
Lyle D. Campbell South Carolina, a genus previously unknown in the Atlantic Ocean 41
Sarah C. Campbell
Monica A. Fernandez Current distribution of the exotic freshwater snail Helisoma dtiri/i
Silvana C. Thiengo (Gastropoda: Planorbidae) in Brazil 44
Fernando S. M. Bezerra
Lucia M. S. Alencar
Free Espinosa
Georgina A. Rivera-Ingraham
Jose C. Garcia-Gomez
Early stages of development in the endangered limpet Patella fermginea
Gmelin, 1791 (Gastropoda: Patellidae) 51
Notice
54
Sponsored in part by the State of Florida, Department
of State, Division of Cultural Affairs, the Florida Arts
Council and the National Endowment for the Arts.
NATIONAL
ENDOWMENT
FOR THE ARTS
TIIE NAUTILUS 124(1):1-19, 2010
Page 1
Defining a clade by morphological, molecular, and toxinological
criteria: distinctive forms related to Conus praecellens
A. Adams, 1854 (Gastropoda: Conidae)^
Jason S. Higgs*
University of Guam Marine Laboratory, UOG Station
Mangilao, GU 96923 USA
and
Department of Biology, University of Utah
Salt Lake City, UT 84112 USA
Maren Watkins*
Patrice Showers Corneli
Baldoinero M. Olivera1
Department of Biology, University of Utah
Salt Lake City, UT 84112 USA
ABSTRACT
We carried out a definition of the Conus praecellens A. Adams,
1854, species group using a combination of comparative
morphological data, molecular phylogeny based on standard
genetic markers, and toxinological markers. Prior to this work.
Conus praecellens was generally postulated to belong to a clade
of similarly high-spired, smaller species such as Conus pagoclus
Kiener, 1845, Conus memiae (Habe and Kosuge, 1970) and
Conus arcuatus Broderip and Sowerby, 1829. The molecular
phylogeny and toxinological data demonstrate that these earlier
hypotheses are incorrect, and that instead. Conus praecellens is
in a branch of Conus that includes Conus stupa (Kuroda,
1956), Conus stupella (Kuroda, 1956), Conus acutangulus
Lamarck, 1810, and surprisingly, some species that are mor-
phologically strikingly different. Conus mitratus Sowerby,
1870, and Conus cylindraceus Broderip and Sowerby, 1830.
A more careful analysis of the morphologically diverse forms
assigned to Conus praecellens suggests that from the Philippine
material alone, there are at least three additional species new to
science. Conus andremenezi. Conus miniexcelstis, and Conus
rizali. A reevaluation of protoconeh/early teleoconcii morphol-
ogy also strongly suggests that Conus excelsus Sowerby III,
1908, is related to these species. Together, the different data
suggest a clade including the 10 species above that we desig-
nate the Turriconus (Shikama and Habe, 1968) clade; there are
additional distinctive forms within the clade that may be sepa-
rable at the species level. The phylogenetic definition using the
multidisciplinary approach described herein provides a frame-
work for comprehensively investigating biodiverse lineages of
animals, such as the cone snails.
Additional keywords: Neogastropoda, Turriconus , 12SrRNA
sequences, phylogenetic analysis, exogenes
Support for this work was provided by grants from the
NII4GMS POl GM048677 (to BMO) and the NIHGMS Diver-
sity Supplement Fellowship 3 POl GM048677-13S1 (to JSB)
; To whom correspondence should be addressed: olivera@
biology, utah.edu
INTRODUCTION
The evolutionary histories of biodiverse Conus lineages
are a challenge to elucidate. In part this is because the
genus is so speciose (about 700 species) but also because
most prior data in the literature is morphological. The
usual approach is to characterize each species in the
lineage based on its shell morphology and to evaluate
phylogenetic relationships using additional anatomical
data, when available.
Prior attempts to divide Conus into subgeneric groups
have been based largely on shell morphology. In this
work, we focus on one particular branch of Conus that
includes the species known as Conus praecellens. Sev-
eral previous attempts to determine which species are
most closely related to Conus praecellens have grouped
C. praecellens with other high-spired forms (Figure 1)
that are collected in deep offshore locations. Some of the
specific prior hypotheses that have been proposed are
summarized in Table 1.
In the most comprehensive modem treatise on Indo-
Paeifie Conus species (Rockel et ah, 1995), Conus
praecellens is regarded as most closely related to Conus
acutangulus. In most of the schemes shown in Table 1
(Marsh and Rippingale, 1964; Okutani, 2000), Conus
praecellens is grouped together with Conus acutangulus
in the subgenus Conasprella Thiele, 1929. The designated
type of Conasprella is “C. cancellatus " ( = C. pagodus).
Another species generally thought to belong to this
subgenus is the Eastern Pacific Conus arcuatus. In one
of the proposals (da Motta, 1991), Conus praecellens and
Conus acutangulus are in two different subgeneric
groups: Conus praecellens in Conasprella and Conus
acutangulus in Kerniasprella Powell, 1958 (which this
author regards as a subgenus of the genus Profuncliconus
Kuroda, 1956). Among the species included with Conus
acutangulus in Kerniasprella are forms such as Conus
memiae and Conus nereis (Petuch, 1979), the latter
regarded by Rockel et ah, 1995 as a form of Conus
wakayamaensis (Kuroda, 1956). Thus, the high-spired
Page 2
THE NAUTILUS, Vol. 124, No. 1
Figure 1. High-spired Conus species previously postulated to be related to Conus praecellens-. Top from left: Conus acutangulus,
“typical form”; Conus acutangulus , “deep-water form”; Conus nereis. Middle from left: Conus praecellens, “Aliguay form”; Conus
praecellens, “sowerbii form”; Conus andremenezi new species (Holotype, MSI); Conus pagodus. Bottom from left: Conus
miniexcelsus, new species (Holotype, deposited at MSI); Conus rizali new species (Paratype 2, MSI); Conus arcuatus. All of the
specimens shown are from the Philippines, except lor Conus arcuatus. Measurements provided in Appendix 1.
J. S. Biggs et al., 2010
Page 3
Table 1. Previous taxonomic assignments of Conus praecel-
lens and Conus acutangulus.
Conus species including Conus praecellens were either
all grouped together in Conasprella, or were divided
into a praecellens/pagodus group (Conasprella) and an
acutangulus/memiae group (Kennasprella) .
These shell morphology-based suggestions can he
independently evaluated using molecular data. If only
morphological analyses are used, the resulting systemat-
ics may not reflect evolutionary trends as the traits may
be subject to selection forces that do not reflect common
descent. Distinguishing similarity by descent (reflecting
the phylogeny) from similarity directed by selection
(convergence or parallelism) is problematic without
independent data corroborating the morphological evi-
dence. Hence a widespread attempt to define biodiver-
sity using molecular markers, notably a segment of the
COI gene, has led to the “barcode initiative”. Although
this initiative has been widely implemented, workers who
need to identify field specimens require a more seamless
integration of the molecular with the morphological data.
Our first goal is to define a phylogenetic tree with
clades that reflect the branching pattern and in turn the
evolutionary history of the species. Molecular data pro-
vide independent evidence for such a phylogeny and a
useful organizational framework for in-depth studies of
species-rich groups. The morphological traits mapped
onto such a tree distinguish the respective roles of com-
mon descent and selection in the evolutionary process.
In this work, we focus on the definition of the putative
clade that includes Conus praecellens. Using 12SrRNA
sequences, we specifically evaluate which Conus species
are most closely related to Conus praecellens . In addition
to using a molecular phylogeny to assess morphology-based
taxonomy, we have gathered molecular data in the form of
the genes that encode toxins expressed in the venom ducts
of cone snails. As will be shown, these highly specialized
“exogenes” (Olivera, 2006) are useful in defining discrete
branches of a large biodiverse lineage such as the cone
snails. This three-pronged approach defines a more com-
plete picture of the evolutionary history of these biodiverse
cone snails with the result that previous morphologically
informed hypotheses may be more objectively assessed.
MATERIALS AND METHODS
Specimen Collection. Most forms in the Conus
praecellens complex are collected offshore from 30-250
meters in depth. The bulk of Philippine specimens
in collections assigned to this species were collected
(together with such species as Tibia fusus (Linnaeus,
1758) and Xenopliora Solaris (Kosuge and Nomoto, 1072)
around 1960, primarily from a few classical fish trawler
localities (Maqueda Bay in Samar Is, Tayabas Bay in
Luzon); at the time, these were mostly identified as Conus
sowerbii (see Reeve, 1849; Springsteen and Loebrera,
1986). Because other forms in the praecellens complex
are mostly from even deeper water, these were less well
represented in collections; most specimens available in
museums are poorly preserved and/or dead-collected.
However, the combination of gill net and hookah collec-
tions in the Cebu/Bohol area of the Central Philippines
and intensive small trawl collections around the Island
of Aliguay has increased accessibility to several forms in
the Conus praecellens complex. Some of these are smaller
specimens that were sparsely represented in earlier col-
lections. A range of live-collected specimens with pre-
served protoconchs has become available, which has
facilitated the reevaluation of the Conus praecellens spe-
cies complex.
Phylogenetic Analysis. We aligned sequences using
Clustal X (Larkin et ah, 2007) and refined by eye using
MaeClade (Maddison and Maddison, 2005). The tree
was inferred using MrBayes (Huelsenbeck et ah, 2001;
Ronquist and Huelsenbeck, 2003). The run comprised
1,000,000 generations with the first 25% of the sampled
generations discarded as burn-in trees. Two MCMCMC
runs (metropolis-coupled Monte-Carlo nrarkov-chain),
using four chains each, were used to thoroughly explore
tree space. Convergence of the likelihoods was deter-
mined by comparing the average standard error of the
difference (ASED) in split frequencies between the two
runs and by comparing plots of the log-likelihood after
the burnin to the end of the runs. Optimality was also
judged adequate when tire PSRL (Potential scale reduc-
tion factor) for the total tree length and for each model
parameter reached 1.00.
Identification and Sequencing of Genomic Clones
Encoding O-Superfamily Peptides. Genomic DNA
was prepared from 50 mg each of tissues of Conus acu-
tangulus, Conus mitratus, Conus pracellens, and Conus
stupa using the Centra PUREGENE DNA Isolation Kit
Kit (Gentra Systems, Minneapolis, MN) according to the
manufacturers standard protocol. These gendmie DNAs
were used as templates for polymerase chain reaction
(PCR) with oligonucleotides corresponding to conserved
5' intron and 3' UTR sequences of omega and delta
prepropeptides. The resulting PCR products were puri-
fied using the High Pure PCR Product Purification Kit
(Roche Diagnostics, Indianapolis, Indiana) following the
manufacturers suggested protocol.
Page 4
TIIE NAUTILUS, Vol. 124, No. 1
The eluted DNA fragments were annealed to
pNEB206A vector and the resulting products transformed
into competent DH5a cells, using the USER Friendly
Cloning Kit (New England BioLabs, Beverly, Massachu-
setts) following manufacturers suggested protocol. The
nucleic acid sequences of the resulting omega and delta
toxin-encoding clones were determined according to the
standard protocol for automated sequencing.
Morphometric Analysis. Using dial calipers, we mea-
sured maximum diameter (mm) and total length (mm;
including spire height) of species within the praecellens
complex. Relative diameter was calculated as the ratio of
maximum diameter to total length. All species were
represented by multiple samples. In view of the low
between-sample variation, we calculated a single mean
relative diameter for each species.
RESULTS
Systematic Descriptions of Three New Species
of Conus
by Baldomero M. Olivera and Jason Biggs
Superfamily Conoidea Fleming, 1822
Family Conidae Fleming, 1822
Subfamily Coninae Rafiuesque, 1815
Genus Conus Linnaeus, 1758
Conus anclremenezi Olivera and Biggs, new species.
(Figures 1, 2, 6)
Description: Biconical in shape, mature specimens from
25-53mm. Moderately solid, and with a relatively high
spire, and generally broader than most related forms
(D/L 0.47). Last whorl is broadly conical, with raised
spiral ribs that are not smooth but always undulating (and
in some specimens, the ribs seem to have arch-like pro-
tuberances, instead of a continuous smooth rib). Raised
ribs on the body whorl are well separated from each other,
with interstices that have axial scales between them.
The body whorl has an off-white ground color with
characteristic purplish-brown spots that occur in zones;
in the two darker zones, the spots generally cover more
spiral ribs and extend into the interspaces (although
there is considerable variation). The protoconch is decol-
lated in most specimens, but when preserved it is a
rounded conical shape, translucent, veiy light yellowish
brown or off-white; the protoconch is followed by two
white early teleoconch whorls that are lightly nodulose
and angled at the periphery. The spots begin to appear
on the periphery of the third or fourth teleoconch whorl,
and typically these are more closely spaced to each other
than are the larger spots in the later spire whorls.
Type Material: The Holotype is deposited in the
Marine Science Institute (MSI) at the University of the
Philippines; Paratypes are deposited at the Academy of
Natural Sciences ol Philadelphia, Philadelphia, Pennsyl-
vania (ANSP 421619); the Museum national d’Histoire
naturelle, Paris, France (MNHN 21131); the Field
Museum of Chicago, Chicago (FMHN 312461); the Har-
vard Museum of Comparative Zoology, Cambridge Mass
(MCZ 361611); Zoological Museum of Moscow State
University, Aloscow, Russia (Lc-37964) and The Bailey-
Matthews Museum, Sanibel, Florida (BMSM 38672)
(see Appendix or a complete listing ol paratypes).
Type Locality: The type locality for Conns anclremenezi
is Aliguay Island, Philippines, where most specimens
in the tvpe series have been collected by commercial fish-
ermen using small trawls at depths around 150 m. Another
established locality is off Panglao, Bohol, from Balicasag
Island to Momo Beach where the species has been col-
lected by tangle nets in deeper water (~200-300m).
Geographical Distribution: From the Central to
Northern Philippines, probably to Viet Nam and possibly
much further West (see discussion below). In the recent
book of Thaeh (2005), the specimen figured as Conus
praecellens (Plate 61, Fig. 34) is likely to be a specimen
of Conus anclremenezi.
Etymology: This species honors the memory of Andre
Menez, one of the giants of the field of toxinology.
Remarks: The sculpture on die spire whorls is diagnostic:
the spiral ribbons on the larger spire whorls are raised,
relatively narrow to very narrow, and always far apart. The
vide spacing on the spire whorls between narrow raised
spiral ribs is a diagnostic trait of this species; in most similar
forms, the spiral ribbons or ridges are much closer together
and are more like flattened ribbons, broad and shallow. The
broad shape, purplish-brown spots, undulating spiral ribs,
and widely spaced ribs on the spire are characteristic
features tiiat separate the species from similar forms.
When the protoconch is decollated, this species is
difficult to separate from some closely related forms that
are potentially variants of Conus praecellens. Most spec-
imens can generally be differentiated by the distinctive
purple-brown color, the broader shell, the widely spaced
spiral ribbons on the spire whorls, and when preserved,
the conical protoconch. Most specimens in the type
series come from Aliguay.
There is a group of Philippine specimens, not from the
type locality, which we tentatively assign to this species.
These were collected by the Musorstom expeditions
prmoted by the Museum national d’Histoire naturelle,
Paris, to Lubang Island/Mindoro. Several large mature
specimens ol Conus anclremenezi , all dead collected, were
examined. All of these were collected at depths between
160-198 meters; at more shallow collection stations, this
form was absent and a narrower Conus praecellens variety
was present. This provides a more accurate estimate of the
depth at which this species occurs.
Finally, there is a small specimen figured by Rockel
et al. (Plate 54, Fig. 14) that appears to be a juvenile of
Conus anclremenezi: if the identity of this specimen can
J. S. Biggs et al., 2010
Page 5
Figure 2. Two morphospecies with non-“praecellens-\i\ce" protoconchs from Aliguay. All ol the specimens shown are from Aliguay
Island, Philippines, except the lower left specimen which was collected from southern Japan. Top row: Conus andremenezi- Bottom
row: Conus miniexcelsus. For Conus andremenezi , the Holotype (left), Paratype 7 (second from right), and Paratype 11 (right) are
shown. For Conus miniexcelsus , the Holotype (second from right), Paratype 2 (third from right), and Paratype 18 (rightmost
specimen) are shown. All of the types figured are deposited at the Marine Science Institute (MSI), University of the Philippines.
Measurements provided in Appendix 1.
be verified, it extends the range of this species across the
entire Indian Ocean since the specimen is reported to be
from Somalia. Thus, although almost all of specimens
examined were from the Central Philippines, there is
strong evidence for the occurrence of the species in the
Northern Philippines, and the possibility that it may have
a geographic distribution that is much wider is raised by
the Somali specimen in the Raybaudi-Massila collection.
Conus miniexcelsus Olivera and Biggs, new species
(Figures 1, 2, 4, 6 and S)
Conus praecellens f. subaequalis. — Robin, 2008: 424,
fig. 14 (non Conus subaequalis , Sowerby III, 1870)
Description: A moderately small shell; adult size range,
25-37 mm. High-spired, with both spire and body whorl
Page 6
THE NAUTILUS, Vol. 124, No. 1
having a straight outline, making the shell narrowly
biconical. The larval shell has 3. 0-3.5 whorls, translucent
brownish or purplish. There are 9-11 teleoconch whorls,
the first three being ivory-white, without spots, providing
a notable contrast to the translucent-colored protoconch.
At around the fourth teleoconch whorl, broad brown-
ish spots appear, centered around the periphery. The
ground color is white, with chestnut-brown spots. On
the body whorl there are a series of flat spiral ribbons.
The shell pattern on the body whorl can be divided into
3-5 zones. The most posterior, next to the suture, are a
series of about 6 spiral ribbons with extremely fine chest-
nut brown spots. These are followed by a zone with 3
noticeably broader spiral ribbons that have deeper brown
and larger spots. In most specimens, this is followed by
three spiral ribbons that have a finer spotted pattern (but
not as fine as in the spiral ribbons in the first zone, closest
to the suture). The remainder of the shell towards the tip
is covered by spiral ribbons that are darker in color and
more heavily spotted; typically the first 3 to 4 are darker
than those towards the anterior end of the shell, although
there is considerable variation in this regard. In some
specimens, the light zone continues to the anterior of
the shell.
Type Material: The Holotype is deposited at the
Marine Science Institute at the University of the Philip-
pines, Paratypes are deposited at the Field Museum,
Chicago, Illinois (FMNII 312462); the Museum National
d’Histoire Naturelle, Paris, France (MNPIN 21132); the
Harvard Museum of Comparative Zoology, Cambridge,
Massachusetts (MCZ 361609); the Academy of Natural
Sciences of Philadelphia, Philadelphia Pennsylvania
(ANSP 421620); Zoological Museum of Moscow State
University, Moscow, Russia (Le-37965) and The Bailey-
Matthews Museum, Sanibel, Florida (BMSM 38673)
(see Appendix or a complete listing of paratypes).
Type Locality: Aliguay Island, Philippines. Most spec-
imens in the type series were collected by the commer-
cial small-trawl operations off Aliguay Island, at depths
of 30- 150m.
Geographical Distribution: Presently known from the
Central Philippines to Wakayama, Japan (Paratype #23).
Etymology: The specific epithet emphasizes some strik-
ing and unexpected similarities to Conus excelsus despite
the considerable disparity in size.
Remarks: A distinguishing characteristic of this species
are the spots on the whorls closest to the suture, which
are generally extremely line in pattern and greater in
number than for any other similar species, followed
by the thicker, darker brown spiral ribbons at the
center of the body whorl. These features are clearly
illustrated in the specimens shown in Figure 3. Conus
miniexcelsus is a distinct species, most easily confused
with Conus praecellens. However, as discussed above
and shown in Figure 3, the differences in protoconch
and early teleoconch morphology between the two spe-
cies are consistent distinguishing characters. This feature
puts Conus miniexcelsus in the same group as Conus
acutangulus, Conus andremenezi, and Conus excelsus
(except that the spire of Conus acutangulus has strong
tubercules at the sutures). Conus andremenezi is gener-
ally larger, with coarse spots that are purplish brown in
color instead of chestnut. Conus miniexcelsus is probably
most similar to Conus excelsus, although there is a strik-
ing difference in size at maturity. The two Japanese spec-
imens examined are more solid and chunky than the
Aliguay material. Figure 8 shows the different shape and
color of the protoconehs and the characteristic switch in
Conus miniexcelsus from a conical translucent purplish
brown protoconch, to the ivory white first teleoconch
whorls, and finally to the normal spotted pattern.
Conus rizali Olivera and Biggs, new species.
(Figures 1, 3, 6)
Description: The species is medium-sized; specimens
examined are 26-39 mm in length. The shell is biconic,
with an unusually tall, straight, and sharply pointed spire
and a straight-sided body whorl, sharply angled at the
shoulder. Outline narrow (D/L = 0.397 ± 0.011); The
larval shell has two whorls, and is praecellens- like but
somewhat proportionally broader than for most specimens
of Conus praecellens; this is followed by two teleoconch
whorls that have a characteristic white-matte surface,
somewhat crinkly; starting with the fourth teleoconch
whorl, there are 8-9 spotted spire whorls.
The body whorl is characterized by shallow spiral
ribbons with only a narrow interstitial space between
them; these are broadly spotted in light yellow-brown.
Characteristically, immediately below the periphery, the
first spiral ribbon lacks spots, leaving a white zone. Al-
though there is some variation, the spots are much ligh-
ter in color than in related forms (Paratype 2 almost
completely lacks spots in the body whorl).
Type Material: The Holotype is deposited at the
Marine Science Institute at the University of the Philip-
pines; Paratypes are deposited at the Academy of Natu-
ral Sciences of Philadelphia, Philadelphia, Pennsylvania
(ANSP 421621); the Harvard Museum of Comparative
Zoology, Cambridge, Massachusetts (MCZ 361610) and
in the Museum National d’Histoire Naturelle, Paris
France (MNIIN 21133) (see Appendix for a complete
listing of paratypes).
Type Locality: All type specimens were obtained from
commercial dealers in the Philippines, and the exact
collection locality of the types could not be verified.
Springsteen and Leobrara show a figure of Conus rizali
(labeled Conus subaequalis) indicating Punta Lugano,
Cebu, suggesting that these were probably collected by
fishermen using tangle nets at depths of 100-200m.
Geographical Distribution: Philippines.
J. S. Biggs et al., 2010
Page 7
Figure 3. Three distinctive forms with “praecellens- like” protoconchs. Top row is a series of Conus praecellens, "sowerbii form .
Bottom row is Conus praecellens, “Aliguay form”. In the middle row are two specimens of Conus rizali new species, the Holotype
(left) and Paratype 2 (right), both MSI. Measurements provided in Appendix 1.
Etymology: This species is named in honor of |ose
Rizal, the National Hero of the Philippines. Dr. Rizal,
who was executed by the Spanish Colonial Administra-
tion in 1898, collected shells as a hobby.
Discussion: Of all of the similar forms. Conus rizali has
the most narrow outline (D/L = 0.397 ± 0.011); spec-
imens of Conus praecellens from Aliguay, which
are generally narrower than the “Sowerbii form” have a
D/L = 0.44, and for Conus miniexcelsus ; (D/L = 0.416)
these are both narrower than Conus andremenezi.
Although Roekel et ah, put this species in synonymy
with Conus praecellens , we believe that it is a distinctive
form that can readily be separated from specimens
assigned to Conus praecellens. The narrower outline,
the shallow ribbons on the body whorl, and differences
in protoconch/early teleoconch moiphology separate
Conus rizali from other related forms. Conus rizali was
previously figured as Conus suhaequalis Sowerby III,
1870, by authors. This name was used by Springsteen
and Leobrera, and by Lim and Wee (1992); however,
the specimen recently figured by Robin (2008) as Conus
subaequalis is not Conus rizali but Conus minexcelsus.
A specimen was also figured by Roekel et al. (Plate 54,
Figure 6) but they refer this to Conus praecellens. Conus
rizali is sufficiently distinct so that it can immediately be
picked out from other related forms discussed elsewhere
in this article: the narrow outline of the shell sets it
Page 8
O
THE NAUTILUS, Vol. 124, No. 1
immediately apart, and in fact the form that is most
similar in outline is Conus gratacapi from Japan, which
is an unrelated species. This species has only been inter-
mittently collected over the last four decades, and never
in large numbers. As has been discussed in detail by
Rockel et al., and is shown in the original figure of
Sowerby (which Rockel et al., reproduced), the spec-
imens that we assign to Conus rizali are clearly not con-
specific with the figure of Conus subaequalis , which
likely refers to a different form in the Conus praecellens
complex.
Morphological Definition of Species in the Conus
PRAECELLENS COMPLEX: TWO “a/FVIEXCELSCS-LIKE” FORMS
In this section, we describe and define two distinc-
tive forms in the Conus praecellens complex from the
Philippines. As wall be defined in the Discussion, the
“ Conus praecellens complex” can be divided into two
broad groups on the basis of protoconch morphology,
the “ praecellens -like” forms and the “miniexcelsus- like”
forms.
The two miniexcelsus- like forms from Aliguay Island
(i.e., those with non-praecellens-like protoconchs), which
we proposed to designate as new species, are discussed
first. The Aliguay specimens of these two forms are
easily distinguishable from each other (see Figure 4).
Since both of these miniexcelsus -like forms were appar-
ently unnamed, these are formally described in the sec-
tion above. The appendix summarizes the individual type
specimens on which the new taxa are based.
Conus andremenezi Olivera and Biggs, new species
(Figure 2)
This form may be similar or identical to Conus bicolor
Sowerby I, 1833, which is a preoccupied name. Sowerby
then provided a new name in 1841, Conus sinensis.
Rockel et al., (1995) stated that “taxonomic status of
Conus bicolor/ Conus sinensis (Sowerby II, 1841)
remains disputable because the type specimen is lost
and the type figure (Plate 54, fig. 3) does not match C.
praecellens in a satisfying way: the pictured shell has a
comparatively low spire. . .is somewhat bulbous below
the shoulder and its color pattern consists of brown axial
flames. . .we favor synonomy with Conus praecellens.'
The figure shown by Rockel et al. (originally drawn from
“ Conus bicolor”) is similar to the species we describe
above as C. andremenezi ; we have not adopted the name
Conus sowerbii for this species because the syntype in
the British Museum does not appear to be nonspecific
with C. andremenezi.
We believe that Conus andremenezi is clearly dis-
tinguishable from typical Philippine specimens of
C. praecellens; first, the protoconch is not “praecellens-
like”; second, this form is generally broader and has a
characteristic purplish-brown coloration. Furthermore,
on the body whorl, there are raised but not flattened
spiral ridges that undulate, with a wade space between
ribbons with axial scales between the spiral ridges. More
consistently, the sculpture on the spiral whorls has nar-
row, raised ridges, widely spaced from each other. This
suite of characteristics consistently distinguishes this
species from C. praecellens of similar size (see Figure 1)
and from Conus miniexcelsus (see next species); Conus
rizali is even more distinctive from C. andremenezi.
There are a group of small Conus praecellens that are
most easily confused with Conus andremenezi; these are
discussed under Conus praecellens below.
Conus miniexcelsus Olivera and Biggs, new species
(Figure 2)
This very distinctive species is characterized by its rela-
tively narrow shell outline (D/L ~ 0.42 vs. 0.47 for C.
andremenezi), the multispiral protoconch of 2.5-3. 0
whorls, which is translucent and distinctly brownish or
purplish and contrasts in its color with the first 2. 0-2.5
teleoeoneh whorls that are ivory white. In most spec-
imens, these white whorls are smooth or have, at most,
nearly obsolete tubercles. This is followed by 6-10 spot-
ted teleoeoneh whorls that are grooved and have strong
axial structure so that the upper part of each spire
whorl has a distinctly tiled appearance. The body whorl
lias shallow spiral ribbons with regular, brown spots
that have a characteristic pattern described in the
Appendix in detail. The colored, translucent protoconch
contrasting in color with the first two shiny- white
teleoeoneh whorls, combined with the slender shape
and the very fine spotted pattern are diagnostic of this
distinctive species. There is considerable variation in
how dark the spots are; a range of variations is shown in
Figure 4. A full description of this new species was pro-
vided in the previous section; detailed measurements
of all the types are provided in the appendix. Almost all
specimens have been collected by small trawls in Aliguay
from 60-130 m, but occasional specimens have also
been collected using gill nets off Balicasag Island. One
specimen assigned to this species from southern Japan
is included in the type series (Figure 4). Figure 2
makes evident the generally finer pattern and narrower
shell shape of Conus miniexcelsus compared to Conus
andremenezi. In addition the spiral ribbons of the body
whorl of Conus miniexcelsus are smooth, but are dis-
tinctly crenulated in Conus andremenezi.
Overview and Description of the
“PRAECELLENS-LIKE FORMS”
Conus praecellens remains a confusing taxon, and the
scheme proposed below is not entirely satisfactory; mul-
tiple forms have been assigned to this species by various
workers. Even after the two “miniexcelsus- like forms”
are separated as new species, what remains still com-
prises a confusing set of specimens, most of which we
are provisionally retaining in C. praecellens. We believe
that the retention of diverse forms within C. praecellens
J. S. Biggs et al., 2010
Page 9
Figure 4. An illustration of the "miniexcelsus-hke complex”. Shown are five specimens (left five) and close-ups of their respective
protoconchs (right five). Left, top and bottom: Conus miniexcelsus (Paratypes 2 and 18, respectively), middle: Conus excelsus, and
right top and bottom: Conus acutangulus. Measurements provided in Appendix 1.
will prove to be only an interim solution, and new mor-
phologically similar species will be identified once a
more extensive molecular and morphological analysis
has been carried out over a wider suite of specimens
from a greater geographic range.
There is a widely illustrated specimen designated as
“a possible syntype” of Conus praecellens from the British
Museum. This is atypical ol specimens assigned to
C. praecellens from the Philippines. This possible syntype
from the China Sea is lighter in color and finer in sculp-
ture on the body whorl than either of the two major
Philippine varieties that we include in C. praecellens. The
first group, “the Aliguay form,” which is small and light
colored, has been extensively collected both by the small
dredge operations in Aliguay Island, and is the form illus-
trated in Figure 3. A second more variable group that we
refer to as the “sowerbii forms,” include larger specimens
that vary considerably in shell pattern, shape, and size.
These comprise most specimens collected by fish trawlers
in the period from 1955-1965, particularly from two local-
ities, Tayabas Bay and Maqueda Bay. A third group is that
referred to by previous authors as Conus subaequalis and
is described above as Conus subaequalis. The three forms
are shown in Figure 5.
Conus praecellens “Aliguay form”
(Figure 3)
The series of specimens that we assign to C. praecellens ,
“Aliguay form”, appears to be the closest to the type in
the BMNH in shell pattern; these have mostly been
collected in 30-80 fathoms off Aliguay Island, between
Mindanao and Bohol in the Philippines. The Philippine
specimens are smaller than the BMNH “syntype” (aver-
age size ~ 24mm); key features that distinguish this form
are a blunt, paucispiral protoconch of two whorls, the
relatively smaller size, and the chestnut color of the
spots. Details of the spire sculpture and body whorl that
are also diagnostic are delineated below.
The shells of this form (see Figure 5) typically have
2. 0-2. 5 protoconch whorls, the first being quite spherical
and inflated, and the second narrower and more elon-
gate. The first two teleoconeh whorls are typically
white and flattened compared to the protoconch whorls,
and they are knobbed on the periphery, while the two
Page 10
THE NAUTILUS, Vol. 124, No. 1
brunneus
eg,us Stephanoconus VZ
Dauciconus W
vittatus
IldVebCeilb
eticus .
— tenuistriatus
gr.?r)um g|ans Leporiconus W
Viitulinus W
acutangulus -< Turriconus W?
Rhizoconus W
■ partus
, - radiatus
■ laterculatus
■ obscui%s°grap us Gastridium F
jaspideus
Conasprella W
B.tippetti
Figure 5. Phylogenetic tree of some Conus species based on 12SrRNA sequences. Species shown in Figure 1 are indicated with
arrows. Branches are labeled with Bayesian confidence values (posterior probabilities expressed as percentages). These data clearly
separate Conus acutangulus and Conus praecellens from the Conasprella species with 100% confidence and join them with C. stupa
and C. mitratus with 97% confidence.
protoconch whorls are smooth. There are 8 to 9 whorls
spotted with a chestnut brown color, with the first one or
two spotted whorl(s) also knobbed. The early teleoconch
whorls are characterized by a deep spiral groove on the
upper section ol the whorl; these spiral grooves gradually
increase in number as the whorls get larger; these are
narrow furrows that can ire bisected by axial sculpture that
varies considerably in strength; in specimens where the
axial sculpture is strong, the area immediately adjacent to
the suture looks as il it were tiled, since the combination of
the spiral grooves and the axial sculpture divide the area
between grooves into square sections. The broader part of
the spiral whorl is smooth to the periphery; the lower
suture is below the sharply angled periphery.
Conus praecellens “sowerbii forms”
(Figure 3)
There are forms in the C. praecellens complex most com-
monly found in collections; most specimens were col-
lected by trawlers around I960 in great numbers in the
Maqueda and Carigara bays of Samar Island, and in
Tayabas Bay of Southwestern Luzon, from Jolo Island in
the Sulu Sea. The “sowerbii forms” are larger and more
densely spotted than the specimens of the “Aliguay form"
described above. There is considerable variation in shell
morphology: some specimens are slender and narrow with
line sculpture; others appear to be much broader at the
shoulders with an overall coarser sculpture. However,
when preserved, the protoconchs of all of these have
the typical highly inflated first whorl, with only two.
pearly white protoconch whorls. A range of specimens
collected from various Philippine localities, all with typical
“praecellens- like” protoconchs that are well preserved are
shown in Figure 5 (the contrast between these and the
“Aliguay form” is also illustrated in that figure).
Given the distinctive (and mutually similar)
protoconchs of both the Aliguay and the “sowerbii forms,”
we have provisionally assigned these in C. praecellens.
However, further characterization of both the radular and
gut morphology, as well as a molecular characterization,
may prove that these are distinct from each other, and that
there are additional separable species embedded in the
“sowerbii forms”, a possibility that clearly needs to be
further evaluated.
Conus praecellens , other distinctive varieties.
A smaller form of Contis praecellens was recently col-
lected by MNHN, off Aurora, Eastern Luzon, Philippines.
These specimens were notable because they were veiy
similar to Conus andremenezi, but much smaller. They
are easily separable from Conus andremenezi because
they have the typical “praecellens- type” protoconch.
These look veiy different from the two Conus praecellens
“forms” described above. We note that in general. Conus
andremenezi is a larger species; however, there have
been juvenile Conus andremenezi specimens collected
using lumum-lumum nets in the Camotes Sea, along
with specimens of the Conus praecellens , “Aliguay form,"
described above. It seems likely that only juvenile spec-
imens of Conus andremenezi are collected at this
J. S. Biggs et al., 2010
Page ] I
locality because lumun-lumiin nets were used, and it pre-
sumably takes longer than the three months lumun-lumun
nets are laid out for Conus andremenezi to reach full
maturity. These small specimens of Conus andremenezi
do have the characteristic protoconchs of that spe-
cies, though they are somewhat lighter in color than
the Alignay series. In contrast, the variety of Conus
praecellens collected off Aurora (trawled at 83 m depth)
have the praecellens -type protoconch. At the same site,
the MNHN expedition collected two dead, somewhat
eroded specimens, that were larger in size, in a trawl
189-307 meters in depth that are likely to lie true Conus
andremenezi.
In addition, a species was recently described as Conus
beatrix, Poppe and Tagaro, 2006. We have not had an
opportunity to examine the Holotype of this species; it
maybe that these represent a series of unusually pale spec-
imens, possibly continuous with the Conus praecellens
“Align ay form”, described above. If this were the case,
and further molecular evidence shows that these are sep-
arable from Conus praecellens , then these authors would
have provided a potentially valid species name for Conus
praecellens “Aliguay form.”
Conus rizali Olivera and Biggs, new species
(Figure 3)
This distinctive species was previously recognized by
Springsteen and Leobrera (1986) and by Lim and Wee
(1992) as morphologically separable from any of the
other forms assigned to C. praecellens or C. acutangulus.
In their treatment of this complex, Springsteen and
Leobrera (1986) provided a figure of this form, to
which the name Conus subaequalis Sowerby IIP 1870,
was assigned, with the locality Punta Engano, Cebu,
Philippines. This locality suggests that the specimens
they examined were collected by gill nets in deep water.
A similar specimen was illustrated by Rockel et al. (plate
54, figure 6) and labeled “ Conus praecellens" from
Davao, Philippines (likely collected by tangle nets off
Balut Island, Davao). In our description of Conus rizali
(see above), the name we propose for this form, we
discuss a number of distinguishing morphological char-
acteristics. The name assigned by both Springsteen and
Leobrera and Lim and Wee, Conus subaequalis does
not appear to refer to this form (Rockel et al. reproduce
the original figure of Sowerby which refers to a smaller
shell, broader in outline with seemingly more deeply
colored spots than Conus rizali.)
The slender, high-spired, and biconical shape of C.
rizali is similar to the Japanese Conus gratacapai , a poorly
understood, rare, deep-water species. Several museum
specimens of C. gratacapai were examined, including
some Paratypes of the latter. Several striking morphologi-
cal differences indicate that the two forms are not conspe-
cific. Most notably, C. gratacapai does not have the sutural
structure of C. rizali ; there is a smooth transition between
whorls in the former, but a peripheral overhang between
spire whorls in the latter. Anodrer obvious difference
are the light brown spots of C. rizali, which are absent in
C. gratacapai Pilsbry, 1904. The spire sculpture of the two
forms differs significantly as well.
Other “miniexcelsus -like” forms: Conus excelsus and
C. actangulus.
The presence of a translucent multispiral brownish
or purplish protoconch, followed by several ivory white
teleconch whorls is a striking morphological feature of
Conus minexcelsus. In this respect, two well-known spe-
cies are “miniexcelsus- like”: C. excelsus and C. acutan-
gulus. Both have the same characteristic translucent
protoeonch and ivory white early teleconch whorls (see
Figure 6). All of these forms have the body whorl cov-
ered by spiral ribbons. Tbe major difference is in the
highly nodulose whorls of C. acutangulus, versus the
smoother whorl of C. minexcelsus. Conus excelsus is some-
what intermediate in this respect. There are also the strik-
ing and obvious differences in size, C. excelsus being by
far the largest. Although the shells are different in pattern
and size at maturity in these three species (Figure 4), note
the similar purplish brown translucent protoconchs,
followed by the ivory white early teleoconch whorls before
the regular shell pattern is initiated. Typical Conus
acutangulus (Figure 4, top right) and the “deep-water
form” (Figure 4, bottom right) are both distinctly more
nodulose while there is a striking similarity between
Conus excelsus and Conus miniexcelsus in their proto-
conchs and early teleoconch whorls.
Conus excelsus Sowerby III. 1908
(Figure 4)
This is one of the largest species in the group (to over
100 mm). The protoconch consists of about 3.25 whorls,
with a maximum diameter of about 1 mm. The protoconch
whorls are grayish, and early teleoconch whorls are bright
white that then begin to have brown radial blotches of
varying size in the later whorls. Early teleoconch whorls
have one deep spiral groove, increasing to up to 4 spiral
grooves in the later whorls. Although body whorl can be
almost smooth, some specimens have variably spaced, axi-
ally striate spiral groups separated by granulose ribbons.
Most specimens in the Philippines are from Balut Island,
Davao, collected by gill nets at depths of approximately
100-150 fathoms. Although C. excelsus is strikingly differ-
ent in size, the body whorl sculpture, the protoconch and
early teleoconch whorls show such strong similarities to C.
miniexcelsus that a close genetic relationship between the
two species seems highly likely.
Conus acutangulus Lamarck, 1810
(Figure 4, 6)
Among Philippine specimens, there appear to be two
varieties of Conus acutangulus, the “typical form”
(Figure 4, top row, right), which conforms to the neotype
designated by Kohn (Kohn, 1981) and a variety that we
will refer to as the “deep-water form” (Figure 4, bottom
row, right). This is a well-known species, and the only
THE NAUTILUS, Vol. 124, No. 1
Page 12
O
Figure 6. Distinctive forms proposed to belong to the Turricomts elude. Top row (showing the shell and, in the inset above it, a
close-up of the corresponding protoconch), from left to right: Conus excelsus ; miniexcelsus (Holotype); acutangulus, “typical form”;
acutangulus, “deep-water form”; andremenezi (Holotype); praecellens , “sowerbii form”; rizali (Holotype); praecellens, “Aliguay
form”. Lower row, from left to right: Conus stupa- stupella ; mitratus ; cylindraceus. The protoconch of Conus stupa is not shown; it
is extremely eroded in the figured specimen. Measurements provided in Appendix 1.
issue is whether the two distinct forms described below
are conspecific or not
“Typical form” (description after Rockel et ah, 1995):
This is a small to medium sized shell; the larval shell is
multispiral with 3 to 4 whorls. The teleoconch whorls are
strongly tuberculate for at least the first eight post-nuclear
whorls, a distinctive characteristic. The body whorl has
strong spiral ribbons or ribs that are separated by grooves
with strong axial threads. The shell is largely brown,
except for small, scattered white blotches at the shoulder
and center. The aperture is white. This form is collected in
relatively shallow water, typically between 3-20 m. Divers
in Batangas Bay, Luzon, collected most Philippine spec-
imens; more recently divers in Nucnucan, Bohol, have
collected the typical form. Lully mature specimens are
2.5-38 mm in length, D/L ~ 0.50-0.53. Typical fully
mature non- Philippine specimens are also illustrated by
Rockel et al. 1995 (plate 54, figs. 19 and 21).
“Deep-water forms:” The deep-water varieties typi-
cally occur between 30 to 150 meters, and are collected
either by dredging or gill nets. These forms do not have
the brown to dark brown color of the typical variety, but
are mostly white with sparse light orange-brown or gray-
ish flecks. Generally smaller than the typical form, most
specimens are 16-22 mm in length. This form has been
collected in Aliguay and Pamilacan Islands. A compari-
son of available deeper- water specimens assigned to
C. acutangulus reveals considerable variation that needs
to be more carefully investigated and defined. These
forms clearly occur outside the Philippines; Rockel
et ah, illustrate a specimen from the Solomon Islands
(plate 54, fig. 17).
Molecular Phylogeny: Relationship of Conus
PRAECELLENS TO OTHER HlGH-SPIRED CONUS SPECIES
Most of the forms investigated in this article were
collected in the Central Philippines, primarily by gill
nets or trawlers offshore. A number of smaller Conus
species of similar shape, including several diverse forms
assigned to Conus praecellens , are collected in this way
(Ligure I ). As described above, in most taxonomic work,
Conus praecellens is either explicitly discussed or implic-
itly grouped with similarly shaped, high-spired, small,
J. S. Biggs et al., 2010
Page 13
deep-water Conus species even when authors do not
endorse a specific phylogenetic scheme (for example see
Robin, 2008; Rockel et ah, 1995; Walls, 1979).
Table I summarizes previously proposed taxonomy
based on shell morphology, which can be assessed using
molecular data. For comparison, a phylogenetic tree
based on 12S mitochondrial DNA includes Conus praece-
llens and C. acutangulus , along other vermivorous, mollu-
scivorous, and piscivorous Conus species (see Figure 5).
This molecular phylogeny assigns C. praecellens and
C. acutangulus to the same elade. The surprising, yet
clear-cut, result is that most other species proposed to
be included in Conasprella with C. praecellens by previ-
ous workers based on shell morphology actually cluster
in a branch extremely divergent from most Conus. The
type species of Conasprella , C. pagodus , is on this very
distant branch, which we refer to as the “ Conasprella
elade”. Additional molecular data support these findings
(Bandyopadhyay et ah, 2008). These data, discussed
below suggest that the degree of divergence makes it
untenable to keep these species (C. pagodus , etc.) within
the same genus as other Conus species.
Definition of a Clade Based on Morphological and
Molecular Data: The combination of the morphological
analysis of the various species and distinctive forms above
combined with the available molecular data (Figure 5)
provides a framework for defining the group of Conus
spp. most related to C. praecellens and C. acutangulus.
As discussed above, some of the superficially similar high
spired Conus species are not at all closely related based on
the molecular data. In the Philippines, there are ten spe-
cies and L2 distinctive forms which we assign to this group
that we designate the Turriconus clade (Conus excelsus =
Conus nakayasui , type species). A comprehensive taxo-
nomic revision of the genus Conus is currently being
carried out by A. Kohn; we suggest that Turriconus is a
distinct branch within the major group of species that
together, comprise the genus Conus.
The molecular work definitively excludes a number of
Conus spp. from Turriconus; clearly, species such as
Conus pagodus. Conus memiae, Conus nereis, and other
deep-water species with high spires such as Conus
boholensis (Petuch, 1979), Conus eugrammatus (Bartsch
and Rheder, 1943), as well as non-Philippine species such
as Conus jaspidcus (Gmelin, 1791) and Conus arcuatus,
though morphologically similar to C. praecellens, do not
belong in the Turriconus clade. The 10 species and 12
distinctive forms that comprise the Turriconus clade in
the Philippines are shown in Figure 6, and summarized
in Table 2; as outlined in the table, these fall into four
groups that will be discussed in turn.
The first group is the excelsus/ acutangulus group
(Group I), with four species and five distinctive forms.
This group includes the type of Turriconus, Conus
excelsus. The second is the praecellens group with two
species and three distinctive forms. The third is the
mitratus group of at least two species and fourth, the
stupa group.
Table 2. Morphologically distinctive “forms" in the Turrico-
nus clade ( Conus excelsus, type species).
Peptide toxins belonging to the O-superfamily have been
determined for these “forms."
The first group of species, the excelsus/acutangulus
group, is characterized by a generally conical protoconch,
without the spherical, inflated first protoconch whorl. The
protoconch is translucent, brownish purplish or light yel-
lowish in color; and followed by two or more, much whiter,
teleoconeh whorls. The four species in this group are
Conus excelsus. Conus miniexcelsus. Conus andrenienezi,
and the two forms of Conus acutangulus described above.
In the second group, the praecellens group (Group II),
the characteristic feature is a white protoconch of two
whorls, with the first protoconch whorl being inflated
and spherical (i.e., “praecellens- like”). The characteristic
shape of this protoconch is diagnostic of this group (as
shown in Figure 6); there may be more species than are
recognized here, since this is a rather variable assem-
blage of forms as is discussed above. C. praecellens and
C. rizali are the two species in this group, with at least
two distinctive forms assigned to C. praecellens .
The third group in Turriconus, based on molecular data
and expanded using morphological similarities, is the
Conus mitratus group (Group III). These species have
much more elongated body whorls than are found in the
two groups above. They seem to share the characteristic
white early teleoconeh whorls before the mature colora-
tion is expressed with the first group. On morphological
grounds alone, we assign two species to this group: Conus
mitratus and Conus cijlindraceus (Broderip and Sowerby,
1830). The molecular evidence in this paper is only pro-
vided for Conus mitratus; however, corroborative molecu-
lar evidence for Conus cijlindraceus has been obtained by
others (C. Meyers, personal communication).
The fourth group in the Turriconus clade is a subge-
nus ( Kurodaconus ) (Group IV) recognized as distinctive
by some workers; the molecular evidence suggests these
species should be included in Turriconus. There are two
species in this group, Conus stupa and Conus stupella; it
is the opinion of several workers on Conus that these
may not be separable species, since they always appear
to occur together. This suggestion needs to be further
evaluated. These forms differ from Groups I and II by
the smooth body whorl, while the species in these groups
have the spiral ribbons or ribs.
THE NAUTILUS, Vol. 124, No. 1
Page 14
The overall hypothesis, based on the combined molec-
ular and morphological data, is presented in Table 2. We
used this working hypothesis as a guide to analyze toxins
in the putative species of the Turriconus clade, from
which DNA samples were available (marked by asterisks
in Table 2).
Using Toxinological Markers to Evaluate the
Turriconus Clade: The hypothesis presented in Table 2
was experimentally tested using a toxinological analysis.
Since cone snails are venomous animals, they use toxins
in their venom to capture prey, defend against predators
and for competitive interactions. Since each species pre-
sumably has a different spectrum of prey, predators and
competitors, the genes encoding venom components are
“exogenes,” which diverge very rapidly as new species
evolve. The peptide toxins that are present in Conus
venoms are encoded by only a few gene superfamilies;
these are predicted to undergo accelerated evolution.
Conus peptide genes are examples of exogenes
( Olive ra, 2006); their gene products act exogenously,
targeting other animals (instead of acting endogenously
within the cone snail itself). A considerable amount of
prior work has demonstrated that each Conus species
has its own distinct complement of venom peptides, with
the same peptides not found in venoms of even closely
related species. What would be predicted when a group
of closely related species is analyzed is that the gene
products encoded by a particular conopeptide superfam-
ily will be highly related to each other, but not identical
in sequence. This toxinological prediction was used to
test if the species proposed to be in the Turriconus clade
do indeed have closely related (but not identical) toxins,
as would be expected for exogene products.
All species for which DNA was available were ana-
lyzed; since no complementary DNA (cDNA) samples
were available, the analysis had to be carried out on
genomic DNA. The gene superfamily used for the anal-
ysis was the O-superfamily; it is possible to determine
the sequence of the mature toxins because there is a
conserved intronic sequence that borders the mature
toxin region (see Materials and Methods) thus, PCR
primers can be used to determine peptide toxin se-
quences from each species. The O-superfamily has
diverged into two branches (Olivera et ah, 1999; Terlau
and Olivera, 2004) one hydrophilic, which includes the
to- and K-conotoxins from fish hunting cone snail venoms
(the “co-branch”) and the second highly hydrophobic;
in fish hunting cone snails this includes the 5 and
pO-conotoxins (the “8-branch”). PCR primers used to
amplify genes in each branch are different and therefore
toxin sequences can be separately obtained. This analysis
was carried out and the results are shown in Figure 7.
It is clear from the figure that representatives of all
four species groups, separated using our aforementioned
morphological/molecular phylogenetic analyses, yielded
homologous O-superfamily peptide sequences that fall
into both the to- and the 5-branches; all of which share a
high degree of sequence identity. Moreover, as predicted
Homologous Peptide Toxins from the O-superfamily
G> - screen
C. acutangulus At6.1
CGGRRAPCRQYIQCCSHSCNTFLGTCV*
C. praecellens Pr6.1
CG S PRARCRQY LQCC SRHC NKFLGMCV *
C. mitratus Mp6.1
CGGPQAPCRQY SQCCSRVCNKFFNKCR*
C. stupa Sa6.1
CG P PRARCRQY LQCC SRRC I KFLNMCM *
8 - screen
C. acutangulus At6.7
DSCLAGSEFCGFLKIGPPCCSGYCLFVCL*
C. mitratus Mp6.7
ECRANGATCGILKPGAKCCDGWCFFVCIG*
C. praecellens Ps6.7
RDD DCVAGGQG CGFPKI GGPCCSGKCFFVCT *
C. stupa Sa6.7
EC FPKDT FCGFPS SGAPCC SGWCFWCA *
Figure 7. Toxinological analysis. Predicted mature toxin
sequences from two distinct branches of the O-superfamily
of conopeptides for four members of Turriconus : Conus
acutangulus. Conus mitratus. Conus praecellens, and Conus
stupa. An independent comparison of the toxin sequences from
the two branches, the hydrophilic to and the hydrophobic 5,
each demonstrate the close relationship between the different
species of the Turriconus clade analyzed.
by the exogenomic hypothesis (Olivera, 2006), these
peptide sequences have diverged from each other.
Therefore, the postulated accelerated evolution of these
exogenes, which, in turn, is an indicator of species diver-
gence, is indeed observed.
DISCUSSION
This study has used three types of data: comparative
morphology, molecular phylogeny based on standard
gene markers, and toxinological markers (i.e., peptide
toxin sequences). This tlnee-pronged effort was aimed
at branch definition leading to a specific phylogenetic
hypothesis. As is typical, none of the individual data sets
were as comprehensive or complete as might be desired;
nevertheless, the combination made the phylogenetic
framework proposed a compelling one.
Morphological Evidence: Importance of the
Protoconch/Early Teleoconch. Springsteen and
Leobrera (1986), separated two forms in the C. pra-
ecellens complex from the Philippines, the commonly
trawled form (designated Conus sowerbii), and a sec-
ond, much more slender form, with lighter yellowish
brown spots, assigned to Conus subaequalis (op. cit,
pi. 71, figs. I, 2). This treatment wtis subsequently
adopted by Lim and Wee (1992). Thus, while Walls
(1979) and Roekel et ah, only recognized C. praecellens
and C. acutangulus, these workers recognized three
distinctive forms from the Philippines/Southeast Asia
J. S. Biggs et al., 2010
Page 15
(“C. sowerbii” (= C. praecellens), “ C.subaequalis and
C. acutangulus) .
One reason why the definition of forms has been chal-
lenging is because most available specimens did not have
good protoconch (or early teleoconch) whorl preserva-
tion. Philippine specimens in this group from many local-
ities have a dark periostracum layer covering the spire of
the shell, which is routinely removed by commercial shell
dealers using acid, a treatment that destroys key features
critical for morphological differentiation. In the analysis
below, we used these “compromised” specimens in our
morphometric analyses but focused primarily on the few
specimens with well-preserved protoconch and early
teleoconch whorls for discriminating between forms.
Once consistent differences in protoconch and early
teleoconch morphologies were established, additional
morphological characters were used to help separate dis-
tinctive forms. This general approach was used for the
morphological definition of forms described above.
The basic approach is illustrated in Figure 8, which
show two forms collected off Aliguay Island; these
have proven to be particularly illuminating. Both would
have been assigned by Roekel et al. (1995) to Conus
praecellens. In Figure 8, the specimen on the right is a
specimen of what we refer to as the “Aliguay form” of
C. praecellens ; the other specimen (on the left) is Conus
miniexcelsus new species. The top section ol Figure 8
shows the shells of the two specimens of approximately
same size. Although their shell patterns differ, the consid-
erable variation observed in this complex led to a rather
confused situation in the past. The major morphological
observation that changed this situation is illustrated in the
lower section of Figure 8, which shows a magnified view
of the well-preserved protoconch and early teleoconch
whorls of the two specimens; we believe that the differ-
ences depicted are sufficiently diagnostic to definitively
assign the specimens illustrated into two distinct groups
(i.e., Conus praecellens and Conus miniexcelsus). The
multispiral brownish protoconch of C. miniexcelsus con-
trasts with the protoconch of the specimen assigned to
C. praecellens; the early teleoconch whorls are also dis-
tinctively different. Using these as the major criteria for
separating forms makes it simpler to identify other shell
morphological characteristics that consistently differ, even
though each individual character might have a consider-
able range of variation. This approach has provided a
much more consistent suite of characters to allow a defi-
nition of different morphospecies.
Using these criteria, the Philippine forms previously
assigned to C. praecellens fall into two separable groups:
a group that has a characteristic protoconch of 2.0-2. 5
whorls, with a rounded and somewhat inflated first
whorl; the protoconchs of these forms are pearly-white;
we have referred to these as the “praecellens -like forms."
The specimens that do not have this very characteristic
type of protoconch, herein collectively referred to as the
“miniexcelsus- like forms”, have the first protoconch
whorl not rounded, nor inflated. The entire protoconch
of the latter generally has a more triangular (conical)
Figure 8. Comparison of two morphospecies collected in
Aliguay Island, Philippines. The specimen at the left is Conus
miniexcelsus (Holotype), and on the right is Conus praecellens ,
“Aliguay form”. Top: The whole shell. Bottom: Close-up of the
protoconch and first few teleoconch whorls.
outline when compared to the “praecellens -like forms;"
these protoconchs are typically translucent-brown, trans-
lucent-yellowish or off-white. Although this color can be
subtle, the contrast to the pure-white early teleoconch
whorls is usually diagnostic.
THE MOLECULAR EVIDENCE
A major conclusion from the molecular analysis is that
C. praecellens and C. acutangulus do not belong in the
Conasprella clade. Instead, they form a distinct branch
among the major group of species in Conus. Another
unexpected result from the molecular phylogenetic anal-
ysis is the other species. Conus stupa and Conus
mitratus, branch within the same well-supported clade
as C. acutangulus and C. praecellens. In particular.
Conus mitratus has strikingly different shell morphology
from C. praecellens and C. acutangulus. In all previous
taxonomic work. Conus mitratus and Conus stupa have
Page 16
THE NAUTILUS, Vol. 124, No. 1
been assigned to different subgenera from Conus
praecellens and Conus acutangulus .
The Contribution of Toxinological Markers. Our
starting point for defining the elade of cone snails that
includes Conus praecellens were the previous proposals
in the literature for subgenera (or genera, when Conus
was split into multiple genera) that included Conus
praecellens. In most proposals, Conus praecellens was, in
effect, proposed to be related to other high-spired, deep-
water species such as Conus pagodus, Conus memiae,
and Conus arcuatus , which are usually assigned to
Conasprella. In some of the prior hypotheses, this
group of species was split in two; e.g., Conasprella and
Kennasprella (da Motta, 1991), or Conasprella and
Endemnoconus (Okutani, 2000). Although these various
proposals differ in detail, they all group C. paraecellens
and C. acutangulus with species such C. pagodus,
C. memiae and C. arcuatus. However, both the molecular
phylogenetic results using standard molecular markers
and the exogenomic data using toxinological markers are
inconsistent with all of these hypotheses; only Conus
praecellens and Conus acutangulus appear to be closely
related to each other by the latter two criteria. All of the
other species previously grouped with Conus praecellens
in prior phylogenetic proposals based on shell morphology
are now assigned to a distant and different branch of
cone snails from Conus praecellens/Conus acutangulus
(see phylogenetic tree in Figure 2).
Instead, the combined data led to a new and strikingly
different phylogenetic framework for the Conus species
comprising the branch that includes Conus praecellens ;
this proposal is summarized in Figure 7 and Table 2. An
entirely unexpected set of species appears to be more
closely related to Conus praecellens (in Groups 3 and 4
in Table 2). These Conus species (C. stupa, C. stupella,
C. mitratus, and C. cylindraceus ) were never previ-
ously proposed to be in the same clade/subgenus as
C. praecellens and C. acutangulus.
The use of toxinological markers has buttressed the
molecular phylogenetic analysis. The presence of highly
similar peptide toxins that belong to the O-superfamily
of conopeptides indicates that the various groups that
branch together with Conus praecellens are indeed
related, using an independent toxinological data set.
THE TURR1CONUS CLADE: OVERVIEW
A more comprehensive morphological analysis reveals
that various distinctive forms previously assigned to
Conus praecellens are likely not conspecific; three new
species were described and additional distinct forms
defined. Thus, Conus praecellens and the newly described
species. Conus miniexcelsus. Conus rizali , and Conus
andremenezi are now proposed to be species in the same
clade.
Finally, the morphological analysis focused on the
importance of protoconch/early teleoconch whorl mor-
phology. These morphological characters strongly suggest
that Group I in Table 2 should include Conus excelsus
given its strikingly similar protoconch/early teleoconch
morphology to C. acutangulus and C. miniexcelsus.
Clearly, there is a difference in size: Conus excelsus is
much larger at maturity. We would predict that the
molecular phylogeny and toxinology of C. excelsus wall
reveal a particularly close affinity to Conus miniexcelsus
(which is, in part, the basis for the proposed name of the
latter). Unfortunately, Conus excelsus is rare and we
have been unable to obtain a live specimen to date.
However, we propose to call the entire group the
Turriconus clade, with C. excelsus as the type species.
In terms of species diversity, it would appear that
Groups 1 and 2 in Table 2 are the dominant species
groups of this clade — except for the differences in
protoconch morphology detailed above, they are all
high-spired species with the body whorls characterized
by spiral ribs or ribbons. Conus excelsus is the type
species of the subgenus Turriconus.
All three types of data used for this investigation need
to be expanded. A more extensive molecular phylogeny
needs to be carried out on all of the forms indicated in
Table 2, including, in particular, the designated “distinc-
tive forms” so that an evaluation of whether these are
separable species can be carried out. The new species
we have proposed need to be rigorously evaluated both
by the standard molecular markers as well as by their
toxin genes. More refined molecular phylogeny should
also allow a better resolution of how the various forms
in the proposed Turriconus clade are related to each
other and to other species of Conus. In addition, the
exogenomic analysis, while in agreement with the molec-
ular phylogeny, also needs to be extended to all of the
species in the Turriconus clade, as well as to other gene
superfamilies expressed in venom ducts (in addition to
the O-gene superfamily that was shown in Figure 8). The
determination of venom peptide sequences by this type
of analysis is, in itself, of considerable intrinsic value,
since it would allow the predicted gene products from
each species to be chemically synthesized and directly
tested for functional activity. Finally, the morphological
analyses to date are based only on shell morphology.
Clearly, other morphological features, particularly the
internal anatomy, need to be evaluated; these will serve
as an independent test of the phylogenetic hypothesis
presented. Potentially, mutually shared and distinctive
morphological features of species in this clade of Conus
may be discovered.
The interaction between the three prongs that are the
basis of the approach used in this manuscript has a
potential synergy that goes beyond clade definition. The
morphological analysis of distinctive forms within the
Conus praecellens complex identifies candidates that
may or may not be different species, separable from the
ones already recognized. Using standard molecular phy-
logeny will help to define this; however, using exogene
analysis should be even more definitive: if these were
indeed separable species, then none ol the toxin gene
products should exactly overlap in their sequence,
J. S. Biggs et ah, 2010
Page 17
Because of the hypermutation in exogenes that accom-
panies speciation events.
If a distinctive form was truly a separable species,
different toxin sequences would be predicted — if it
were merely a variant ol the same species, then identity
in most venom peptide sequences should be found
(except for allelic differences). In some of the well-
known species (e.g., Conus textile , Linnaeus, 1758, and
Conus striatus Linnaeus, 1758) that are distributed all
over the Indo-Pacific, it has been shown that major
venom peptides have the same sequence, even from
variants whose shells may be distinguishable from each
other because of the long period it may have taken for a
species to spread across the entire Indo-Pacific, from the
Red Sea to Hawaii.
The inclusion of exogenes in the investigation of bio-
diversity has a significance that goes beyond differentiat-
ing between morphologically closely related species.
The divergence of exogenes from one species to the next
is indicative of different biolog)', shaped by different
selection pressures. This is essentially a molecular read-
out of the deeper biological/historical/ecological differ-
ences between species that might look morphologically
similar. Thus, the characterization of toxin genes in the
case of Conus not only serves as a tool for branch defini-
tion, but is a potentially important entiy point toward a
more profound understanding of the biological differ-
ences between species, a molecular readout that could
provide insights into the complex changes that accom-
pany the speciation events that give rise to a biodiverse
lineage of animals such as the cone snails.
ACKNOWLEDGMENTS
This work was supported by Program project grant
GM48677 from the National Institutes of General
Medical Sciences. We are grateful to Adam Baldinger
of the MCZ, Philippe Maestrati and Philippe Bouchet,
MNHN, Paris, and Paul Callomon and Gary Rosenberg,
ANSP, for the loan of specimens used in this study. We
are grateful to Chris Meyers for making his sequences
for C. cylindraceus available to us.
LITERATURE CITED
Bandyopadhyay, P. K., B.[. Stevenson, |.P. Ownby, M.T. Cady,
M. Watkins, and B.M. Olivera. 2008. The mitochondrial
genome of Conus textile, coxl-coxll intergenic sequences
and Conoidean evolution. Molecular Phylogenetic Evolu-
tion 46: 215-223.
da Motta, A. j. 1991. A systematic classification of the gastropod
family Conidae at the generic level. La Conchiglia, Rome,
48 pp.
Huelsenbeck, J.P, F. Ronquist, R. Nielsen, and J.P. Bollback.
2001. Bayesian inference of phylogeny and its impact on
evolutionary biology. Science 294: 2310-2314.
Larkin, M.A., G. Blaekshields, N.P Brown, R. Chenna,
PA. McGettigan, PI. McWilliam, F. Valentin, PM. Wallace,
A. Wilm, R. Lopez, J.D. Thompson, T. | Gibson, and
D.G. Higgins. 2007. Clustal W and Clustal X version 2.0.
Bioinformatics 23: 2947-2948.
Lim, C.F., and V.T.H. Wee. 1992. Southeast Asian Conus, a sea-
shells book. Seaconus Private Limited, Singapore, 100 pp.
Maddison, D.R. and W. P. Maddison. 2005. MacClade 4.08.
Marsh, J.A. and O.IP Rippingale. 1964. Cone Shells ol the
World. 3rd Edition. Jacaranda Press, Melbourne, 186 pp.
Okutani, T. 2000. Marine Mollusks in Japan. Tokai University
Press, Tokyo, 1221 pp.
Olivera, B.M., 2006. Conus peptides: biodiversity-based dis-
covery' and exogenomics. Journal ol Biological Chemistry
281: 31173-31177.
Olivera, B.M., C. Walker, G.E. Cartier, D. Hooper, A.D. Santos,
R. Sehoenfeld, R. Shetty, M. Watkins, P. Bandyopadhyay,
D.R., and Hillyard. 1999. Speciation of cone snails and
interspecific hyperdivergence ol their venom peptides.
Potential evolutionary significance of introns. Annals of
New York Academy of Science 870: 223-237.
Reeve, L.A. 1849. Monograph of the genus Conus. I,. Reeve
and Co., London.
Robin, A. 2008. Encyclopedia ot Marine Gastropods.
XENOPHORA and ConchBooks, Hackenheim, 480 pp.,
461 pis.
Rockel, D.. W. Korn, and A. |. Kohn. 1995. Manual of the
Living Conidae (Vol. 1: Indo-Pacific Region) Verlag
Christa Hemmen, Wiesbaden, 517 pp.
Ronquist, F J.P. and Huelsenbeck. 2003. MrBayes 3: Bayesian
phylogenetic inference under mixed models. Bioinformat-
ics 19: 1572-1574.
Shikama, T. and T. Habe. 1968. A New Japanese Cone,
Turriconus nakayasui with Reference to Embrikena stupa
group. Venus 26: 3-4.
Springsteen, F.J. and F. M. Loebrera. 1986. Shells of the Phil-
ippines. Carfel Seashell Museum, Manila, 377 pp., 100 pis.
Terlau, H. and B.M. Olivera. 2004. Conus venoms: a rich
source of novel ion channel-targeted peptides. Physiologi-
cal Reviews 84: 41-68.
Thach, N.N. 2005. Shells of Vietnam. ConchBooks,
Hackenheim, 338 pp., 91 pis.
Walls, J.G., 1979. Cone Shells. A synopsis of the living Conidae.
TFII Publications Inc. Ltd., Neptune City, 101 1 pp.
Page 18
THE NAUTILUS, Vol. 124, No. 1
APPENDIX
Baldomero M. Olivera and Jason S. Biggs
Conus andremenezi, summary of type specimens (Figures of types are cross-referenced)
J. S. Biggs et al., 2010
Page 19
APPENDIX
(Continued.)
Abbreviations: MSI, Marine Science Institute, University of the Philippines, Quezon City, Philippines, ANSP, Academy of Natural
Sciences, Philadelphia, PA, USA; MNHN, Museum national d’Histoire naturelle, Paris, France; MCZ, Museum of Comparative
Zoology, Harvard University, Cambridge, MA, USA; BMSM, The Bailey- Matthews Shell Museum, Sanibel FL, USA; FMHN, Field
Museum of Chicago, Chicago IL, USA; Lc, Zoological Museum of Moscow State University, Moscow, Russia; *, These specimens wall
be deposited in public museums, but have not yet been assigned.
THE NAUTILUS 124(l):20-24, 2010
Page 20
An anatomical note on Moellendorffia eastlakeana
(Mollendorff, 1882) a camaenid land snail from Vietnam
(Gastropoda: Pulmonata: Camaenidae)
Somsak Panha
Chirasak Sutcharit
Animal Systematic Research Unit
Department of Biology
Faculty of Science
Chulalongkorn University
Bangkok, 10330, THAILAN D
[email protected]
Dang Ngoe Can
Department of Zoology
Institute of Ecology and Biological Resources
18 Hoang Quoe Viet Road
Can Giay, Hanoi, VIETNAM
ABSTRACT
Newly collected specimens of Moellendorffia eastlakeana
(Mollendorff, 1882) expand the known range of this species into
Vietnam. Using these new Vietnamese and existing museum
samples we have re-described the species including new infor-
mation on radula and genital anatomy. Comparison with the
type material of M. callitricha (Bavay and Dautzenberg, 1899)
from Vietnam suggested M. callitricha is a junior synonym of
M. eastlakeana.
Additional keywords: Gastropoda, pulmonate, Traumatophora,
Chloritis, T ri ch elix
INTRODUCTION
The land snail genus Moellendorffia Ancey, 1887, has a
wide distribution in southeastern China, Hong Kong and
Vietnam. The detached peristome, descending aperture
with denticles, and hirsute shell with external furrows,
confer a very distinctive morphology on the shells
(Pilsbry, 1890, 1895, 1902, 1905; Yen, 1939; Azuma,
1982).
Currently, seven species are recognized within this
genus, namely: M. trisinuata (von Martens, 1867),
M. eastlakeana (Mollendorff, 1882), M. hensaniensis
(Gredler, 1885), M. loxotata (Mabille, 1887), M. messageri
(Bavay and Dautzenberg, 1899), M. spurca (Bavay and
Dautzenberg, 1899), and M. depressispira (Bavay and
Dautzenberg, 1908) (Pilsbry, 1905; Zilch, 1966; Richard-
son, 1985).
Originally, Moellendorffia was placed by Pilsbry (1890)
in a section of Helix (Stegodera) Martens, 1876, then
reclassified by Pilsbry (1894) as a subgenus ol Heli-
codonta Ferussac, 1819, and finally (Pilsbry, 1905) as a
distinct southeastern Chinese and Indo-Chinese genus
related to Stegodera and allied to Chloritis Beck,
1837. Likewise, Trichelix Ancey, 1887, was originally
placed by Pilsbry (1905) along with Moellendorffiella
Pilsbry, 1905, as subgenera within Moellendorffia , and
Traumatophora Ancey, 1887, as a subgenus of Stegodera.
Subsequently, Schileyko (2003) recognized Trichelix
as a genus distinct from Moellendoiffia and Zilch (1959)
separated Traumatophora as a genus distinct from Stego-
dera on the basis of the possession of a dextral shell with
apertural teeth.
The early descriptive work on Mollendorffia was
restricted to shell i Morphology (e.g., Pfeiffer, 1862;
Mabille, 1887; Bavay and Dautzenberg, 1899; 1908,
Pilsbry, 1902; 1905). Subsequently, Habe (1957), Azuma
(1982), and Schileyko (2003) provided some additional
anatomical information for M. trisinuata and Trichelix
eucharista (Pilsbry, 1902) (= M. (Trichelix) eucharista ).
In this article, we examine specimens of M. eastlakeana
collected from a forest reserve in northern Vietnam and
compare them to museum material originally collected
from other locations.
MATERIALS AND METHODS
We examined three specimens of M. eastlakeana collected
in May 1999 from the Huu Lien Nature Reserve, Lang
Son Province, northeastern border of Vietnam, which are
now deposited in the Chulalongkorn University, Museum
of Zoology (CUMZ). Type and other materials were criti-
cally examined in the Senckenberg Museum, Frankfurt
(SMF) and Museum National d’Histoire Naturelle, Paris
(MNHN). Terminology for soft anatomy follows that of
Habe (1957) and Schileyko (2003). The terms “proximal”
and “distal” refer to a position relative to the genital ori-
fice. Methodology for whorl counts and shell measure-
ments follow Kerney and Cameron (1979).
Abbreviations: at, atrium; e, epiphallus; fl, flagellum;
fo, free oviduct; gd, gametolytic duct; gs, gametolytic
S. Panha et al., 2010
Page 21
sac; hw, head wart; ov, oviduct; p, penis; pp, penial
pilaster; pr, penial retractor muscle; pv, penial verge;
v, vagina; vd, vas deferens; vp, vaginal pilaster.
SYSTEMATICS
Family Camaenidae
Genus Moellendorffia Ancey, 1887
Type species: Helix trisinuata von Martens, 1867,
Hong-Kong, China; by subsequent designation ol Pilsbry
(1905: 64).
Diagnosis: Shell medium size (11.5x19.5 mm), de-
pressed, rather thin, umbilicate and corneous to brown-
ish. Spire low to slightly convex; embryonic shell nearly
smooth; subsequent whorls granulated and with short to
long periostracal hairs. Last whorl rounded to shoulder
and suddenly descending anteriorly. Aperture trigonal
or squarish, entirely free from preceding whorl; usually
with barriers inside and externally marked with furrows.
Peristome expanded and continuous. Penis and epi-
phallus long, flagellum short and vagina long. Penial
wall with longitudinal pilasters. Radula with triangular-
shaped teeth.
Moellendorffia eastlakeana (Mollendorff, 1882)
Helix eastlakeana Mollendorff, 1882: 185 (Tai-mo-shan,
Kwangtung, China (= Hong Kong): Lectotype SMF 8328
by Yen, 1939); Mollendorff, 1885: 391, pi. 10, tig. 18.
Ancey, 1887: 64
Helix (Moellendorffia) eastlakeana. — Pilsbry, 1890: 12, 13, pi. 1,
figs 21, 22; Pilsbry, 1895: 290.
Stegodera eastlakeana. — Pilsbry, 1890: 310 (figure legend),
pi. 1, figs 21, 22.
Helix (Moellendorffia) callitricha Bavay and Dautzenberg,
1899: 35, pi. 1, figs 6, 6b (That-Khe near Lang Son,
Vietnam).
Moellendorffia eastlakeana . — Pilsbry, 1905: 65; Yen, 1939: 125,
228, pi. 13, fig. 3 (Lectotype SMF 8328); Richardson,
1985: 184.
Moellendorffia callitricha. — Pilsbry, 1905: 66; Richardson,
1985: 183.
1 mm 1 mm 5 mm
Figures 1-4. Shell characteristics of Moellendorffia eastlakeana , CUMZ 2547. 1. Shell morphology. 2. Shell surface structure and
showing the bristles on the periostracum. 3. Protoconch sculpture 4. Apertural lamellae.
THE NAUTILUS, Vol. 124, No. 1
Page 22
Moellendorffia (Moellendorjfia) eastlakeana. — Zilch, 1966: 210,
pi. 6, fig. 52 (Lectotype SMF 8328).
Material Examined: Tai-mo-shan, Hong Kong: Lee-
totype SMF 8328, Paralectotype SMF 8329 (2 shells);
Huu Lien Nature Reserve, Lang Son Province, Vietnam:
CUMZ 2547 ( I specimen), CUMZ 2549 (2 shells); That-
Khe, Tonkin, Vietnam (1 shell), MNHN Holotype of
“ callitricha ”; That-Khe, Tonkin, Vietnam (2 shells),
Denis collection (NMHN); That-Khe, Tonkin, Vietnam
(I shell), Staadt collection (NMHN); Tonkin, Vietnam
(1 shell), Messager collection (NMHN); Tonkin, Viet-
nam (2 shells), Messager collection (NMHN)
Measurements: From 10 specimens analyzed; shell
height ranged from 12.4 to 14.7 mm (mean 13.5±1.0
mm); shell width ranged from 20.8 to 23.9 mm (mean
22. 0±1. 2); and whorl count ranged from 6.0 to 6.1
whorls.
Shell: Shell (13.5 mm height, 22.0 mm width) slightly
thin, translucent, depressed globose and deeply umbili-
cate. Spire flat to convex. Shell brownish to light brown;
upper surface with long hairs (Figures I, 2); lower sur-
face with short hairs, few hairs around umbilicus. Shell
surface rough, rows of tubercles running obliquely anil
descending, relatively smooth around umbilicus. Embry-
onic shell large and with very fine growth lines (Figure 3).
Whorls 5-6, slightly convex and increasing regularly;
suture depressed. Last whorl rounded and little con-
vex below periphery. Aperture ear-shaped; lip margin
light brown and continuously expanded; externally with
furrows. Peristome free from preceding whorl and
abruptly descending. Aperture brownish inside with
well -developed, whitish, and semi-circular palatal and
basal lamellae located closed to apertural lip. Two exter-
nal furrows align with the internal apertural denticles.
Parietal callus thickened, elevated, emarginated and
obtusely projecting inward (Figure 4).
Genitalia: Atrium (at) short; penis (p) long; proxi-
n i ally with short penial verge and folded at penial verge
based; distally long and somewhat slender. Epiphallus
(e) shorter than penis. Flagellum (fl) short, small and
without appendix. From free oviduct, vas deferens (vd)
follows vagina and penis and connects distally on
epiphallus. Penial retractor muscle (pr) thin and veiy
long (Figure 5).
Internal wall of penis ribbed by series of swollen lon-
gitudinal pilasters (pp) (Figure 6). Smooth pilasters line
introverted penial chamber and encircle penial verge tip.
Penial verge (pv) short, conic and smooth (Figure 6).
Vagina (v) of similar length to penis, cylindrical and
held in position by connective tissue attached to foot
floor. Slightly swollen proximally; more slender distally.
Gametolytic duct (gd) as wide as gametolytic sac (gs) for
most of its length but narrows before gemetolytic sac.
Free oviduct (fo) short; oviduct (ov) small (Figure 5).
Internal wall of vagina possess several longitudinal
vaginal pilasters (vp) with smooth pilaster surfaces
(Figure 6).
Animal: Live animal covered with blackish reticulated
skin and dorsally with whitish stripe in middle ol the
Figures 5-7. Reproductive system of Moellendorffia eastlakeana , CUMZ 2547. 5. General view ol the genital system. 6. Interior
structure of the atrium, penis and vaginal chamber. 7. Dorsal view showing head wart.
S. Panha et al., 2010
Page 23
body. A small curve-shaped head wart (hw) is located
between the posterior tentacles (Figure 7). Foot narrow
and long; mantle edge grayish; tentacles gray, and lower
tentacles paler. Mantle cavity with blackish pigmenta-
tion. Live snails possess short to long periostracal hairs,
which mostly break off after death.
Radula: Teedi arranged in anteriorly pointed V-shaped
rows, each row contains about 70 (34-(15-17)-l-( 15-17)-
35) teeth. Central toodr triangular with minute eetocones.
Teeth become taller laterally. Lateral teeth tricuspid;
endocones and eetocones small and located half way
along tooth length (Figure 8). From tooth 16 to 17 out-
ward lateral teeth, the marginal ectocone originates from
the tooth base (Figure 9). Marginal teeth rather small,
tricuspid and aligned obliquely; endocone becomes taller
than mesocone; ectocone located basally (Figure 10),
sometimes divided into two or three cusps in outermost
teeth.
Distribution: Moellendorffia eastlokeana was previ-
ously known only from the type locality: Tai-mo-shan,
Hong Kong (Mollendorff, 1882, 1885; Pilsbry, 1890;
Yen, 1939; Zilch, 1966). Our material was collected from
Huu Lien Nature Reserve, Lang Son Province, north-
eastern border of Vietnam.
Remarks: On examination of the holotype of M. calli-
tricha and other topotypic material identified as this
species, the only detectable difference was a slightly ele-
vated spire relative to that of the lectotype of M. cast-
lake ana and other material recognized as M. eastlokeana.
On this basis we consider M. callitricha to be a junior
synonym of M. eastlokeana.
The locality characteristic of our sampling is mon-
soonal karst landform with high humidity. The sn; xils
occurred among the tropical moist deciduous forest.
There was rain before the time of our visit in May, 1999.
The snails were active, crawling on moist rotten logs.
Moellendorffia (M.) eastlokeana is distinctly different
in shell morphology from M. (M.) messaged (Bavay and
Dautzenberg, 1899), which occurs in the same area. The
latter species has a much smaller shell (about 8 mm
height; 14 mm width), flattened spire and shouldered
last whorl .
DISCUSSION
The newly collected material from Vietnam presents
valuable additional information for the taxonomic revi-
sion of Moellendoijfia and it allies. The presence ol
shell apertural lamellae and shell external furrows appear
as common shell characters among Moellendoijfia ,
Trichelix, and Moellendorffiella.
In consideration to the generic relationship, the pres-
ence ol lamellae and external furrows could be com-
mon characters among Moellendorffia, Trichelix, and
Moellendorffiella. The long epiphallus, short flagellum,
and triangular shape of the radula central tooth in both
Figures 8-10. Scanning electron micrographs of Moell-
endorffia eastlokeana radula, CUMZ 2547. 8. Central teeth
with the first to the third lateral teeth (black arrows indicate
endocone and ectocone). 9. Lateral teeth with the tricuspid
marginal teeth transition. 10. Marginal teeth. Central tooth is
indicated by “C” and the other numbers indicate the order of
lateral and marginal teeth.
Page 24
THE NAUTILUS, Vol. 124, No. 1
Trichelix and Moellendorjfia (Habe, 1957; Schileyko,
2003) may support their having a close relationship.
The parietal callus free from a preceding whorl, with
aperture lamellae, ear shaped aperture, and long hairs
are possibly the distinctive characters of Moellendorffia
sensu stricto. The position of two furrows (upper and
lower periphery), parietal callus thickened at the edge,
and tuberculated penial wall are probably the unique
characteristics of Trichelix. Unfortunately, the anatomy
of species of Moellendorjfiella is still lacking for
comparison, but the differences lie tween shells of
Moellendorffiella and Moellendorffia are the shouldered
last whorl, flattened spire, parietal callus shortly
attached to penultimate whorl, and rounded aperture
(Pilsbry, 1890, 1905). These differences support the dis-
tinct generic position of Moellendorffia, Trichelix, and
Moellendorffiella as proposed by Schileyko (2003).
However, with so few samples and, especially, so few
different species and informative morphological charac-
ters, the exact phylogenetic relationships remain equiv-
ocal. To better resolve the exact phylogeny, we suggest
that the anatomical examination from more localities
within each species range and from different species
required is still insufficient, however a molecular based
phylogenic approach is required in conjunction with
morphology traits.
ACKNOWLEDGMENTS
We thank F. Naggs (NHM, London), R. Janssen (SMF,
Frankfurt), and P. Bouehet and V. Heros (MNHN, Paris)
for permitting S.P. and C.S. to investigate type materials,
and FN. for critical comments on the manuscript. We
are especially grateful to S. Natsupakpong, P. Tongkerd,
N. Pattaramanon, and S. Pholkoksung for providing
important literature and assistance in the field. This
project was funded by the Thailand Research Fund (TRF),
the Thai-French Project TRF-CNRS (BRT 245005), the
RES-A1B1-7, the SP2-TKK2555-PERFECTA, and the
Darwin Initiative Project (DEFRA).
LITERATURE CITED
Ancey, C.F. 1887. Description of new genera or subgenera of
Helieidae. The Conchologists Exchange 1: 64.
Azuma, M. 1982. Colored illustrations of the land snails of
Japan. Hoikusha, Japan, i-xvi, 1-343 pp, pis 1-63.
Bavay, A. and P. Dautzenberg. 1899. Descriptions d’espeees
nouvelles de l'lndo-Chine, II. Journal de Conchyliologie
47: 28-55, pis 1-3.
Bavay, A. and P. Dautzenberg. 1908. Molluseorum terrestrium
Tonkinorum diagnoses. Journal de Conchyliologie 56:
229-251.
Habe, T. 1957. Anatomy of Moellendoiffia (Trihelix) euch-
aristus (Pilsbry). The Nautilus 71: 8-9, pi. 1.
Kerney, M.P and R.A. D. Cameron. 1979. A field guide to the
land snails of Britain and north-west Europe. Collins,
London, 288 pp.
Mabille, M.J. 1887. Sur quelques mollusques du Tonkin. Bul-
letins de la Societe Malacologique de France 4: 80-164,
pis 1—4.
Mollendorff. O. von. 1882. Diagnoses specierum novarum
chinae meridionalis. Jahrbiieher der Deutsehen Malako-
zoologischen Gesellschaft 9: 179-188.
Mollendorff. O. von. 1885. Materialien zur fauna von China
(Die Auriculaceen, Naehtrage und Beriehtigungen).
Jahrbiieher der Deutsehen Vlalakozoologisehen Gesell-
schaft 12: 349-398, Tafel 9-11.
Pfeiffer, L. 1862. Descriptions of thirty six new land shells from
the collections of H. Cumming, Esq. Proceedings of the
Zoological Society of London 1862: 268-278, pi. 36.
Pilsbry, H.A. 1890-1891. Manual of Conchology, Series 2, Vol-
ume 6. The Academy of Natural Sciences of Philadelphia,
Philadelphia, 1-324,' pis 1-69.
Pilsbry, H.A. 1893-1895. Manual of Conchology, Series 2, Vol-
ume 9. The Academy of Natural Sciences of Philadelphia,
Philadelphia, iii-xlvii, 1-366, pis 1-71.
Pilsbry, II. A. 1902. New land Mollusca from Japan and the Loo
Choo islands. Proceeding of the Academy of Natural Sci-
ences of Philadelphia 53: 344-353.
Pilsbry, H.A. 1905. Notes on Moellendoiffia and Stegodera.
The Nautilus 19: 63-67, pi. 2.
Richardson, L. 1985. Camaenidae: Catalog of species. Tryonia
12: 1-479.
Schileyko, A. A. 2003. Treatise on recent terrestrial pulmonate
mollusks. Trigonochlamydidae, Papillodesmidae, Vitri-
nidae, Limacidae, Bielziidae, Agriolimacidae, Boetgeri-
llidae, Camaenidae. Ruthenica, Supplement 2. Part 11:
1467-1626.
Yen. T. -C. 1939. Die chinesischen land- und SiiBwasser-Gas-
tropoden des Natur- Museums Senckenberg. Abhandlun-
gen der Senckenbergisch-Naturforschenden Gesellschaft
444: 1-234, Tafel 1-16.
Zilch, A. 1959-1960. Gastropoda, Euthyneura. In: Handbuch
der Paliiozoologie (O. H. Sehindewolf, ed.), 6: 1-834.
Gebriider Borntraeger, Berlin.
Zilch, A. 1966. Die typen und typoide des Natur-Museum
Senckenberge, 34: Mollusca: Camaenidae (4). Arehiv ftir
Molluskenkunde 95: 197-223.
THE NAUTILUS 124(1 ):25-33, 2010
Page 25
Terrestrial gastropods from Haida Gwaii (Queen Charlotte
Islands), British Columbia, Canada, including description
of a new northern endemic slug (Gastropoda:
Stylommatophora: Arionidae)
Rristiina Ovaska
Biolinx Environmental Research Ltd.
424 Viaduct Avenue, Victoria
V9E 2B7, CANADA
[email protected]
Lyle Chichester
209 Chestnut Springs Way,
Williamston SC 29696 USA
[email protected]
Lennart Sopuck
Biolinx Environmental Research Ltd.
1759 Colburne Place, Sidney
BC VSL 5A2, CANADA
[email protected]
ABSTRACT
Reflecting its isolation, geography, and glacial history, the
Haida Gwaii archipelago (Queen Charlotte Islands, British
Columbia) contains numerous endemic and disjunct taxa of
various groups of organisms, but terrestrial gastropods have
received scant attention. During surveys of 56 sites on Graham
and Moresby Islands and 11 smaller islands, including remote
mountain top locations, we detected 18 species of native ter-
restrial gastropods, most of which also occur in southwestern
British Columbia. An undescribed species of semi-slug was
found at four sites on Graham Island and six sites on Moresby
Island and is formally described (Arionidae: Staala gwaii).
Morphological and anatomical analyses suggest that the new
slug is related to small species of Hemphillia Bland and Binney,
1872, but the differences are substantial, warranting the estab-
lishment of a new genus. The new species is of particular
interest because it appears to be a northern endemic and a
relict to the archipelago.
Additional keywords: Gastropoda, Arionidae, Staala gwaii ,
Queen Charlotte Islands, anatomy, endemism
INTRODUCTION
Haida Gwaii (Queen Charlotte Islands) is an isolated
archipelago located at the edge of the North American
continental shelf in the North Pacific Ocean. A distance
of at least 80 km separates the islands from the nearest
landmass to the east across Hecate Strait on the mainland
British Columbia and to the north across Dixon Entrance
on the Alaskan panhandle. The biota of the islands in-
cludes endemic and unusual disjunct populations from a
wide range of taxonomic groups (e.g., vascular plants:
Ogilvie, 1989, 1994; bryophytes: Schofield, 1989a,b; cara-
bid beetles: Clarke et al., 2001; birds and mammals:
McTaggart Cowan, 1989). Endemism and disjunct distri-
butions have been interpreted to reflect the geographic
isolation of the archipelago and differentiation in situ , in
combination with complex patterns of past recolonization
and extinction events.
Terrestrial gastropods of Haida Gwaii are poorly
documented, and knowledge of this group is largely
restricted to serendipitous observations as part of studies
of other organisms. Terrestrial gastropods as a group can
be useful for elucidating phylogeographic patterns, as
many species have poor dispersal abilities it not aided
by humans and can survive in small habitat patches
(Cowie and Holland, 2006). From 2000 to 2004, we sur-
veyed numerous sites on the two main islands (Graham
and Moresby) and on smaller islands of the archipelago
for terrestrial gastropods. Here we report the results of
these surveys and describe a new genus and species of
arionid semi-slug, presumed to be a relict, and endemic
to the archipelago.
MATERIALS AND METHODS
Study Sites; We sampled 56 sites on Graham (6883
km") and Moresby (3066 km") islands and on 1 1 smaller
islands in the Hecate Strait: Lyell (181 km"), Kunghit
(134 km2), Burnaby (66 km"), Tanu (23 km"), Huxley
(6.7 km2), SGang Gwaii (2.9 lori2), Kat (0.7 km2), Bischofs
(1.1 km"), Hotspring (0.2 km"), Ellen (0.2 km"), and
Slug Islet (0.03 km") (Figure 1; see RBCM website
for coordinates and habitat descriptions). More than one
habitat or sub-site within a 1 km area was sampled at
seven of these sites. The surveys took place in Apr. 2000,
Jul.-Oct. 2002, Sep.-Nov. 2003, and Sep. 2004. The focus
was on old-growth forest (28 sites), dominated by Picea
sitchensis, Tsuga heterophylla , and Thuja plicata and
with an understory of Vaccinium species, Gaultheria
shallon, Menziesia ferruginea , and Blechnum spirant.
Other habitats sampled consisted of older (> 80 years
old) second-growth coniferous forest (12 sites), young
forest with a large component of Abuts rugosa (< 60 years
old) (3 sites), subalpine and alpine meadows (7 sites), bog
Page 26
THE NAUTILUS, Vol. 124, No. 1
Figure 1. Map of sampling sites in the Haida Gwaii (Queen
Charlotte Islands archipelago. Site numbers correspond to those
in Table 1 (see RBCM website for coordinates and habitats).
Biogeoclimatic zones: AT-alpine tundra, MH-mountain hemlock,
CWH-coastal western hemlock (Meidinger and Pojar, 1991).
with stunted trees (3 sites), and other open habitats (rocky
bluff, wet meadow, riparian fringe, thermal meadow, sand
dune) (9 sites). The alpine sites were on rocky slopes with
sparse ground cover, including hummocks ol grasses,
sedges, heathers, and erowberry ( Empetrum nigrum).
The subalpine sites contained scattered stunted trees
and shrubs, including Pinus contorta , Chamaecyparis
nootkatensis , Tsuga mertensiana , and Juniperus species.
In 2004, we specifically targeted subalpine-alpine habi-
tats, which were suspected to support populations of the
new species of slug.
Gastropod Sampling and Identification: The main
survey methods consisted of timed searches of natural
cover on the forest floor (59 plots at 50 sites) and inspec-
tions of cardboard cover-objects (36 plots at 9 sites).
Additionally, we extracted small snails from litter sam-
ples from two sites, including an experimental forestry
site that was sampled intensively in two years (102 1 of
litter dried and sieved and residues examined for snail
shells). Searches of natural cover focused on key micro-
habitat features for gastropods, such as piles of bark or
an abundance of decaying logs or stumps. Observers
visually scanned the surface of the forest floor and vege-
tation, turned over downed logs, sloughed-off bark, and
rocks, and examined handfuls of leaf-litter. At one site
(Site 2a-d in Figure 1), the surveys were both time- and
area-constrained, and the observers searched 100x1 m
transects in four different habitats for 40 minutes. The
total search time for surveys of natural cover was 86.7
person-hours (x ± SE = 88 ± 7 min/site).
The cardboard cover-object method (Hawkins et ah,
1998) permitted repeated sampling of gastropods with
minimal disturbance to the habitat. We used cover-
objects constructed of layers of corrugated cardboard
(dimensions 30 cm x 30 cm) placed at stations 10 m apart
along transects of 10 sampling stations and inspected
them one or more times after they had weadiered on the
forest floor for at least two weeks. There were a total of
1072 cardboard cover-objects on 36 plots at 9 sites. One
site (Site 1 in Figure 1) was used as an experimental site
for investigating logging effects and was sampled inten-
sively and repeatedly (800 cover-objects inspected four
times; in 2002 anti 2006; KO and LS, unpublished data).
Identification of gastropods was based on descriptions
in Pilsbry (1940, 1948) and Forsyth (2004). Nomencla-
ture follows Forsyth (2004). Snails were identified using
shell characteristics. Any small snails that could not be
readily identified in the field were collected and exam-
ined under a dissecting microscope. Some snails (notably
juveniles of Ancotrema and Pristiloma , and most Vertigo)
were identified to genus only. Of slugs, several spec-
imens of Staala gwaii , new species, and a sample of
Prophysaon foliolatum, and P. vanattae, were dissected,
and their reproductive anatomy was examined. Voucher
specimens are deposited in the Royal British Columbia
Museum, Victoria, British Columbia, Carnegie Museum
of Natural History, and in the personal collections of
K. Ovaska and R. Forsyth.
Dissection of Specimens: Seven specimens of the
new species, preserved in 70% ethanol, were dissected
by LC under a dissecting microscope (7.5-35X magnifi-
cation). Parts removed for further study were mounted
on standard microscope slides and examined under a
compound microscope (40-400X magnification). Hema-
toxylin stain was used to make a permanent slide of the
penis. Mounted specimens were dehydrated in 95%
and 100% ethanol. Toluene was used as a clearing agent
and specimens were mounted in Permount (Fisher Sci-
entific, Fairlawn, New Jersey).
RESULTS
Gastropod Species Found
Surveys of 56 sites resulted in the detection of 18 native
and four alien species of terrestrial gastropods (Table 1).
Five species predominated in the samples: Ariolimax
columbianus (71.4% of sites), Vespericola columbianus
sp. (subgenus Pristiloma)
Polygyridae:
Page 28
THE NAUTILUS, Vol. 124, No. 1
(71.4% of sites), Prophysaon foliolatum ( 60.7 % of
sites), Haplotrema vancouverense (66.1% of sites), and
Pristiloma stearnsii (57.1% of sites). All these species
were widely distributed in forests throughout the archi-
pelago. Several snails with unusual, clear, transparent
shells were found at one locality on Graham Island (Site
1 in Figure 1), but were attributed to Pristiloma stearnsii
based on other shell features.
We found IS species of terrestrial gastropods on
Graham Island and 15 on Moresby Island. On the
smallest island sampled, a rocky bluff (Slug Islet), we
found two species; on the remaining 10 small islands
we found 4-9 species each (x = 6.4, SD = 1.6).
Alien gastropods, represented by four species, were
found only at a few sites that were either disturbed and
in early suecessional stages on Graham and Moresby
Islands or received regular human visitation (Hotspring
Island); older forest and small islands, apart from
Hotspring Island, appeared to be free of alien species.
Slugs, represented by P. foliolatum , P. vanattae, and
S. gwaii , dominated the gastropod fauna in the subal-
pine and alpine sites sampled, whereas other gastro-
pods, including A. columbianus, H. vancouverense , and
P. stearnsii were found infrequently and in very low
numbers in these habitats; A. columbianus occurred only
at sites with patches of trees and shrubs. P. foliolatum was
the only gastropod found at two alpine sites that were
devoid of trees and shrubs (Sites 31 and 34 in Figurel).
A New Species of Arionid Slug
A slug that did not fit within the description of any known
species was encountered at four sites on Graham Island
and six sites on Moresby Island (Figure 2, 3). The locali-
ties were near Rennell Sound, south of Port Clements,
and on Alt. Genevieve (Sleeping Beauty Massif) on Gra-
ham Island, and on Yatza Mountain, Ml. Oliver, Mt. De la
Touche, unnamed mountains near Sunday Inlet and
Kostan Inlet, and in Louscoone Inlet on Moresby Island.
Superficially, the slug resembled Hemphillia glanclulosa
Bland and W.G. Binney, 1872, found on Vancouver Island,
British Columbia, and in Washington and Oregon, but
detailed morphological and anatomical examination re-
vealed substantial differences, warranting the establish-
ment ol a new genus. Preliminary genetic analyses using
mitochondrial markers also place the species apart from
all known genera of arionid slugs in western North Amer-
ica (Clade C in Wilke, 2004: fig. 2).
Arionid genera native to the Pacific Northwest include
Zacoleus Pilsbry, 1903, Udosarx Webb, 1954, Prophysaon
Bland and W.G. Binney 1873, Kootenaia Leonard,
Chichester and Baugh, 2003, and Hemphillia Bland and
W.G. Binney 1872. Arionid genera share a ribbed jaw.
The new slug possesses a jaw that is subdivided into
sectors by evenly spaced, finely incised lines. We con-
sider this jaw to be sufficiently similar to the jaws ol other
arionids to warrant the inclusion ol the new species to
this family. The new slug further differs from the first
four genera by possessing a visceral cavity that is elevated
Figures 2-3. Staala gwaii. 2. Adult (17 mm in extended
length) from near Port Clements, Graham Island (Type locality.
Site 1 in Figure 1). 3. Juvenile (2 mm in extended length) from
near Port Clements, Graham Island (Type locality. Site 1 in
Figure 1).
into a hump and that fails to extend to the tip of the tail.
It shares this character with Hemphillia (jumping-slugs),
the only other genus of native semi-slugs known from
North America. It differs from Hemphillia by having a
shell plate that is calcareous and completely covered by
the mantle and by a pattern of papillae covering the
entire body. See Table 2 for comparisons of major fea-
tures among western North American genera of arionids.
A formal description of the new genus, Staala, and spe-
cies, S. gwaii, follows.
Staala new genus
Type Species: Staala givaii new species (below).
Diagnosis: Distinct from any other known arionid
genus externally by having viscera in a pronounced
hump and shell covered by mantle, and internally by the
complexity of the penial stimulatory apparatus (see de-
scription in the following species account) and by the
presence of an atrial accessory sac.
Etymology: The generic name means “slug” in Haida
language and honors the aboriginal heritage of the archi-
o o o o
pelago of Haida Gwaii (Queen Charlotte Islands).
K. Ovaska et al., 2010
Page 29
Table 2. Comparison of external and internal characteristics of Staala (new genus) with those of five other genera of Arionidae
native to western North America.
*Except the main branch of the left tentacular retractor, which originates on the floor of the body cavity.
Staala gioaii new species
Description: Size: Veiy small; length of 16 live spec-
imens was 2-17 mm (x = 9.8 mm, SD = 5.7 mm) when
extended in movement. Length of 12 preserved specimens
was 3- 11 mm (x= 8.1 mm, SD = 2.7 mm); the difference in
size between live and preserved specimens probably
reflects preservation techniques (live animals were maxi-
mally extended whereas the preservative, ethanol, resulted
in shrinkage). Holotype: 16 mm live, 9.4 mm preserved.
Smallest dissected and preserved individuals with a mature
reproductive system were 8 mm in length.
External Anatomy: The following description is based on
examination of 40 individuals from ten sites and apply to
the holotype, unless otherwise mentioned. Shell dome-
shaped and completely covered by mantle. Outer layer
horny and thin, and covering the entire visceral hump;
inner layer calcareous, thickest at the center of the dome
and largely absent at the margins. Mantle elliptical and
large, about 2/3 the length of the body and covering the
visceral pouch, which is elevated into a pronounced
hump; mantle hump flattened dorsally towards its distal
end and can be slightly asymmetrical, giving it a mis-
shapen appearance. Pneumostome slightly anterior or in
the middle of the right side of the mantle, near mantle
margin. Tail rounded dorsally, no keel evident; tail flat-
tened and depressed at its base where the distal portion
of the mantle rests. Several elevated lines of papillae and
associated grooves radiate outwards from the depression.
Tail protrudes distally over foot. Caudal mucus pore pre-
sent. Head, mantle, and tail covered with numerous papil-
lae. Foot fringe moderately wide; sole undivided.
Color: Head and base of tentacles dark grey, sometimes
bluish; tentacles lighter grey towards tips. Mantle mot-
tled with dark grey and light grey (as in holotype) or tan,
sometimes flecked with small tan specks. Dorsal surface
of head and tail dark grey. Foot fringe light grey or tan.
lighter than sides, sometimes with indistinct dark, verti-
cal lines. Underside of head similarly light grey or tan.
Black-tipped papillae often form dotted line at foot mar-
gin. Sole light grey or tan, dark grey in some melanistic
individuals. Papillae covering head, mantle, and tail are
light grey and black-tipped. Individuals from some local-
ities, especially subalpine habitats on Moresby Island,
were melanistic and almost uniformity dark with the
exception of the sole that is slightly lighter.
Internal Anatomy: Reproductive System: The ovo-
testis comprises a large number of lobules (more than
three dozen). It is partially embedded on the right pos-
terior of the digestive gland. The exposed portion is
lightly to moderately pigmented with black flecks. The
hermaphroditic duct is long, slender, and straight in
immature individuals and swollen and highly convoluted
in sexually mature animals. The albumen gland is adher-
ent to the spermoviduct (common duct). In sexually
mature individuals both the albumen gland and the
spermoviduct become greatly enlarged and the latter
becomes structurally more elaborate. In most individuals
the spermathecal duct and tree oviduct enter the shallow
atrium separately. In two sexually immature individuals
the two ducts joined just before entering the atrium. The
spermatheca (seminal receptacle or bursa copulatrix) is
conical to ovoidal in shape; its duct is slender and
tapered. In one specimen containing a single spermato-
phore, the spermatheca was forced into a fusiform shape
and its duct into a corkscrew. The vas deferens arises as a
slender duct from the spermoviduct, which also gives
rise to the free oviduct. The vas deferens becomes even
more slender as it curves around the base of the penis at
the penial junction with the atrium, only to thicken again
as it transitions along the side of the penis eventually to
become a greatly thickened epiphallus (Figure 4).
The epiphallus enters the penis at its apex. Inserted at
the apex, at this epiphallus-penis junction, is the penis
THE NAUTILUS, Vol. 124, No. 1
Page 30
Figures 4-6. Reproductive anatomy of Staala g waii (specimen from type locality). 4. Reproductive system. 5. Bisected penis of
two specimens of Staala g waii from the type locality. Left: upper verge chamber (empty) and lower stimulatory chamber with its
complex folds and lobes. Scale bar = 0.2 mm; Right: bisected verge in the upper chamber and a portion of the stimulator in the lower
chamber. 6. Spermatophore (ca. 2 mm in length) showing the denticle region (arrow). Terminal portion of the filament is missing.
Abbreviations: A, atrium; AG, albumen gland; AS, accessory 'sac: EP, epiphallus; FO, free oviduct; HD, hermaphroditic duct; OT,
ovotestis; P, penis; PR, penis retractor muscle; SP, spermatheca (bursa copulatrix); S, stimulator; SPD, spermathecal duct; SPOV,
spermoviduct; V, verge; VD, vas deferens.
retractor muscle, which is a wide band that passes
directly back to its origin near the midline of the dia-
phragm. The penis is a large barrel-shaped structure
divided internally into an upper verge chamber and
a lower stimulator chamber (Figures 4, 5). A lightly
pigmented band on the penis surface roughly cor-
responds to the boundary between the two inner
chambers. The verge chamber contains a large conical
structure we believe functions as a verge. The lumen
of the epiphallus continues within the verge as a narrow
passage that opens at or near the apex of the cone. The
lower stimulator chamber is almost completely filled
with a variety of attachments on the inner penial wall.
Some are plumose while others are smooth-margined
and lobed. In other slug species such structures have
been referred to as stimulators and we extend that tra-
dition in this case, although we have not been able to
observe copulation to determine how this complex is
employed. The penis enters the atrium independent
of the spermathecal duct and the free oviduct. There is
no accessory penial sac. However, there is a small atrial
accessory sac present. This sac has a very slender duct,
which enters the atrium independent of the other ducts.
In immature individuals the sac is very small and difficult
to see. A single spermatophore was found intact in one
specimen. The spermatophore consists of a crescent-
shaped main body and a long threadlike terminus
(Figure 6). Near the junction of the two parts the surface
bears a number of tiny denticles. Tbe overall length of
the spermatophore is about 2 mm.
Buccal and Tentacular Retractor Muscles: The left
and right buccal retractor muscles fuse just posterior of
the buccal mass. The fused band passes directly back to
the origin near the midline of the diaphragm. The right
tentacular retractor muscle passes between the male and
female components of the reproductive system to its
origin near the midline of the diaphragm. The left ten-
tacular retractor muscle is split into a main branch that
originates from the floor of the body cavity on the left
side. The other branch is very slender, almost nerve-like.
This branch extends backward toward an origin near the
midline of the diaphragm thus preserving an overall pat-
tern one might describe as converging. This pattern is
disrupted only by the anomalous branch of the left ten-
tacular retractor. We did not find a retensor muscle.
Digestive System: The jaw bears line, evenly spaced
incised lines but is not ribbed. Tbe radula is of the
usual arionid type, with the central row of teeth tricus-
pid, the inner lateral rows bicuspid and the outer rows
K. Ovaska et al., 2010
Page 31
tending toward elongation of the mesocones and reduc-
tion of the eetoeones. The crop is large but otherwise
unremarkable. The short, slender intestine makes three
looping turns before arriving at the anal pore.
Holotype: From type locality, on cardboard cover-
objects used to sample gastropods in a coniferous stand
of mixed old-growth and naturally regenerated mature
second-growth forest at elevation of 65-80 m; collected
by J. Gray, L. Hyatt, C. Engelstoft, 7 Oct. 2002, Royal
British Columbia Museum, RBCM 009-00035-001.
Paratypes: (1) Near summit of Mt. Genevieve, Gra-
ham Island (53°33.9' N, 132°5.6/ W), from cardboard
cover-objects in alpine meadow at elevation of about
800 nr; collected by Luke Hyatt, 16 Oct. 2002, RBCM
009-00036-001; (2) mid-slope of Mt. Genevieve
(Sleeping Beauty Trail; 53°15.8/ N, 132°12.9' W), from
cardboard cover-objects in old-growth coniferous forest
at elevation of 340 m, collected by Kristiina Ovaska,
Lennart Sopuek, and Bern Wijdeven, 22 Sep. 2004,
Carnegie Museum of Natural History, CM97971 and
RBCM 009-00038-001 .
Type Locality: 13 km southeast of Port Clements,
Graham Island (53°34.6' N, 132°6.6/ W), Queen Char-
lotte Islands, British Columbia, Canada; a coniferous
stand of mixed old-growth and naturally regenerated
mature second-growth forest at elevation of 65-80 nr.
Other Material Examined: Collected from Moresby
Island by Kristiina Ovaska and Lennart Sopuek from
under rocks or within krummholtz hummocks in subalpine
meadows: (1) Yatza Mountain (52°21,5' N, 13F26.0' W),
elevation 170-210 m, 14 Sep. 2003, RBCM 009-00037-
001; (2) Mt. Oliver (52° 42.9' N, 132°1.4' W), elevation
650 m, 14 Sep. 2004, RBCM 009-00039-001; (3) unnamed
mountain near Kostan Inlet (52°34.7' N, 131°44.0' W),
elevation 280 m, 14 Sep. 2004, RBCM 009-00041-001;
(4) unnamed mountain near Sunday Inlet (52°37.9' N,
131°50.4' W), elevation 475 m, 14 Sep. 2004, RBCM
009-00040-001; (5) from within leaf litter along bank of
small stream in old-growth coniferous forest: Louscoone
Inlet (52° 10.0' N, 131° 12.7' W), elevation < 50 m, 17 Sep.
2004; RBCM 009-00042-001.
Etymology: The specific name (used as a name in
apposition) g waii means “island” or “home” in the Haida
language and refers to the archipelago the slugs inhabit.
Natural History: The ten sites where the species was
found ranged from lowland coniferous forest, dominated
by Sitka spruce ( Picea sitchensis ), western redeedar (Thuja
plicata ), and western hemlock (Tsuga heterophylla), to sub-
alpine tundra. The species was seldom found in lowland
forest (2 sites), although most extensive search effort was
in this habitat. It was more frequently encountered at mid-
elevation forest containing yellow cedar ( Chamaecyparis
nootkatensis), mountain hemlock (Tsuga mertensiana),
and/or shore pine ( Pinus contorta), and in subalpine
meadows and mountain slopes. The subalpine habitats
were very moist with scattered, stunted (< 2 m tall) trees
and bushes (P. contort a, C. nootkatensis, T. mertensiana ,
and Juniperus sp.) and swales of grasses, heather, and crow-
berrv (Empetnim nigrum). In these habitats, we found
slugs under rocks or within hummocks of ground vegeta-
tion. At the forested sites, we located the species by using
cardboard cover-objects (see Methods); only one individual
was found during visual searches of the forest floor. We
found the smallest juveniles, about 2 mm in extended
length, on 27-28 Jul. and 26 Sep. 2002 at a lowland site
(Site 1 in Ligure 1). We found larger juveniles and adult-
sized individuals (> 10 mm in extended length) from Sep-
tember to November, 2002-2004. Longevity and life stages
at which the slugs survive winter are unknown.
Possible Taxonomic Relationships: Of the previ-
ously described species, the new species most closely
resembles small species of HemphiUia (PI. glandulosa/
PI. hurringtoni species complex). It differs from them
externally by a mantle that completely covers the shell
plate, which in the new species is calcareous, by dense,
pointed papillae that cover the sides and the tail as well
as the mantle, and by an unkeeled tail, and internally by
an unusual configuration of buccal and tentacular retrac-
tors (Table 2).
DISCUSSION
The terrestrial gastropod fauna of Haida Gwaii is depau-
perate when compared to more southern areas along the
Pacific coast, probably reflecting the isolation and harsh,
northern climate of the archipelago; 18 native species
were detected in contrast to over 35 species on Vancou-
ver Island (Lorsyth, 2004). With the notable exception of
the new slug, Staala gwaii, all species of gastropods
found during the surveys also occur on Vancouver Island
and the coastal mainland of southern British Columbia.
However, systematic relationships of some groups such
as Prophysaon, Pristiloma , and Vertigo from western
North America have not been examined recently, and
genetic or detailed morphological studies could reveal
differences among populations from Haida Gwaii and
farther south. In particular, the unusual, clear-shelled
Pristiloma, attributed herein to P. stearnsii, requires fur-
ther investigation.
Curiously, we detected only infrequently two species
that are relatively common on Vancouver Island and
the lower mainland of British Columbia, Nesovitrea
binneyana and Euconulus fulvus. Both snails were
present in thermal meadows on Hotspring Island;
N. binneyana also occupied sand dune habitat near
Masset, Graham Island. We encountered Cryptomastix
germana at only two sites within pockets of dense ri-
parian herbaceous vegetation. This species has been
reported previously from one Moresby Island locality
(Lorsyth, 2000). Some species (Planogyra clappi,
Cryptomastix germana) probably exist at or near their
northern limits of distribution in Haida Gwaii.
THE NAUTILUS, Vol. 124, No. 1
Page 32
The new species of slug is of particular interest
because it is possibly a relic of an ancient lineage that
has survived several periods of glaciation on the archi-
pelago. Ice-free refugia existed in various locations
along the North Pacific coast from the Aleutian Islands
to Vancouver Island during Pleistocene glaciations,
and such refugia could have permitted the persistence
of this and other endemic and disjunct species known
from the islands through tins and earlier glacial epi-
sodes. Paleoeeological evidence exists for lowland
ice-free refugia in Haida Gwaii at the height of the
Wisconsin glacial epoch (Warner et ah, 1982), but a
continuous record of micro- or macro-fossils through
this period is lacking. Some mountain tops in the Queen
Charlotte Range are also thought to have remained as
ice-free nunataks throughout glacial periods (Heusser,
1989) and probably supported organisms such as bryo-
pliytes (Schofield, 1989a) that are able to exist in
small microhabitats and withstand harsh conditions.
The slug could conceivably also have persisted in nuna-
taks, as it is presently found in isolated mountain top
habitats.
Some endemics on the archipelago appear to be of
relatively recent origin as a result of rapid morphological
evolution in post-glacial times within the past 15,000-
16,000 years (e.g., carabid beetles of the genus Nebria:
Clarke et ah, 2001; Haida Gwaii black bear, Ursus
americmms carlottae: Byun et ah, 1997), whereas others
are thought to be much older. Ancient, possibly Tertiary
origins have been postulated for relic species of bryo-
phytes that show unusual, disjunct distribution patterns
(Schofield, 1989a).
Preliminary molecular analyses suggest that the line-
age containing Staala gwaii is old and has split from
Hemphillia , the presumed sister taxon, several million
years ago (Wilke, 2004; Thomas Wilke, Animal Ecology &
Systematic^, Justus Liebig University Giessen, Giessen,
Germany, pers. comm.), lending support to the notion
that the slugs survived several glacial periods in refugia
on the islands or elsewhere along the northwest coast of
North America. Several species of plants endemic to the
northwest coast have scattered and disjunct distributions
(Calder and Taylor, 1968; Taylor, 1989; Ogilvie, 1989).
Examples of endemic plants that co-occur with the slug
in subalpine habitats in Haida Gwaii include Geum
schofieldii , Ligusticum calderi , Saxifraxa taylori , and
Senecio moresbiensis on Mt. De la Touche; Ligusticum
calderi and Saxifraga taylori on Mt. Yatza; Ligusticum
calderi on Mt. Oliver; Saxifraga taylori and Senecio
moresbiensis on an unnamed mountain east of Blue
Heron Bay (plant distribution from unpublished data
files by Parks Canada).
Further surveys along the northwest coast of main-
land British Columbia are needed to document the
extent of the distribution of Staala gwaii and to ex-
plore the existence of other undiscovered species and
populations. Comparative studies with other western
North American and northeast Asian forms are also
desirable, as they have potential to shed light on the
evolution and biogeography of western North American
slugs.
ACKNOWLEDGMENTS
We thank Glen Dunsworth, Bill Beese, Brian Reader,
Scott Parker, Barb Johnston, and Arthur Robinson for
their support of the project and help with logistics. Tom
Wilke accepted specimens for genetic analysis and
shared with us his unpublished data. Luke Hyatt, Janet
Gray, Berry Wijdeven, and Christian Engelstoft assisted
in the field. Richard Lamy and Debbie Gardiner acted
as our guides in Gwaii Haanas. Kelly Sendall and
Moretta Frederich, and Tim Pearce accepted specimens
for the collections at Royal British Columbia Museum
and Carnegie Museum of Natural History, respectively.
Alvin Cober prepared the base-map for Figure 1 . Robert
Forsyth, Tim Pearce, and an anonymous reviewer
provided helpful review comments. Funding from
Weyerhaeuser Canada, Western Forest Products, En-
dangered Species Recovery Fund (Environment Canada
and World Wildlife Fund), Wildlife Habitat Canada,
Department of National Defence, and Parks Canada for
Biolinx Environmental Research Ltd. made fieldwork in
Haida Gwaii possible.
LITERATURE CITED
Byun, S. A., B.F. Koop, and T. E. Reimchen. 1997. North Amer-
ican black bear mtDNA phylogeography: Implications for
moqrhology and the Haida Gwaii glacial refugium contro-
versy. Evolution 51: 1647-1653.
Clarke, T. E., D.B. Levin, D.H. Kavanaugh, and T. E.
Reimchen. 2001. Rapid evolution in the Nebria gregaria
group (Coleoptera: Carabidae) and the paleogeography of
the Queen Charlotte Islands. Evolution 55: 1408-1418.
Calder, J.A. and R.L. Taylor. 1968. Flora of the Queen Char-
lotte Islands. Part 1. Systematics of the vascular plants.
Canada Department of Agriculture Monograph 4.
Queen's Printer, Ottawa, Ontario, Canada, xiii + 659 pp.
Cowie, R.PI. and B.S. Holland. 2006. Dispersal is fundamental
to biogeography and the evolution of biodiversity on oce-
anic islands. Journal of Biogeography 33: 193-198.
Forsyth, R.G. 2000. The land snail Cryptomastix german a
(Gastropoda: Polygyridae) in the Queen Charlotte Islands,
British Columbia: a range extension north from Vancouver
Island. Canadian Field-Naturalist 114: 316-317.
Forsyth, R.G. 2004. Land snails of British Columbia. Royal
British Columbia Museum handbook. Royal BC Museum,
Victoria, British Columbia, Canada. 188 pp.
Heusser, C.J. 1989. North Pacific coastal refugia - the Queen
Charlotte Islands in perspective. In: Scudder, G.G.E. and
N. Gessler (eds). The Outer Shores of Queen Charlotte
Islands. Queen Charlotte Islands Museum Press,
Skidegate, British Columbia, pp. 91-106.
Hawkins, J.W., M.W. Lankester, and R.R.A. Nelson. 1998.
Sampling terrestrial gastropods using cardboard sheets.
Malacologia 39: 1-9.
McTaggart Cowan, 1. 1989. Birds and mammals on the Queen
Charlotte Islands. In: Scudder, G.G.E. and N. Gessler
(eds). The Outer Shores of Queen Charlotte Islands.
K. Ovaska et al., 2010
Page 33
Queen Charlotte Islands Museum Press, Skidegate, Brit-
ish Columbia, pp. 175-186.
Ogilvie, R.T. 1989. Disjunct vascular flora of northwestern
Vancouver Island in relation to Queen Charlotte Islands’
endemisms and Pacific coast refugia. In: Scudder, G.G.E.
and N. Gessler (eds). The Outer Shores of Queen Char-
lotte Islands. Queen Charlotte Islands Museum Press,
Skidegate, British Columbia, pp. 127-130.
Ogilvie, R.T. 1994. Rare and endemic vascular plants of
Gwaii Ilaanas (South Moresby) Park, Queen Charlotte
Islands, British Columbia. British Columbia Ministry of
Forests, Forest Science Program. FRDA Report 214
(available online at http://www.for.gov.bc.ca/hfd/pubs/
Docs/F rr/F rr2 1 4.htm )
Pilsbry, II. A. 1940. Land Mollusca of North America (north of
Mexico). The Academy of Natural Sciences of Philadel-
phia, Monograph 3, VI, Part 2: 575-994, i-ix.
Pilsbry, H.A. 1948. Land Mollusca of North America (north of
Mexico). The Academy of Natural Sciences of Philadel-
phia, Monograph 3, V2, Part 2: i-xlvii, 521-1113.
RBCM (Royal British Columbia Museum, Victoria, B.C.)
website. http://www.royalbcmuseum.bc.ca/Content_Files/
Files/Collections%20and%20Research/Natural%20History/
Haida_Gwaii_gastropod_survey_sites.pdf
Schofield, W. B. 1989a. Structure and affinities of the bryoflora
of the Queen Charlotte Islands. In: Scudder, G.G.F. and
N. Gessler (eds). The Outer Shores ol Queen Charlotte
Islands. Queen Charlotte Islands Museum Press, Skidegate,
British Columbia, pp. 109-119.
Schofield, W. B. 1989b. Bryopbyte disjunctions in the Northern
Hemisphere: Europe and North America. Botanical Jour-
nal of the Linnean Society 98: 21 1-224.
Taylor, R.L. Vascular plants ol the Queen Charlotte Islands.
1989. In: Scudder, G.G.E. and N. Gessler (eds). The
Outer Shores of Queen Charlotte Islands. Queen Char-
lotte Islands Museum Press, Skidegate, British Columbia,
Canada, pp. 121-125.
Warner, B.G., R.W. Mathewes, and J.J. Clague. 1982. Ice-free
conditions on the Queen Charlotte Islands, British Colum-
bia, at the height of Late Wisconsin glaciation. Science
218: 675-677.
Wilke, T. 2004. Genetic and analytical analysis of the jumping-
slugs. Technical report prepared for the Olympic National
Forest, Olympia, USA (contract 43-05G2- 1 -10086). 26 pp.
THE NAUTILUS 124(1 ):34-40, 2010
Page 34
How the number of hinge teeth may induce errors in the
taxonomy of Nuculidae and Nuculanidae (Bivalvia)
Cleo Dilnei de Castro Oliveira
Tatiana Huguenin Morales
Departamento de Zoologia, Instituto de Biologia
Universidade Federal do Rio de Janeiro, 1 1 ha do Fundao
21941-590
Rio de Janeiro, BRAZIL
[email protected]
ABSTRACT
The hinge figures as an important feature in the taxonomy of
bivalves, especially when soft parts are not available. For the
Protobranchia, in addition to other shell features, the number
of hinge teeth is often used in taxonomic studies. However,
despite the importance of the number of hinge teeth, this char-
acter is not informative when shell size measurements are not
available, since the number of teeth can increase during ontog-
eny. In addition, intraspecific variation may be observed for the
same shell-size class. Since this variation has been up to now
only empirically observed, the present study provides a statisti-
cal approach to the problem by computing the linear regression
between number of teeth and shell size in 310 valves from five
protobranch species (family Nuculidae: Pronucula benguelana;
Nucula semiomata ; Ennucula puelcha-, and family Nuculani-
dae: Adrana electa ; A. patagonica.) All species showed a statis-
tically significant relationship (P value < 0.0001) between these
characters.
Additional Keywords: Linear regression, shell morphology,
Nuculoidea, Nuculanoidea, Protobranchia, taxonomy
INTRODUCTION
The protobranchs are a dominant bivalve group at abys-
sal depths, encompassing a high percentage of the bi-
valve species found in the deep-sea (Sanders and Allen,
1973). The recent sampling of deep-sea benthic fauna
and the efforts of many investigators (e.g. Allen and
Sanders, 1973, 1996; Moore, 1977; Rhind and Allen,
1992; Kilburn, 1994, 1999; Gofas and Salas, 1996; Roy
et al., 2000; Allen, 2008; La Perna, 2008) have increased
the number of known species and enlarged the known
ranges of many protobranchs, providing a source for
different proposals of classification for the group (e.g.
Poel, 1955; Purchon, 1959; Cox, I960; McAlester, 1964;
Newell, 1969; Verril and Bush, 1897; Yonge, 1959;
Sanders and Allen, 1973; Scarlato and Starobogatov,
1985; Allen and Hannah, 1986; Maxwell, 1988; Morton,
1996; Salvini-Plawen and Steiner, 1996; Coan, Scott, and
Bernard, 2000; Schneider, 2001; Giribet and Wheeler,
2002; Giribet, 2008).
Among the protobranchs, the Nuculoidea Gray, 1824,
and Nuculanoidea Adams and Adams, 1858, have had a
problematic taxonomic history, often with obscure rear-
rangements of species and unclear changes in the
higher-level taxonomy of many names (for more details
see Sehenck, 1934; Poel, 1955; Allen and Hannah, 1986;
Maxwell, 1988; Rhind and Allen, 1992; Zardus, 2002).
Most of the difficulties involved in the classification of
the group arise from the conservative nature of the shell
shape (Allen and Hannah, 1986) and from the morphol-
ogical approach, which often considers only a single set
of features (Sanders and Allen, 1973).
Although several characters have been taken into
account (e.g., general outline, ornamentation and micro-
structure of the shell), in most taxonomic descriptions of
protobranchs the hinge usually is an important taxonom-
ic feature, especially when the studied specimens lack
soft parts. The shape, number, position, and spacing of
the teeth are often used in the diagnoses of species and
even genera (Dali, 1886; Gofas and Salas, 1996). More-
over, the differences between the number of anterior
and posterior teeth are used in identification, and even
differences in the order of two or three teeth have been
considered significant in descriptions or identification
works (e.g. Esteves, 1984; Smith, 1885; Abbott, 1974;
Kilburn, 1994; Rios, 1994; Espinosa and Ortea, 2001).
However, to consider the number of teeth without
associating the character to measurements of shell size
is not informative, and may cause taxonomic confusion.
A morphometrieal approach may improve on the tradi-
tional taxonomic methods and has been used with suc-
cess by several authors (Bonfitto and Sabelli, 1995;
Gofas and Salas, 1996; Fuiman et ah, 1999).
This paper discusses the taxonomic importance of the
size of the shell in proportion to the number of teeth on
the hinge in three species of Nuculidae: Pronucula ben-
guelana Clarke, 1961; Nucula semiomata d’Orbigny,
C.D.C. Oliveira and T.H. Morales, 2010
Page 35
VENTRAL
POSTERIOR
Figure 1. Ennticula puelclio d’Orbigny, 1S42. Shell and the anterior and posterior hinge teeth. Abbreviations: at = anterior teeth;
pt = posterior teeth. Scale bar = 2 mm. Adapted from Absalao & Pimenta (2005).
1846; Ennucula puelcha d’Orbigny, 1842; and two of
Nuculanidae: Aclrana electa (A. Adams, 1846); and
Adrana patagonica (d’Orbigny, 1846).
MATERIALS AND METHODS
The material examined includes samples taken during
different cruises undertaken the South Atlantic Ocean.
The measurements used herein are commonly used in
morphometric studies with bivalves (Sibaja and Vilalo-
bos, 1986; Bonfitto and Sabelli, 1995; Gofas and Salas,
1996; Fuiman et al., 1999), and are represented in
Figure 1. The numbers of anterior and posterior teeth
were counted with the aid of a ZEISS SV-6 stereoscopic
microscope. The antero-posterior and dorso-ventral axes
of each valve were measured using a caliper of 0.05 mm
accuracy. A total of 200 valves of nuculids and 1 10 valves
of nuculanids were considered in this study (Table 1).
The statistical approach consisted of linear regression
analysis (Sokal and Rohlf, 1981). All material from this
study is deposited in the Mollusca collection of the
Departamento de Zoologia, Instituto de Biologia, Uni-
versidade Federal do Rio de Janeiro (IBUFRJ).
Table 1. Descriptive statistics of the material analyzed. Abbreviation: sd = Standard deviation.
80
A Pronucula benguelana
• Nucula semiornata
O Ennucuta puelcha
■ Adrana electa
□ Adrana patagonica
40
30
□ ft
■ □ Bj
□ q-jd-1 ^ □□□
rP
ID Ro D rn D
□ □
20
□P
Dorso-ventral axis (mm)
Figure 2. Relationship of dorso-ventral axis and number oi posterior teeth in studied protobranch species, lhe two families
analyzed occupy discrete morphospaces, reinforcing the importance of the number of teeth as a character at supra-specific levels.
C.D.C. Oliveira and T. H. Morales, 2010
Page 37
25
20
0)
2 15
10
5
O
0 +—
0 2 4 6 8 10 12 14
Dorso-ventral axis (mm)
Figure 3. Relationship between: A. antero-posterior and B. dorso-ventral axes with the number of anterior teeth, showing the
morphospaces overlap between Pronucula benguelana and Ennucula puelcha.
Number of posterior teeth Number of posterior teeth
Page 38
THE NAUTILUS, Vol. 124, No. 1
10
10
8
Antero-posterior axis (mm)
12
16
• (DO
0 2 4 6 8 10 12 14
Dorso-ventral axis (mm)
Figure 4. Relationship between: A. antero-posterior and B. dorso-ventral axes with the number of posterior teeth, showing the
overlap of the morphospaces of Pronucula benguelana and Nucula semiomata.
C.D.C. Oliveira and T.H. Morales, 2010
Page 39
RESULTS AND DISCUSSION
All the species studied exhibited a gradual increase of
the number of anterior and posterior teeth during on-
togeny. All results were statistically significant (Table 2),
when we compared the importance of shell size with the
number of anterior and posterior teeth. This statistical
analysis confirmed the existence of a relationship be-
tween the two variables, size and number of teeth, and
suggests that this relationship may be verified in other
protobranch species. Furthermore, it confirmed the var-
iation in the number of teeth for the same size class for
each species studied. This attests to the inconsistency of
this character when it is analyzed alone.
In addition. Figure 2 indicates a distinction among the
genera Adrana and Pronucida , Nucula, and Ennucula,
which becomes more evident when we compared the
number of posterior teeth and the length ol the dorso-
ventral axis. This result matches most accepted classifi-
cations that consider several characters (not only num-
ber of teeth) and allocate these three genera into two
distinct groups (e.g. Allen anti Hannah, 1986; Maxwell,
1988; Giribet and Wheeler, 2002; Giribet, 2008).
On the other hand, considering the Nuculidae, the
morphospace of Pronucida benguelana overlapped with
E. puelcha in the number of anterior teeth regressed
on antero-posterior axis (Figure 3a) and on dorso-
ventral axis (Fig. 3b); and P. benguelana overlapped
with N. semiomata in the number of posterior teeth
regressed on antero-posterior axis (Figure 4a) and on
dorso-ventral axis (Figure 4b). In both cases, these
overlaps of the number of teeth (anterior or posterior)
occurred up to about 4 mm in size, on each axis ana-
lyzed, for P. benguelana. Because this latter species is
about 4 mm in size, this size limit in the overlap cannot
be interpreted as a consequence of the number of
specimens collected.
It is evident that the current taxonomy of Nuculidae
presents confused generic definitions, not rare with a
great correspondence of characters. Considering only
the results presented herein, the overlaps of the mor-
phospaces of Pronucida and Nucula are in agreement,
and may reinforce the view ol Bergmans (1978), who
synonymized the two genera, or that of Allen and Han-
nah (1986), who proposed the allocation of Pronucida, at
a subgeneric rank, to the genus Nucula. Along the same
lines, the overlaps of the morphospaces of Ennucula and
Nucula may reinforce the view of Schenck (1934) who
placed Ennucula as a subgenus of Nucula. Nevertheless,
because no other taxonomic features were analyzed in
this study and, moreover, none of the species studied are
type-species of Pronucida , Nucula , or Ennucula , this
ratification of the opinions of above-mentioned authors
may lie premature.
CONCLUSION
These statistical analyses confirmed empirical observa-
tions of the relation between shell size and number of
teeth in protobranch bivalves and attests to the inconsis-
tency of the latter character when analyzed alone. For
the taxa studied herein, the number of teeth on the
hinge is an important taxonomic feature, but only when
the size of the shell is also taken into account. Other-
wise, taxonomic studies and descriptions based only on
the number of teeth without providing any measures of
the shell are not informative and might make it impossi-
ble to define whether one is dealing with several similar
species or just one that shows intraspecific variation for
the character number ol hinge teeth.
The use of other characters in the taxonomy of the
group is obviously important, but for the species studied
here, at the family level, the distinction between Adrana
(Nuculanidae) and Pronucida , Nucula , and Ennucula
(Nuculidae) is in agreement with most accepted classifi-
cations. This attests the importance of number of teeth
on the hinge related to the size ol the shell for the
distinction of these two families even when no other
characters are considered. Nevertheless, for the nueu-
lids, the differentiation ol the distinct genera is unclear.
The number of teeth on hinge and the size of the shell
alone do not provided a good distinction among the
three genera and the overlap of the morphospaces of
these different taxa reinforces the demand for the use
of more taxonomic characters and emphasizes the need
for more comprehensive studies with these groups.
ACKNOWLEDGMENTS
Our best thanks go to Dr. Ricardo Absalao (Universi-
dade Federal do Rio de Janeiro) for his encouragement
and critical information; Dr. John Zardus (Military
College of South Carolina) and Ms. Natalia Benaim
(Universidade Federal do Rio de Janeiro) for the
exchange of ideas.
O
LITERATURE CITED
Abbott, R.T. 1974. American Seashells. 2nd ed. Van Nostrand
Reinhold Co., New York. 663 p., 24 pis.
Absalao, R.S. and A.D. Pimenta, 2005. Moluscos Marinhos da
APA do Arquipelago de Santana, Macae, RJ. Chave
Ilustrada para Identificagao das Especies do Substrato
Inconsolidado. Editora Cieneia Moderna, Rio de Janeiro.
84 p., 21 pis.
Allen, [.A. 2008. Bivalvia of the deep Atlantic. Malacologia
50(1): 57-173.
Allen, J.A. and F. J. Hannah, 1986. A reclassification of the
Recent genera of the subclass Protobranehia (Mollusca:
Bivalvia). Journal of Conehology 32: 225-249.
Allen, |.A. and ILL. Sanders, 1973. Studies on deep-sea
Protobranehia (Bivalvia); the families Siliculidae and
Lametilidae. Bulletin of the Museum of Comparative
Zoology 145: 263-310.
Allen, J.A. and H.L. Sanders, 1996. Studies on the deep-sea
Protobranehia (Bivalvia): the family Neilonellidae and the
family Nuculanidae. Bulletin-Natural History Museum
Zoology Series 62: 101-132.
Page 40
THE NAUTILUS, Vol. 124, No. 1
Bergmans, W. 1978. Taxonomic revision of Recent Australian
Nuculidae (Mollusca: Bivalvia) except Ennucula Iredale,
1931. Records of the Australian Museum 31: 673—736.
Bonfitto, A. and B. Sabelli. 1995. Yoldiella seguenzae, a new
species of Nuculanidae (Bivalvia; Nuculoida) from the
Mediterranean Sea. Journal of Molluscan Studies 61:
21-27.
Coan, E.V., P.V. Scott, and F. R. Bernard. 2000. Bivalve sea-
shells of western North America: marine bivalve mollusks
from arctic Alaska to Baja California. Santa Barbara
Museum of Natural History, Santa Barbara, 764 pp.
Cox, L. R. 1960. Thoughts on the classification of the Bivalvia.
Proceedings of the Malacologieal Society of London 34:
60-80.
Dali, W. II. 1886. Report on the Mollusca. Part 1. Brachiopoda
and Peleeypoda. Reports on the results of dredging by the
US coast survey steamer Blake'. Bulletin of the Museum
of Comparative Zoology 12: 171-318.
Espinosa, J. and [. Ortea. 2001. Description de una nueva
espeeie de Adrana Adams and Adams, 1858. Avicennia 4:
61-76.
Esteves, I.R. 1984. Recent bivalves (Palaeotaxodonta and Pter-
iomorphia) from de Brazilian continental shelf. Pesquisas,
Porto Alegre, 16: 190-226.
Fuiman, L.A., J.D. Gage, and P.A. Lamont. 1999. Shell mor-
phometry of the deep sea protobranch bivalve Ledella
pustulosa in the Rockall Trough, Northeast Atlantic. Jour-
nal of the Marine Biological Association United Kingdom
79: 661-671.
Giribet, G. 2008. Bivalvia. In: Ponder, W.F. and D.R. Lindberg
(eds.) Phylogeny and Evolution of the Mollusca. Universi-
ty of California Press Berkeley, pp. 105-141.
Giribet, G. and W. Wheeler. 2002. On Bivalve Phylogeny: A
High-Level Analysis of the Bivalvia (Mollusca) Based on
Combined Morphology and DNA Sequence Data. Inver-
tebrate Biology: 271-324.
Gofas, S. and C. Salas. 1996. Small Nuculidae (Bivalvia) with
functional primary hinge in the adults. Journal of Con-
chology 35: 427-436.
Kilburn, R.N. 1994. The protobranch genera Jupiteria,
Ledella , Yoldiella and Neilo in South Africa, with the de-
scription of a new genus (Mollusca: Bivalvia; Nuculanoi-
dea). Annals of the Natal Museum 35: 157-175.
Kilburn, R.N. 1999. The family Nuculidae (Bivalvia: Proto-
branchia) in South Africa and Mozambique. Annals of
the Natal Museum 40: 245-268.
La Perna, R. 2008. Revision of the protobranch species de-
scribed by Dautzenberg and Fischer (1897) with descrip-
tion of a new species and taxonomic comments on
Bathyspinula (Bivalvia, Nuculanoidea). The Veliger 50:
149-162.
Maxwell, P. 1988. Comments on “A reclassification of the Re-
cent genera of the subclass Protobranchia (Mollusca:
Bivalvia)” by JA Allen and F| Hannah (1986). Journal of
Conchology 33: 85-96.
Mealester, A.L. 1964. Preliminary suggestions for a classifica-
tion of nuculoid bivalves. Journal of Paleontology 38:
397-400.
Moore, D.R. 1977. Small species of Nuculidae (Bivalvia) from
the tropical western Atlantic. The Nautilus 91: 1 19-128.
Morton, B. 1996. The evolutionary history of the Bivalvia. In:
Origin and evolutionary radiation of the Mollusca (J.D.
Taylor, ed.), pp. 337-359. Oxford: Oxford University Press.
Newell, N.D. 1969. Classification of Bivalvia. In: Moore, R.C.
(ed.) Treatise on Invertebrate Paleontology, Part N, Vol. 1,
Mollusca 6, Bivalvia. Geological Society of America and
the University of Kansas Press, Lawrence, N205-N224.
Poel, L. 1955. Structure du test et classification des Nucules.
Bulletin de l’lnstitut Royal des Sciences Naturelles de
Belgique 11: 1-68.
Purchon, R. D. 1959. Phylogenetic classification of the Lamel-
libranehia, with special reference to the Protobranchia.
Proceedings of the Malacologieal Society of London 33:
224-230. 1
Rhind, P.M. and J.A. Allen. 1992. Studies on the deep-sea
Protobranchia (Bivalvia): the family Nuculidae. Bulletin
of the British Museum, Natural History, Zoology 58:
61-93.
Rios, E.C. 1994. Seashells of Brazil. 2nd ed. Museu Oceano-
grafico Prof. E.C. Rios da Fundagao Universidade de Rio
Grande, Rio Grande. 368 p., 113 pis.
Roy, K., D. Jablonski, and J.W. Valentine. 2000. Dissecting
latitudinal diversity gradients: functional groups and elades
of marine bivalves. Proceedings of the Royal Society of
London, Series B 267: 293-299.
Salvini-Plawen, L. and G. Steiner. 1996. Synapomorphies
and plesiomorphies in higher classification of Mollusca.
In: J.D. Taylor (ed.) Origin and evolutionary radiation of
the Mollusca. Oxford University Press, Oxford, pp. 29-51.
Sanders, II.L. and |.A. Allen. 1973. Studies on deep-sea Pro-
tobranchia (Bivalvia); Prologue and the Pristiglomidae.
Bulletin of the Museum of Comparative Zoology 145:
237-262.
Scarlato, O.A. and Y. I. Starobogatov. 1985. General evolution-
ary patterns and the system of the class Bivalvia. Harvard
University Department Special Occasional Publication,
67 pp. [English translation from the Russian original.]
Schenek, H.G. 1934. Classification of nueulid pelecypods. Bul-
letin du Musee Royal d’Histoire Naturelle de Belgique
10: 1-70.
Schneider, J.A. 2001. Bivalve Systematic^ during the 20th Cen-
tury. Journal of Paleontology 75: 1119-1127.
Sibaja, W. G. and C.R. Villalobos. 1986. Crecimiento del mejil-
lon Mi/tella guyanensis L. (Bivalvia: Mytilidae), en el
Golfo de Nieoya, Costa Rica. Revista de Biologia Tropical
34: 231-236.
Smith, E.A. 1885. Report on the Lamellibranchiata collected
by I IMS Challenger during the years 1873-1876. Chal-
lenger Reports, Zoology 13, 341 pp.
Sokal, R.R. and F. [. Rohlf. 1981. Biometry. The principles and
practice of statistics in biological research. Freeman and
Company, New York, 859 pp.
Verrill, A.E. and K.J. Bush. 1897. Revision of the genera of
Ledidae and Nuculidae of the Atlantic coast of the United
States. American Journal of Science 3: 51—63.
Yonge, C.M. 1959. The status of the Protobranchia in
the bivalve Mollusca. Proceedings of the Malacologieal
Society of London 33: 210—214.
Zardus, J.D. 2002. Protobranch bivalves. Advances in Marine
Biology 42, 65 pp.
THE NAUTILUS 124(l):41-43, 2010
Page 41
A new species of Zeadmete (Gastropoda: Cancellariidae)
from South Carolina, a genus previously unknown in the
Atlantic Ocean
Richard E. Petit
806 Saint Charles Road
North Myrtle Beach, SC 29582 USA
[email protected]
Lyle D. Campbell
Sarah C. Campbell
Division of Natural Sciences and Engineering
University of South Carolina Upstate
800 University Way
Spartanburg, SC 29303 USA
[email protected]
ABSTRACT
A new species of Zeadmete is described from deep water on the
Blake Plateau southeast of Charleston, South Carolina. Previ-
ously known from South Africa, New Zealand, New Caledonia,
and Fiji, this is the first report ol Zeadmete from the Atlantic
Ocean.
Additional keywords: Bathyal, deep-sea, gastropod
INTRODUCTION
The little-known genus Zeadmete has been recently
discussed by Petit and Harasewych (2000) and Bouehet
and Petit (2008). Previously known species occur off
South Africa, New Zealand, New Caledonia, and Fiji.
With the exception of Zeadmete subantarctica Powell,
1933, found at 65 m, this genus is usually found at 300-
GOO in depth. The new species extends this range to
764 meters.
Although known from only one specimen, the rarity ol
all known species, coupled with their depth, makes it
advisable to describe the species. During extensive
dredging on Norfolk Ridge (south of New Caledonia)
only one specimen of Zeadmete bilix Bouehet and Petit,
2008, was discovered although it is several times larger
than, and found in half the depth of, the new South
Carolina species.
MATERIALS AND METHODS
In 1986, Lyle and Sarah Campbell were guest scientists
with separate survey cruises on the SC Marine Re-
sources Lady Lisa to determine if Gert/on crabs were
present in sufficient quantity to support a fishery off
Charleston, South Carolina. Gert/on are found in 600
to 1200 m of water, some 160 to 320 km offshore on
the Blake Plateau. The Campbells were permitted to
add a 30 cm diameter pipe dredge to the ballast hold-
ing down the crab traps, and a series of bulk sediment
samples were obtained. Those constituted the first set
of bathyal bulk sediment samples obtained from South
Carolina waters. Mollusks were recorded by Dali
(1889, 1927) from two similar samples off Florida and
southern Georgia but there is virtually no published
documentation of this fauna from South Carolina
waters.
A sediment sample from SC Marine Resources Geryon
cruise, 23 July 1986, Blake Plateau, southeast ol Charles-
ton, South Carolina from 418 fathoms (764 meters) water
depth was recently washed for a student research proj-
ect. Bulk sediment was wet screened through seven
sieves ranging from 12.5 mm to 0.7 mm mesh. Prelimi-
nary investigation yielded 15 species of pelagic gastropods,
30 species of benthic mollusks, and other taxa ranging
from fish otoliths to diverse benthic and planktic forami-
nilera. Ongoing investigations of remaining samples will
more completely document the fauna.
One other species of Cancellariidae was found in the
same sample as the new Zeadmete, a broken specimen ol
Microcancilla microscopica (Dali, 1889).
SYSTEMATICS
Family Cancellariidae Forbes and Hanley, 1851
Genus Zeadmete Finlay, 1926
Type Species: Cancellaria trailli Hutton, 1873, by
original designation. Recent, New Zealand.
Zeadmete atlantica new species
(Figures 1-5)
Description: Shell (Figures 1-3) small (3.76 mm),
elongated biconical, consisting of 3.75 whorls. Protoconch
(Figures 4-5) smooth, evenly rounded, increasing in
Page 42
THE NAUTILUS, Vol. 124, No. 1
Figures 1-5. Z eadmete atlantica. Southeast of Charleston, South Carolina, in 418 fathoms [764 m], 1. Apertural. 2. Right lateral.
3. Dorsal views of the holotype. 4. Axial, and 5. dorsal views of protoconch. Scale bar = 1 mm for entire shell, 500 pm for protoconch
views.
diameter from 230 pm to 640 pm in 1 whorl, with fine,
irregular spiral threads evident on last 0.5 whorl. Transi-
tion to teleoconch marked by onset of axial growth striae
and fine ribs. Teleoconch of 2.75 roundly shouldered,
weakly convex whorls. Suture deeply impressed. Axial
sculpture of about 40 ribs per whorl, ribs becoming less
distinct with increasing whorl size. Spiral sculpture of
weak, narrow, evenly spaced spiral cords, about 30 on
body whorl, 15 on penultimate whorl. Aperture 0.5 shell
length, narrowly elliptical (W/L = 0.37), deflected from
coiling axis by 16 '. Outer lip strongly curved at shoulder,
evenly convex from shoulder to tip of siphonal canal.
Spiral sculpture most pronounced near shoulder and
along siphonal canal. Inner lip with smooth inductural
region that is slightly shorter than the smooth, axial
columella, which lacks columellar folds, but has a single
siphonal fold. Shell and aperture uniformly white in
color.
Type Material: Holotype USNM 1125242 (3.76x
1.96 mm).
Type Locality: Blake Plateau, southeast of Charleston,
South Carolina, 32°38.6/ N, 76°47.7' W, 764 m (Geryon
cruise, station 125, July 23, 1986).
Etymology: Named for the Atlantic Ocean.
R. E. Petit et al., 2010
Page 43
Remarks: Z eadmete atlantica new species has a more
rounded shoulder than most species in the genus.
Although corroded, the type specimen differs from its
geographically closest congener, the South African
Z. verheckeni Petit and Harasewych, 2000, in having a
rounded shoulder, more numerous axial ribs and less
prominent nodules at the intersection of axial ribs and
spiral cords. Zeadmete bathymon Bouchet and Petit,
2008, from New Caledonia has sculpture similar to
Z. atlantica but the ribs are not as numerous and the
shoulder is strongly angled.
ACKNOWLEDGMENTS
Dr. M.G. Harasewych, National Museum of Natural
History, Smithsonian Institution, Washington, DC,
kindly prepared the SEM and plate. Dr. Matthew
Campbell, Judson University, read and commented on
a draft of this paper.
LITERATURE CITED
Bouchet, P. and R.E. Petit. 2008. New species and new records
of southwest Pacific Cancellariidae (Gastropoda). The
Nautilus 122: 1-18.
Dali, W. II. 1889. [Reports on the results of dredging, under
the supervision of Alexander Agassiz, in the Gulf of
Mexico (1877-78) and in the Caribbean Sea (1879-80)
by the U.S. Coast Survey Steamer “Blake”, Lieut. -
Commander C.D. Sigsbee, U.S.N., and Commander
J.R. Bartlett, U.S.N., commanding.] XXIX. Report on
the Mollusca. Part II. Gastropoda and Scaphopoda. Bul-
letin of the Museum of Comparative Zoology, 18, 1^192,
pis. 10-40.
Dali, W.H. 1927. Small shells from dredgings off the southeast
coast of the United States by the United States Fisheries
Steamer Albatross in 1885 and 1886. U.S. National
Museum Proceedings 70 (art. 18): 1—134.
Finlay, II. [. 1926. A further commentary on New Zealand
molluscan systematics. Transactions of the New Zealand
Institute 57: 320—485, pis. 18-23.
Hutton, F.W. 1873. Catalogue of the marine Mollusca of New
Zealand, with diagnoses of the species. Colonial Museum
and Geological Survey Department, Wellington, xx + 116
pp., I pf
Petit, R.E. and M.G. Harasewych. 2000. Additions to the
cancellariid (Mollusca: Neogastropoda) fauna of South
Africa. Proceedings of the Biological Society of Washing-
ton 113: 145-154.
Powell, A.W. B. 1933. New species of marine Mollusca
from the subantarctic islands of New Zealand. Proceed-
ings of the Malacologieal Society of London 20(5),
232-236, pi. 20.
THE NAUTILUS 124(l):44-50, 2010
Page 44
Current distribution of the exotie freshwater snail Helisoma duryi
(Gastropoda: Planorbidae) in Brazil
Monica A. Fernandez
Silvana C. Thiengo
Laboratorio de Malacologia
Referenda Nacional em
Malacologia Medica
Instituto Oswaldo Cruz - Fiocruz
Av. Brasil 4365
21045-900 Rio de Janeiro, BRAZIL
[email protected]
Fernando S. M. Bezerra
Departamento de Analises Clmieas/FFOE
Universidade Federal do Ceara
Rua Capitao Francisco Pedro 1210
60430-370 Fortaleza, BRAZIL
Lucia M. S. Alencar
Secretaria de Saude do Estado do Ceara
Rua dos Tabajaras 281, Praia de Iracema
60060-510 Fortaleza, BRAZIL
ABSTRACT
This article describes the current distribution of the introduced
gastropod Helisoma duryi in Brazil. The species was recorded
for the first time in Brazil in 1972, in Formosa, state of Goias,
and since then it has been reported to occur in the states of
Ceara, Minas Gerais, Paraiba, Rio de Janeiro, and Sao Paulo.
Recently, this species was found in the state of Ceara, where it
was introduced through ornamental fish and aquatic plant
trade. The expansion of the species range in Brazil demon-
strates the need for increased efforts to monitor and con-
trol the introduction of exotic species. Up to now, H. duryi
had been found in 14 municipalities together with spec-
imens of Ampullariidae, Ancylidae, Corbieulidae, Lymnaeidae,
Planorbidae, Physidae, and Thiaridae. We believe that the
current absence of H. duryi in the localities where it had
been previously collected (1972 and 1998) could be associated
with environmental changes in those regions and also be-
cause selling in H. duryi is not as efficient as it is for other
Planorbidae species. A map with the distribution of H, duryi is
also provided.
Additional keywords: exotic freshwater mollusks, biological
invasions, invasive species, planorbids
INTRODUCTION
Non-native species, those that have been introduced
from another geographic region to an area outside its
natural range, have been the focus of several investiga-
tions in the past years, mostly because they have been
closely related to problems in human health, in the envi-
ronment, and economy. The Convention on Biological
Diversity (CBD), ratified in 188 countries, including
Brazil, is one of the most important international tools
conceived to provide environmental conventions, strate-
gies, and agreements in order to promote sustainable
development. In Brazil, where specialists and environ-
mental public bodies recognize the problems involved
with exotic species, CBD signed the Decree number
2.519, seeking to protect and manage biodiversity
(Ministerio do Meio Ambiente, 2009).
Difficulties in predicting the effects of alien species
after introduction were discussed by Meyer et al.
(2008), in an investigation on the exotic giant African
snail, Achatina fulica Bowdich, 1822. According to
Ricklefs (2005), every invasion process undergoes lour
phases: introduction or colonization; settlement, which
requires adaptation to local conditions to survive local
species interactions; geographical expansion; and even-
tual decay. The period during which every species
remains at each of those phases depends on either intrin-
sic or extrinsic factors to it. (Incidentally, Brazil is cur-
rently experiencing the explosive phase of the invasion of
A. fulica , and dense populations of that species are wide-
spread in at least 24 out of 26 Brazilian states and the
Federal District.)
In Brazil, biological invasions and the pathways of
introduction and spread of exotic species are not yet well
documented, but a number of instances of tbe spread of
invasive mollusks have been documented in the last
decade: Thiengo et al. (2007a) reported the rapid expan-
sion and current distribution of A. fulica since its intro-
duction in the state of Parana, in 1988 while Santos et al.
(2002) and Fischer and Colley (2005) reported the
occurrence of A. fulica in preservation areas in the states
of Rio de Janeiro (Ilha Grande, Angra dos Reis) and
Parana (Ilha Rasa, municipality of Guaraqueyaba), re-
spectively, and Takeda et al. (2003) and Mansur et al.
(2004) reported the occurrence of the invasive freshwa-
ter clams Limnopema fortunei (Drinker, 1857) and
Corbicula spp. in Southern Brazil. In addition to envi-
ronmental and economical problems related to exotic
snail species, some of those species have medical and
veterinary importance as they may be associated with
zoonotic and parasitic transmission ol diseases (Caldeira
et ah, 2007; Thiengo et ah, 2008).
M. A. Fernandez et al., 2010
Page 45
The aquarium trade is a major source ol exotic fresh-
water mollusks. In 1972, a population of Helisoma chinji
(Wetherby, 1879), autochthonous from the Everglades
wetlands in Florida, was first reported in Distrito de
Santa Rosa, municipality of Formosa, state of Goias,
Brazil, in natural breeding sites connected with the Cana
Brava River (Paraense, 1975). According to Paraense
(1976), these specimens collected in the locality Lagoa
da Pedra, in connection with the Cana Brava River,
included a large number of albinos obtained from sym-
patrie populations of Ampullariidae, Ancylidae, Phys-
idae, and other Planorbidae. Similarly, Thiengo et al.
(1998) also reported the presence of albino specimens
in fish tanks in the municipality of Guapimirim, state of
Rio de Janeiro, Brazil, in June 1997 and remarked the
importance of aquarium fish trade in the introduction
and spread of exotic snails in new sites.
Recognizing the threat to global biodiversity that in-
vasive species play Brazil is one of 188 countries that
have ratified the CBD in an effort to help manage this
disappearing resource. In 2006 snails were sent from
Serra Verde do Saraiva by the Secretaria de Saude of
the state of Ceara (SESA-CE), to the Centro Nacional
de Referenda em Malacologia Medica (LRNM) for
identification. These snails were identified as H. clurt/i ,
and prompted surveys of the present distribution of this
species in Brazil along with the occurrence of sympatric
freshwater snail species were performed and presented.
MATERIALS AND METHODS
Information on the distribution of Helisoma dunji in
Brazil since its first recorded introduction was obtained
from the literature and from data on specimens collected
by the authors. Field surveys were performed in three
states, from which the occurrence of H. dunji was previ-
ously reported by the staff of LRNM: Goias (munici-
palities of Formosa and Vila Boa), Rio de Janeiro
(municipality of Guapimirim), and Ceara (municipalities
of Acarape, Fortaleza, Guaiuba, and Redenyao).
In the state of Goias (Table 1), snail collections were
performed between 2003 and 2005 in wetland areas
along federal highway BR-020, and in Lagoa da Pedra,
between the municipalities of Formosa and Vila Boa. In
the state ol Rio de Janeiro (municipality of Guapimirim)
collections were made in 2000, 2003, and 2007 (Table 1)
in exotic ornamental fish ( Betta splendens (Regan. 1910))
breeding tanks. Four municipalities were investigated in
the state of Ceara (Table 1): three in the region of Serra
Verde do Saraiva (Acarape, Guaiuba and Redenyao) and
one in the Fortaleza municipality (a lake named Lagoa
de Porangabussu).
Mollusks were collected from different habitats
(streams, wells, marshy areas, fish tanks and lakes) using
collecting sieves. With the aim of assessing abiotic factors
in the habitats where IP dunji occurs, variables such
as temperature (water and air), pH, and the concen-
tration of dissolved oxygen in the water column were
measured using a mereurium thermomether, a pHmeter
(Instrutherm pH-1700), and an oxymeter (Lutron
DO-5510). Samples were maintained under laboratory
conditions at LRNM in aquaria containing dechlorinated
tap water and a thin bottom layer of a 2:1 mixture of
screened soil and ground oyster shells as a source of
mineral nutrients.
For specific identification, the snails were anesthe-
tized with 0.05% sodium pentobarbital (Hypnol®) for
five hours; killed by immersion in 70'’C water and then
fixed in Railliet- Henry solution (Fernandez et al. 2008).
Snail samples were deposited in the Malacologieal Col-
lection of Institute) Oswaldo Cruz (CM IOC).
RESULTS
In the state of Goias (Table 1), eight freshwater gastropod
species were found: Biomphalaria straminea (Drinker,
1848), Drepanotrema anatimun (Orbigny, 1835), Drepa-
notrema cimex (Morieand, 1839), Drepanotrema depres-
sissimum (Morieand, 1839), Drepanotrema hicidum
(Pfeiffer, 1839), Gnndlachia radiata (Guilding, 1828),
Melanoides tuberculatus (Muller, 1774) and Pomacea sp.
In the state of Rio de |aneiro, in the municipality of
Guapimirim (Table 1), no H. duriji specimens were
found but the following species were collected: Bio-
mphalaria tenagophiJa (d’Orbigny 1835), B. straminea ,
Hebetancylus morieand i (d’Orbigny, 1837), Lymnaea
columella Say, 1817, M. tuberculatus, Physa marmorata
Guilding, 1828, Pomacea diffusa (Reeve, 1856), and
Pomacea sp. (only juvenile specimens).
In the state of Ceara, specimens of H. dunji were
found in the two habitats, a well and a fish tank (Table 1).
In these the water temperatures were 27.3°C and
27.4°C, environment temperatures were 36.8°C and
33.7°C, pH was: 7.76 and 6.38, and dissolved oxygen
measured 7.8 mg/L and 7.0 mg/L in the well and the
fish pond, respectively. The other freshwater gastro-
pods found in the state were B. straminea, D. lucidum,
G. radiata , H. dunji , M.tuberculatus, P. marmorata ,
Pomacea lineata (Spfx in Wagner, 1827), P. diffusa, and
Pomacea sp. (only juvenile specimens).
DISCUSSION
According to Paraense (1976) and the data from
CMIOC, in August 1972, in addition to Helisoma dunji ,
the following snail species were collected in lakes form-
ed by the Cana Brava River (in the municipality of
Formosa, Goias): B. straminea, Biomphalaria schrammi
(Crosse, 1864), D. anatinum, D. lucidum, Plesioplysa
ornata (Haas, 1938), L. columella, and P. marmorata . In
the present study surveys were performed in seven
ponds formed by Cana Brava River flooded areas, in the
municipalities of Vila Boa and Formosa, but no spec-
imens of H. dunji were found.
In the 1990s, many ornamental freshwater fish breed-
ing facilities in the state of Rio de Janeiro were located in
Page 46
THE NAUTILUS, Vol. 124, No. 1
Table 1. Study localities and species found.
the municipality of Guapimirim. This probably favored
the introduction of exotic species. According to the field
work registrations in the LRNM, specimens of H. duryi
reported by Thiengo et al. (1998) were found in sym-
patry with B. straminea, Ferrissia sp., L. columella and
P. bridgesii. The latter is identified as P. diffusa nowa-
days, according to Hayes et al (2008). Many albino spec-
imens ol H. duryi and P. diffusa were also found in those
fish tanks in September, 1997. Although no PI. duryi
specimen was found, the present paper confirms the
establishment ol P. diffusa, only species reported by
Thiengo et al. (1998) and also obtained in 2007. This
species occurs naturally throughout the Amazon Basin
(Peru, Bolivia and Brazil) but it is widespread nowadays
due to aquarium and fish trade, specially the more
attractive albino specimens known as golden apple
snails.
Our results indicate a reduction in Helisoma duryi
populations in the state of Ceara. In March and May
2006, a team from Secretaria de Saude of the state of
Ceara (SESA-CE) collected samples of H. duryi in five
localities in the municipalities of Redenyao and Guaiuba,
and in the present study this species was found in only
two of these (Table 1). In the lake Porangabussu, in the
M. A. Fernandez et al., 2010
Page 47
municipality of Fortaleza, where H. duryi and M. tuber-
culatus specimens were collected in 1999 by Dr.
Fernando Bezerra (Universidade Federal do Ceara) and
sent to LRNM for identification, no specimens were
found in 2006 and 2008.
The introduction of Helisoma duriji was probably the
result of aquaculture activity. Ornamental plants are
used in fish tanks chiefly to promote water oxygenation.
These plants may transport both eggs and early stages of
freshwater gastropods, enabling their spread into new
environments. Correa et al. (1980) inferred the impor-
tance of such plants as vectors for dispersal ol non-native
mollusks, and noted that they may have been particularly
important regarding the spread of schistomsomiasis-
carrying individuals of B. straminea in Sao Paulo state.
They surveyed aquarium and aquatic plant shops through-
out the municipality and found specimens of Physidae,
Lymnaeidae, Ampullariidae, Thiaridae, and Planorbidae,
including Helisoma sp. In the same state, Franga et al.
(2007) collected sediment samples in three reservoirs of
the Baixo Rio Tiete (Promissao, Nova Avanhandava, and
Tres Irmaos), in November 2002 and August 2003, in
order to identify species of benthic mollusks. Specimens
H. duryi were found, including another exotic bivalve,
Corbicula fluminea (Mnller, 1774), and the Afro-asiatie
gastropod, M. tuberculatus. Although //. duryi was pre-
sent in the three reservoirs analyzed, that species had the
lowest density among the exotic mollusks.
For an exotic species to be regarded as invasive it must
have, at least, considerable adaptability to new environ-
ments, rapid sexual maturation, and a large reproductive
capacity (Santos et al. 2007). Ecological and parasitolog-
ical laboratory studies of Helisoma duryi obtained in
Goias in 1972 (Milward-de- Andrade, 1978a, b; Milward-
de-Andrade and Belisario, 1979; Milward-de-Andrade
and Souza, 1979; Milward-de-Andrade et al., 1979) indi-
cate adaptive advantages of that exotic species over
Biomphalaria glabrata (Say, 1818). These include a
higher reproduction rate, lower mortality, higher resis-
tance to environmental desiccation, increased starvation
survival, and increased resistance to infection by
Schistosoma mansoni in that former species.
Other authors reported that Helisoma duryi may have
the ability to control populations of Biomphalaria spp., a
vector of schistosomiasis (Frandsen, 1987; Frandsen and
Madsen, 1979), in Puerto Rico, St. Lucia, Egypt, and
Tanzania. In Brazil, Milward-de-Andrade (1979) argued
that the capacity of H. duryi to colonize Neotropical
ecosystems, either directly or indirectly, may play a
key role in the biological control of schistosomiasis
mansoni. However, throughout the last three decades,
such expected interspecific competition has not been
observed (the H. duryi population found in 1972, in
Goias, did not successfully establish itself, and was
not observed in 2003 and 2005). Remarkably, M. tuber-
culatus was found in this habitat after 2005, having been
introduced in Brazil probably by aquarists in Santos in
1967 (Vaz et ah, 1986). Currently, M. tuberculatus may
be found in seventeen Brazilian states and in the Distrito
Federal, in both lenthic and lothie habitats, with or with-
out anthropic influences (Fernandez et al., 2003).
Melanoides tuberculatus reproduces parthenogeneti-
eally, which may account for its wider geographic distri-
bution when compared to II duryi. The latter may
occasionally utilize selfing as an alternative means of
reproduction, although it is not as efficient as it is for
other Planorbidae species (Paraense and Correa, 1988).
According to these authors, H. duryi benefits much less
from functional hermaphroditism which, besides other
advantages, enables a single virgin individual to found a
new population. Furthermore, other characteristics of
M. tuberculatus , such as viviparity, iteroparity and high
survival rate of the young, may also contribute to its
spread (Santos et al., 2007).
In Guapimirim (Rio de Janeiro) and in Lagoa do
Porangabussu (Ceara), B. straminea appears to have
adapted to local conditions, forming colonies, while
H. duryi has not. Remarkably, in Guapimirim municipal-
ity, specimens of B. straminea were found in 1997 and
2003, but not in 2007; whereas B. tenagophila was
recorded in 2003 and 2007. The disappearance of
B. straminea and the establishment of B. tenagophila
must be confirmed. In contrast, Silva et al. (1997) re-
ported the replacement of B. straminea for B.tenagophila
in the municipality of Paracambi, Rio de Janeiro.
Tl le introduction of H. duryi in the state of Ceara may
be a result of B. splendens aquaculture (breeding and
trade), similar to that described for Guapimirim (Rio de
Figure 1. Helisoma duryi from Ceara state, municipality of
Redengao (04°10'46.8" S, 38°44'02.4" W).
Page 48
THE NAUTILUS, Vol. 124, No. 1
Janeiro). Ornamental and pet fish such as B. splendens
originate in Asia and were introduced to Europe and the
United States in 1874 and 1910, respectively (Faria et ah,
2006). In the 1960s and 1970s, ornamental fish breeders
in Brazil introduced production techniques and female
individuals imported from Europe and the United
States. Since then, individuals of H. clun/i have been
recorded in the following Brazilian states: Minas Gerais,
in the municipalities of Vigosa in 1967, and Uberaba
(Vidigal et ah, 2000); Rio de Janeiro, in the municipality
of Nova Iguagu in 1975; Paraiba, in the municipalities of
Joao Pessoa and Campina Grande (Abilio, 2003); and
Sao Paulo (Correa et ah, 1980; Franga et ah, 2007). The
distribution of the exotic freshwater snail H. duryi in
Brazil is shown in the Figure I .
In addition to use of the species in ornamental fish
aquaculture, Betta splendens was also released under
experimental conditions in 2000 as a biological control
of the mosquito Aedes aegypti Linnaeus, 1758, in the
state of Ceara, municipalities of Fortaleza and Caninde
(Pamplona et ah, 2004). This may in part account for the
spread of II. duryi in that state. A temporary shortage of
rainfall in the state of Ceara in October 2006 made it
difficult to find H. duryi, in contrast to March and May,
the rainfall season in that region. In October 2006, H.
duryi specimens (juvenile and eggs) were found in a fish
tank of ornamental fish production in Redengao, as well
as other snail species such as P. mannorata and P. diffusa.
Recently, Hayes et ah (2008) reported that some
ampullariid species, such as P. diffusa, may have some
characteristics that allow them to become invaders fol-
lowing introduction; its occurrence in Guapimirim (Rio
de Janeiro), ten years after its first record, supports
Hayes’s remark. Furthermore, the presence of P. diffusa
in Ceara, currently restricted to a fish tank, is reason for
concern over the potential for future spread and estab-
lishment of new colonies in other areas of Serra Verde do
Saraiva. This could happen as a result of the rainy sea-
son, a possibility that in itself makes evident the urgent
need for monitoring of the local malacofauna.
To date, there is no record of threatened native species,
risk of economical loss, or damage to public health that
could be triggered by the introduction of Heliosma
duryi in Brazil However, this lack of concern may be
unwarranted, and preventive measures against the intro-
duction and spread of the species, as well as of others that
Figure 2. Distribution of the exotic freshwater snail Helisoma duryi in Brazil: 1, Fortaleza; 2, Guaiiiba; 3, Acarape; 4, Redengao; 5,
Campina Grande; 6, Joao Pessoa; 7, Vila Boa; 8, Formosa; 9, Uberaba; 10, Vigosa; 1 1 , Promissao; 12, Sao Paulo; 13, Nova Iguagu; 14,
Guapimirim.
M. A. Fernandez et al., 2010
Page 49
are associated with environmental damages and public
health problems, should be taken. Accordingly, strict law
enforcement policies and procedures must be established
in the trade of aquatic plants to fish producers as a pre-
ventive measure to preserve our biodiversity.
LITERATURE CITED
Abilio, F.J.P. 2003. Gastropodes e outros invert ebrados
bentonieos do sedimento litoraneo e associados a macrofitas
aquaticas em ayudes do semi-arido paraibano, nordeste do
Brasil. Available from: http://www.uepb. edu.br/eduep/rbct/
sumarios/pdf/eiehhornia.pdf [ 13/VIII/2008] .
Caldeira, R.L., C.L. G.F. Mendonya, C.O. Gouveia, H.L.
Lenzi, C. Graeff-Teixeira, W. S. Lima, E.M. Mota, I.L.
Pecora, A. M.Z. Medeiros, and O.S. Carvalho. 2007. First
record of molluscs naturally infected with Angiostrongijlus
cantonensis (Chen, 1935) (Nematoda: Metastrongylidae)
in Brazil. Memorias do Instituto Oswaldo Cruz 102:
887-889.
Correa, L.L., M.O.A. Correa, J.F. Vaz, M.I.P.G. Silva,
R.M. Silva, and M.T. Yamanaka. 1980. Importancia das
plantas ornamentals dos aquarios como veiculos de
propagayao de vetores de Schistosoma rnansoni. Revista
do Instituto Adolfo Lutz 40: 89-96.
Faria, P.M.C., D.V. Crepaldi, E.A. Teixeira, L.P Ribeiro,
A.B. Souza, D.C. Carvalho, D.C. Melo, and E.O.S.
Saliba. 2006. Criayao, manejo e reproduyao do peixe Betta
splendens (Regan 1910). Revista Brasileira de Reproduyao
Animal 30: 134-149.
Fernandez, M.A., S.C. Thiengo, and R.S. Amaral. 2008.
Teenicas Malacologicas, pp. 47-81. IN Thiengo, S.C.,
O.S. Pieri, and R.S. Amaral (Orgs) Vigilancia e eontrole
de moluscos de importancia epidemiologica: diretrizes
teenicas. Programa de Vigilancia e Controle da
Esquistossomose (PCE), Ministerio da Saude, Secretaria
de Vigilancia em Saude, Departamento de Vigilancia
Epidemiologica, 2a Ediyao, Brasilia, 177pp.
Fernandez, M.A., S.C. Thiengo, and L. R. Simone. 2003. Dis-
tribution of the introduced freshwater snail Melanoides
tuberculatus (Gastropoda: Thiaridae) in Brazil. The Nau-
tilus 117: 78-82
Fischer, M.L. and E. Colley. 2005. Especie invasora em
Reservas Naturais: earaeterizayao da populayao de
Achatina fulica Bowdich, 1822 (Mollusca - Achatinidae)
na Ilha Rasa, Guaraqueyaba, Parana, Brasil. Biota
Neotropica 5: 1-18.
Franya, R.S., A.L. Sudani, and O. Rocha. 2007. Composiyao
das espeeies de moluscos bentonieos nos reservatorios do
baixo rio Tiete (Sao Paulo, Brasil) com uma avaliayao do
impacto causado pelas espeeies exoticas invasoras. Revista
Brasileira de Zoologia 24: 41-51.
Frandsen, F. 1987. Control of schistosomiasis by use of biolog-
ical control of snail hosts with special reference to compe-
tition. Memorias do Instituto Oswaldo Cruz 82 (Suppl.
IV): 129-133.
Frandsen, F. and PI. Madsen. 1979. A review of Helisoma duryi
in biological control. Acta Tropica 36: 67-84.
Hayes, K.A., R.C. Joshi, S.C. Thiengo and R.H. Cowie. 2008.
Out of South America: multiple origins of non-native
apple snails in Asia. Diversity and Distributions 14:
701-712.
Mansur, M.C.D., C.T. Callil, F.R. Cardoso, and J.A.A. Ibarra.
2004. Uma retrospectiva e mapeamento da invasao de
espeeies de Corhicula (Mollusca, Bivalvia, Veneroida,
Corbiculidae) oriundas do Sudeste Asiatico, na America
do Sul, pp. 39-58. In: Silva, J.S.V. and R.C. C.L. Souza
(Eds.) Agua de Lastro e Bioinvasao. Editora Intercieneia,
Rio de Janeiro, 224 pp.
Meyer, W. M., K.A. Hayes and A. I. Meyer. 2008. Giant African
snail Achatina fulica as a predator. American Malacologi-
cal Bulletin 24! 117-119.
Milward-de- Andrade, R. 1978a. Fecundidade de Helisoma
duryi e Biomphalaria glahrata , criadas em laboratorio.
Revista Brasileira de Malariologia e Doenyas Tropicais
30: 5-44.
Milward-de-Andrade, R. 1978b. Competiyao entre Helisoma
duryi e Biomphalaria glahrata , em eondiyoes de labo-
ratorio. Revista Brasileira de Biologia 38: 787-800.
Milward-de-Andrade, R. 1979. Natalidade comparada de
Helisoma duryi e Biomphalaria glahrata , em laboratorio
(Mollusca, Planorbidae). Revista Brasileira de Malari-
ologia e Doenyas Tropicais 31 : 35-58.
Milward-de-Andrade, R. and R.F. Belisario. 1979. Tipo
de substrato e natalidade comparada de Helisoma duryi
e Biomphalaria glahrata. Ciencia e Cultura 31 (Suppl.):
412.
Milward-de-Andrade, R., S. Oliveira, and A. A. Ramos. 1979.
Observayao preliminar sobre liberayao de eerearias de
S. rnansoni por Biomphalaria glahrata associadas a
Helisoma duryi. Ciencia e Cultura 31 (Suppl.): 532.
Milward-de-Andrade, R. and C.R Souza. 1979. Infecyao
experimental de Biomphalaria glahrata com Schisto-
soma rnansoni , na presenya de Helisoma duryi. Revista
Brasileira de Malariologia e Doenyas Tropicais 31
(Suppl.): 185-186.
Ministerio do Meio Ambiente. 2009. Convenyao sobre
Diversidade Biologica. Available from: http:// www.mma.
gov.br/port/sbf/chm/cdb/decreto.html [03/1 1 1/2009].
Pamplona, L. G.C., J.W.O. Lima, J.C.L. Cunha, and
W.R Santana. 2004. Avaliayao do impacto na infestayao
por Aedes aegypty em tanques de cimento do Municipio
de Caninde, Ceara, Brasil, apos a utilizayao do peixe Betta
splendens como alternativa de controle biologico. Revista
da Sociedade Brasileira de Medicina Tropical 37:
400-104.
Paraense, W. L. 1975. Estado atual da sistematica dos pla-
norbfdeos brasileiros. Arquivos do Museu Nacional 55:
105-128.
Paraense, W. L. 1976. A natural population of Helisoma duryi
in Brazil. Malacologia 15: 369-376
Paraense, W.L. and L.R. Correa. 1988. Self-fertilization in the
freshwater snails Helisoma duryi and Helisoma trivolvis.
Memorias do Instituto Oswaldo Cruz 83: 405-409.
Ricklefs, R.E. 2005. Taxon cycles: insights from invasive
species, pp. 165-199. In: Sax, D.F., J.J. Stachowicz, and
S.D. Gaines (Eds.) Species invasions: insights into ecology,
evolution, and biogeography. Sinauer Associates, Sunder-
land, 495 pp.
Santos, S.B., D.P Monteiro, and S.C. Thiengo. 2002. Achatina
ftdica (Mollusca, Achatinidae) na Ilha Grande, Angra dos
Reis, Rio de Janeiro: implieayoes para saude ambiental.
Biociencias 10: 159-152.
Santos, S.B., I.C. Miyahira, and L. E.M. Lacerda. 2007. First
record of Melanoides tuberculatus (Muller, 1774) and
Biomphalaria tenagophila (d’Orbigny, 1835) on Ilha
THE NAUTILUS, Vol. 124, No. 1
Page 50
Grande, Rio de Janeiro, Brazil. Biota Neotropica 7:
361-364.
Silva, C.L.P.A.C., M.S. Soares, and M.G.M. Barreto. 1997.
Occurrence of Biomphalaria tenagophila and disap-
pearance of Biomphalaria straminea in Paracambi,
RJ. Memorias do Instituto Oswaldo Cruz 92: 37-38.
Takeda, A M., M.C.D. Mansur, D.S. Fujita, and J.P.R. Bibian.
2003. Ocorreneia da especie invasora de mexilhao
dourado, Limnopema fortunei (Dunker, 1857), em dois
pequenos reservatorios proximos a Curitiba, PR. Acta
Biologica Leopoldensia 25: 251-254.
Thiengo, S.C., F.A. Faraco, N.C. Salgado, R.H. Cowie, and
M. A. Fernandez. 2007a. Rapid spread of an invasive snail
in South America: the giant African snail, Achatina fulica,
in Brasil. Biological Invasions 9: 693-702.
Thiengo, S.C., M.A. Fernandez, M.F. Boaventura, and
M.A. Stortti. 1998. A survey of freshwater gastropods in
the Microrregiao Serrana of the State ol Rio de Janeiro,
Brazil. Memorias do Instituto Oswaldo Cruz 93 (Suppl. I):
233-234.
Thiengo, S.C., M.A. Fernandez, A.C. Mattos, and A.F.
Barbosa. 2007b. Dispersao do molusco introduzido
Melanoides tuherculatus (Muller, 1774) (Gastropoda;
Thiaridae) no Brasil, p. 101-106. In: Barbosa, S.B., A. D.
Pimenta, S.C. Thiengo, M.A. Fernandez, and R.S. Absalao
(Eds.) Topicos em Malacologia - Eeos do XVIII Encontro
Brasileiro de Malacologia. Sociedade Brasileira de
Malacologia, Rio de Janeiro, 365pp.
Thiengo, S.C., M.A. Fernandez, E.J.L. Torres, P.M. Coelho,
and R.M. Lanfredi. 2008. First record of a nematode
Metastrongyloidea (Aelurostrongylus abstmsus larvae) in
Achatina (Lissachatina) fulica (Mollusca, Achatinidae) in
Brazil. Journal of Invertebrate Pathology 98: 34-39.
Vaz, J.F., II. M.S. Telles, M.A. Correa, and S.P.S. Leite. 1986.
Ocorreneia no Brasil de Thiara ( Melanoicles ) tuberculata
(Muller, 1774) (Gastropoda; Prosob ranc-hia), primeiro
hospedeiro intermediario de Clonorchis sinensis
(Cobbold, 1875) (Trematoda, Plathyhelmintes). Revista
de Saude Publica 20: 318-322.
Vidigal, T.H.D.A., J.C. Kissinger, R.L. Caldeira, E.C.R. Piles,
E. Monteiro, A. |.G. Simpson, and O.S. Carvalho. 2000.
Phylogenetic relationships among Brazilian Biomphalaria
species (Mollusca: Planorbidae) based upon analysis of
ribosomal ITS2 sequences. Parasitology 121: 611-620.
THE NAUTILUS 124(l):51-53, 2010
Page 51
Early stages of development in the endangered limpet
Patella ferruginea Gmelin, 1791 (Gastropoda: Patellidae)
Fi ee Espinosa
Georgina A. Rivera-Ingraham
Jose C. Garcia-Gomez
Laboratorio de Biologia Marina
Departamento de Fisiologia y Zoologia
Universidad de Sevilla
Avda. Reina Mercedes 6
41012 Sevilla, SPAIN
[email protected]
ABSTRACT
The larval biology of Patella fermginea is studied lor the first
time. Development in the species first showed two complete
and equal cleavages whereas the third cleavage was unequal,
resulting in an embryo with 4 micromeres and 4 macromeres.
Early troehophores were detected 19 hours post-fertilization
and pretorsional veligers appeared 27 hours post- fertilization.
Early stages of development are very similar to those shown by
other related limpet species, with higher developmental times
than those recorded for Patella caemlea and similar to those
obtained in Patella vulgata. However, in vitro fertilization and
the obtainment of spats in a massive amount could be the solu-
tion for replenishing threatened or extinct populations of this
extremely endangered Mediterranean species. The results of
the present study represent a first approach in order to produce
great amounts of spats in laboratory conditions for further
reintroduction projects aiming for conservation of the species.
Additional keywords: Conservation, endangered species
INTRODUCTION
The mollusk Patella fermginea Gmelin, 1791, endemic to
the Mediterranean, is the most endangered marine species
listed on the European Council Directive 92/43/EEC and it
is presently under serious risk of extinction ( Lahore] -
Deguen and Laborel, 1991; Ramos, 1998; Espinosa et ah,
2006). Nevertheless, its biology and ecology are poorly
known (Guerra-Gareia et ah, 2004) and studies mainly
focused on the reproductive biology and larval develop-
ment of the species are urgently required, as pointed out
by Templado (2001) and Guallart et ah, (2006), in order to
implement adequate management and conservation strate-
gies. The larval biology has not been studied in detail
before, although some preliminary fertilization assays were
made on the field by Guallart et ah, (2006). Taking into
account that in the last decades captive breeding has been
suggested an important supportive intervention to avoid the
loss of many species (IUCN, 1987), in vitro fertilization of
Patella fermginea and the obtainment of spats in a massive
amount could be the solution for replenishing the threat-
ened or extinct populations of the species around the
Mediterranean. The development of appropriate culture
techniques is considered to be crucial for die future conser-
vation of the species.
MATERIALS AND METHODS
Adults of Patella fermginea were collected from Ceuta,
North Africa (35°53/20" N, 5°18'30" W), during October
and November 2006, overlapping with the annual repro-
duction period of the species (Frenkiel, 1975) and inde-
pendently of the lunar cycle, but always during low tide.
Animals were kept in an aquarium, at a constant tempera-
ture of 18°C. Additionally, and in order to determine the
maturation stage of the gonads, biopsies were taken. The
gonads of ripe animals were dissected for artificial insemi-
nation following Van den Biggelaar (1977) and Wanninger
et ah (1999) protocols; all further fertilization, culture, and
breeding procedures were carried out in Seachem B artifi-
cial seawater filtered through a 0.45 pm mesh (AFSW) at
18°C. 1000 ml beakers were used as culture vessels, each
filled with 500 ml of AFSW, stirred through moderate
aeration. Eggs from four females were treated with alka-
line sea water (pH = 8.9, by addition of drops of NH4OH)
for 1-7 minutes before fertilization to induce the egg-
ripening process, followed by stirring, allowed to settle for
3 minutes, washing, and decanting 4 or 5 times (see also
Dodd, 1957). Sperm of four males was diluted in AFSW
until the suspension became fully clear; the agility of sperm
cells was confirmed under the microscope before insemi-
nation. For fertilization, 10-20 drops of sperm suspension
were used per liter of egg-containing AFSW. The percent-
age of fertilized eggs at each treatment was assessed
using a compound microscope by the presence of normal
or abnormal cleavage in 100 undamaged eggs that were
Page 52
THE NAUTILUS, Vol. 124, No. 1
5
Figures 1-5. Development stages in Patella ferruginea , reared at 18°C. Light micrographs. 1. First cleavage (2 h) displaying polar
body (pb). 2. Eight-cell stage (4 h). Micromeres (mic); macromeres (mac). 3. >12 cells: morula (5 h). 4. Completely formed
trochophore (19 h) with apical cilia (ae), prototrochal cilia (pc), prototrochal girdle (pg) and stomodeum (sto). 5. Early pretorsional
veliger (27 h) with apical cilia (ac), prototrochal girdle (pg) and larval shell (Is). Scale bars 100 pm.
randomly sampled from each vessel at least 4 h after
insemination (see Baker and Tyler, 2001).
Larval cultures were kept in AFSW with 50 mg strep-
tomycin and 60 mg penicillin per litre to minimize
microbial or fungal infection. The water was changed
periodically by pouring the vessels’ content on to a sieve
of 100 pm being held partly under water to prevent
damage to the larvae. Larval development was moni-
tored with a compound microscope, and major stages
were recorded with photomicrographs.
RESULTS
Eggs of Patella ferruginea present an average diameter
of 149.78 pm whereas sperm shows an average length of
3.78 pm (Espinosa et ah, 2006). The first evidence of
fertilization was the extrusion of the first polar body in
the first two hours after insemination, and the complete-
ness of the first two cleavages, equal and always initiated
near the polar body (Figure 1). However, the fertilization
rate resulted very low (3±1%). The third cleavage was
F. Espinosa et al., 2010
Page 53
unequal and equatorial, such that the resulting 8-celled
embryos were composed ol 4 macromeres and 4 micro-
meres (Figure 2). Trocophores presented the natural
morphology associated with the taxon and swam actively
during 19 hours after fertilization, with telotroeh (anal
tuft), apical and prototrochal cilia (Figure 4) well devel-
oped and similar to those described for other patellid
limpet species. In early trochophores, steady swimming
was often alternated with abrupt bursts of speed. This
sprint behaviour was constantly observed. Trochophores
swam horizontally and vertically in culture vessels.
The stomodeum was visible immediately beneath the
prototrochal girdle (Figure 4). In pretorsional veliger
the larval shell started to be observed (Figure 5) 27 hours
after fertilization, whereas other structures remained, as
the apical cilia and prototrochal girdle. This pretorsional
veliger could be observed until 48 hours after fertiliza-
tion, when the remained larvae died.
DISCUSSION
The early stages of larval development in Patella
ferruginea obtained in the present study, appear to
be veiy similar to other related limpet species, with
higher developmental times than Patella caerulea (see
Wanninger et al., 1999) and similar to those obtained in
Patella vulgata (see Dodd, 1957; Wanninger et al., 1999).
Nevertheless, it is known that water temperature influ-
ences the timing of developmental events (Kay and
Emlet, 2002). In this sense, the proportional timing for
P. ferruginea could be higher than for P. vulgata, al-
though further experiments would be necessary. It is
important to note that the fertilization rates obtained
were very low and that the larval survival did not exceed
48 h, despite the use of similar methods that have
reported good results in other related species (Dodd,
1957; Wanninger et al., 1999, 2000; Kay and Emlet,
2002). Further studies are required in order to establish
if these results can be imputed to the necessity of
improving the methodology or to biological constraints
of the species.
Either way, the results of the present study could be
considered as a first step towards the elaboration of a
protocol that will permit to rear spats in laboratory con-
ditions which could be used for further reintroduction
and eonservational projects.
ACKNOWLEDGMENTS
This work was funded by a postdoctoral grant of the
Ministry of Education of Spain awarded to F. Espinosa
(EX2006-0534), predoctoral grant of the Ministry of
Education of Spain to G.A. Rivera-Ingraham (AP-2006-
04220) and financial support by the “Autoridad Portuar-
ia de Ceuta”. The authors express their gratitude to
“Consejerfa de Medio Ambiente-Obimasa,” Ceuta, for
its support.
LITERATURE CITED
Baker, M.C. and P.A. Tyler. 2001. Fertilization success in
the commercial gastropod Haliotis tuberculata. Marine
Ecology Progress Series 21 1 : 205-213.
Dodd, J.M. 1957. Artificial fertilisation, larval development
and metamorphosis in Patella vulgate L. and Patella
caerulea L. Pubblicazione di la Stazione Zoologica di
Napoli 29: 172-186.
Espinosa, F., J.M. Guerra- Garcia, D. Fa, and J.C. Garcia-
Gomez. 2006. Aspects of reproduction and their implica-
tions for the conservation of the endangered limpet.
Patella ferruginea. Invertebrate, Reproduction and Devel-
opment 49: 85-92.
Frenkiel, L. 1975. Contribution a l’etude des cycles de repro-
duction des Patellidae en Algerie. Pubblicazione di la
Stazione Zoologica di Napoli 39: 153-189.
Guallart, J., J. Templado, M. Calvo, P. Cabezas, I. Acevedo,
A. Machordom, and A. A. Luque. 2006. Inventario
y seguimiento de Patella ferruginea en Espana, asi
conro la elaboration de una propuesta de estrategia de
conservation de la especie. Informe final. Ministerio de
Medio Ambiente, Madrid, 199 pp.
Guerra-Garcia, J.M., |. Corzo J., F. Espinosa, and J.C. Garcia-
Gomez. 2004. Assessing habitat use of the endan-
gered marine mollusc Patella ferruginea (Gastropoda,
Patellidae) in nordiern Africa: preliminary results and
implications for conservation. Biological Conservation
116: 319-326.
IUCN (International Union for Conservation of Nature and
Natural Resources). 1987. The IUCN position statement
on traslocation of living organisms: introductions, re-intro-
ductions and re-stocking. IUCN Council, Gland, Switzer-
land, 4 September 1987, 20 pp.
Kay, M.C. and R.B. Emlet. 2002. Laboratory spawning, larval
development, and metamorphosis of the limpets Lottia
digitalis and Lottia asmi (Patellogastropoda, Lottiidae).
Invertebrate Biology 121: 11-24.
Laborel-Deguen, F. and ]. Laborel. 1991. Statut de Patella
ferruginea Grnelin en Mediterranee. In: Boudouresque,
C.F., M. Avon and V. Gravez (Eds.). Les Especes marines
a proteger en Mediterranee. GIS Posidonie Publishers,
Marseille, pp. 91-103.
Ramos, M.A. 1998. Implementing the Habitats Directive for
mollusc species in Spain. Journal of Conchology Special
Publication 2: 125-132.
Templado, J. 2001. Patella ferruginea (Grnelin, 1791). In:
Ramos, M.A., D. Bragado and J. Fernandez (Eds.). Los
invertebrados no insectos de la Directiva Habitats en
Espana. Ediciones Serie Tecniea, Organismo Autonomo
Parques Nacionales, Direction General de Conservation
de la Naturaleza, Ministerio de Medio Ambiente, Madrid,
pp. 41—49.
Van Den Biggelaar, J. A. M. 1977. Development of dorsoventral
polarity and mesentoblast determination in Patella
vulgata. Journal of Morphology 154: 157-186.
Wanninger, A., B. Ruthensteiner, S. Lobenwein, W. Salvenmoser,
W. Dictus, and G. Haszprunar. 1999. Development of
the musculature in the limpet Patella (Mollusca, Patello-
gastropoda). Development, Genes and Evolution 209:
226-238.
Wanninger, A., B. Ruthensteiner, and G. Haszprunar. 2000.
Torsion in Patella caerulea (Mollusca, Patellogastropoda):
ontogenetic process, timing, and mechanisms. Inverte-
brate Biology 1 19: 177-187.
THE 2010 R. T. ABBOTT VISITING CURATORSHIP
The Bailey- Matthews Shell Museum is pleased to invite applications for the 2010 R. T. Abbott Visiting Curatorship.
The Curatorship, established originally in accordance with the wishes of the late Dr. R. Tucker Abbott, Founding Director of the
Shell Museum, is awarded annually to enable malacologists to visit the museum for a period of one week. Abbott Fellows are
expected, by performing collection-based research, to assist with the eviration of portions of the Museum’s collection and to provide
one evening talk for the general public. The Museum collection consists of marine, freshwater, and terrestrial specimens. A large
percentage of our holdings have been catalogued through a computerized database management system; part of the catalogue is
already available for searches online at: www.shellmuseum.org/collection.html. A substantial portion of the time will be available for
research in the collection, but field work in southwest Florida can be arranged. The R. T. Abbott Visiting Curatorship is accompanied
by a stipend of $1,500.
Interested malacologists are invited to send a copy of their curriculum vitae, a letter detailing their areas of taxonomic expertise and
research objectives, and to provide a tentative subject for their talk. Send materials to:
Dr. Jose H. Leal, Director
The Bailey- Matthews Shell Museum
P.O. Box 1580
Sanibel, FL 33957
[email protected]
Applications for the 2010 Visiting Curatorship should be sent electronically to the above e-mail address no later than May 15, 2010, or
postmarked by that date if sent by regular mail. The award will be announced by mid-June 2010. Questions about the Visiting
Curatorship should be sent to the e-mail address above, or by phone at:
(239) 395-2233; fax (239) 395-6706
INSTRUCTIONS TO AUTHORS
THE NAUTILUS publishes articles on all aspects of the
biology, paleontology, and systematics of mollusks.
Manuscripts describing original, unpublished research
and review articles wall be considered. Brief articles, not
exceeding 1000 words, will be published as notes and do
not require an abstract. Notices of interest to the mala-
cological community will appear in a notices section.
Manuscripts: Each original manuscript and accompa-
nying illustrations should be submitted to the editor pref-
erably via e-mail or as hardcopy in triplicate.
Text must conform to the dimensions of 8 A x 11-inch
paper, double-spaced, and single-column throughout (in-
cluding literature cited, tables, and figure captions). Au-
thors should follow the general recommendations of Sci-
entific Style and Format — The CSE Manual for Authors,
Editors, and Publishers, available from the Council of
Science Editors at www.councilscienceeditors.org. The
first mention of a scientific name in the text should be
accompanied by the taxonomic authority, including year.
Latinized names and other words to be printed in italics
must be underlined; leave other formatting indications to
the editor. Metric, not English, units are to be used. Geo-
chronologic modifiers should be capitalized only when
units are formally recognized: for instance, use Late Cre-
taceous but early Miocene. Likewise, only modifiers of
formally recognized chronostratigraphic units are capi-
talized: use Lower Jurassic but upper Oligocene.
The sequence of sections should be title page, ab-
stract, introduction, materials and methods, results, dis-
cussion, acknowledgments, literature cited, tables, figure
captions, figures. The title page should include the title,
authors name(s) and address(es). If corresponding au-
thor is not the senior author, please indicate. The ab-
stract should summarize in 250 words or less the scope,
main results, and conclusions of the article. Abstracts
should be followed by a list of additional key words. All
references cited in the text must appear in the Literature
Cited section and vice-versa. Please follow a recent issue
of THE NAUTILUS for bibliographic style, noting that
journal titles must be unabbreviated. Information on
plates and figures should be cited only if not included
within the pagination of cited work. Tables must be num-
bered and each placed on a separate page. If in doubt,
please follow a recent issue of the journal for sequence of
sections and other style requirements.
Illustrations: Illustrations are rendered either at full-
page width (maximum width 17 cm) or column width
(maximum width 8.2 cm). Please take these dimensions
into consideration when preparing illustrations. Page-
width illustrations ideally should span the entire width of
printed page (17 cm). “Tall” page-width illustrations
should be avoided, square or “landscape” formats work
better. Please design [dates accordingly, such that there
will be enough space left at the bottom of printed page
for plate caption. (Digital technolog)' has made this task-
much easier.)
All line drawings must be in black, clearly detailed,
and completely labeled. Abbreviation definitions must be
included in the caption. Line drawings must be high
resolution files at at least 600 dpi (dots per inch) resolution
at actual size. Standard digital formats for line drawings
include .tif, .bmp, .psd, .eps, and .pdf.
Photographs may be submitted in black-and-white or
color, preferably in RGB mode if in color. Standard digi-
tal formats for photographs include .tif, .psd, .jpg, or .pdf.
Photographs must be high resolution files at least 300 dpi
resolution at actual size.
If more than one figure is included in an illustration,
all figures are to be consecutively numbered (Figures 1,
2, 3, ... , NOT Figures 1A, lB.'lC, . . . , NOR Plate 1,
Figure 1, • . .). In illustrations with more than one figure,
make sure that blank areas between figures is kept to a
minimum, thereby allowing for more area for each indi-
vidual figure.
Compressed files (e.g., .jpg) may be used to facilitate
transmission of files during original submission, but may
not be acceptable at final submission (see below).
Voucher Specimens: Deposition of the holotype in a
recognized institutional, public collection is a require-
ment for publication of articles in which new species-
level taxa are described. Deposition of paratypes in in-
stitutional collections is strongly encouraged, as is the
deposition of representative voucher specimens for all
other types of research work.
The Editorial Process: Upon receipt, all manuscripts are
assigned a number and acknowledged. The editor reserves
the right to return manuscripts that are substandard or
not appropriate in scope for THE NAUTILUS. Manu-
scripts deemed appropriate for the journal will be sent
for critical review to at least two reviewers. The review-
ers’ recommendations will serve as basis for rejection or
continuation of the editorial process. Reviewed manu-
scripts will be sent back to authors for consideration of
the reviewers’ comments. The revised version of the
manuscript may at this point be considered accepted for
publication by the journal.
Final Submission: Authors of accepted manuscripts are
required to submit a final version via e-mail to the editor
at [email protected]. Please do not send low-resolu-
tion or compressed illustration files at this stage. Send any
files larger than 20 Mb on a CD or DVD to the editor.
Proofs: After typesetting, proofs will be sent to the au-
thor. Author should read proofs carefully and send cor-
rections to the editor within 48 hours. Changes other than
typesetting errors will be charged to the author at cost.
Offprints: Ai order form for offprints will accompany
the proofs. Offprints will be ordered through the editor.
Authors with institutional, grant, or other research sup-
port wall be asked to pay for page charges at the rate of
$60 per page.
0 This paper meets the requirements of ANSI/NISO Z39. 48-1 992 (Permanence of Paper)
THE NAUTILUS
<£L-
4 Cl
.h'Si 4
XN'i'Z-
Volume 124, Number 2
July 7, 2010
ISSN 0028-1344
A quarterly devoted
to malacology.
EDITOR-IN-CHIEF
Dr. Jose H. Leal
The Bailey-Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
BUSINESS MANAGER
Mary Jo Bunnell
The Bailey-Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
EDITOR EMERITUS
Dr. M. G. Harasewych
Department of Invertebrate Zoolog)7
National Museum of
Natural History
Smithsonian Institution
Washington, DC 20560
CONSULTING EDITORS
Dr. Rudiger Bieler
Department of Invertebrates
Field Museum of
Natural History
Chicago, IL 60605
Dr. Arthur E. Bogan
North Carolina State Museum of
Natural Sciences
Raleigh, NC 27626
Dr. Philippe Bouchet
Laboratoire de Biologie des
Invertebres Marins et Malacologie
Museum National d’Histoire Naturelle
55, rue Buffon
Paris, 75005 France
Dr. Robert H. Cowie
Center for Conservation Research
and Training
University of Hawaii
3050 Maile Way, Gilmore 409
Honolulu, HI 96822
Dr. Robert T. Dillon, Jr.
Department of Biology
College of Charleston
Charleston, SC 29424
Dr. Eileen H. Jokinen
8234 E. North Shore Road
Sault Ste. Marie, MI 49783
Dr. Douglas S. Jones
Florida Museum of Natural History
University of Florida
Gainesville, FL 32611-2035
Dr. Harry G. Lee
4132 Ortega Forest Drive
Jacksonville, FL 32210
Dr. Charles Lydeard
Biodiversity and Systematics
Department of Biological Sciences
University of Alabama
Tuscaloosa, AL 35487
Bruce A. Marshall
Museum of New Zealand
Te Papa Tongarewa
P.O. Box 467
Wellington, NEW ZEALAND
Dr. fames H. McLean
Department of Malacology
Natural History Museum
of Los Angeles Count)'
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Paula M. Mikkelsen
Paleontological Research
Institution
1 259 Trumansburg Road
Ithaca, NY 14850
Dr. Diarmaid 6 Foighil
Museum of Zoology and Department
of Biology
University of Michigan
Ann Arbor, MI 48109-1079
Dr. Gustav Paulay
Florida Museum of Natural Histoiy
University of Florida
Gainesville, FL 32611-2035
Mr. Richard E. Petit
P.O. Box 30
North Myrtle Beach, SC 29582
Dr. Gaiy Rosenberg
Department of Mollusks
The Academy of Natural Sciences
1900 Benjamin Franklin Parkway
Philadelphia, PA 19103
Dr. Angel Valdes
Department of Malacology'
Natural History Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Geerat J. Vermeij
Department of Geology
University of California at Davis
Davis, CA 95616
Dr. G. Thomas Watters
Aquatic Ecology Laboratory
1314 Kinnear Road
Columbus, OH 43212-1194
SUBSCRIPTION INFORMATION
The subscription rate for volume
124 (2010) is US $54.00 for
individuals, US $88.00 lor
institutions. Postage outside the
United States is an additional US
$10.00 for regular mail and US
$28.00 for air delivery. All orders
should be accompanied by payment
and sent to: THE NAUTILUS, P.O.
Box 1580, Sanibel, FL 33957, USA,
(239) 395-2233.
Change of address: Please inform
the publisher of your new address at
least 6 weeks in advance. All
communications should include both
old and new addresses (with zip
codes) and state the effective date.
THE NAUTILUS (ISSN 0028-1344)
is published quarterly by The Bailey-
Matthews Shell Museum, 3075
Sanibel-Captiva Road, Sanibel, FL
33975.
Periodicals postage paid at Sanibel,
FL, and additional mailing offices.
POSTMASTER: Send address
changes to: THE NAUTILUS
P.O. Box 1580
Sanibel, FL 33957
THE0NAUTILUS
CONTENTS
Volume 124, Number 2
July 7, 2010
ISSN 0028-1344
Paul Valentich-Scott
Carol Skoglund
Jess VV. Jones
Richard J. Neves
Axel Alf
Philippe Maestrati
Philippe Bouchet
B.L. Bodamer
M.L. Ostrofsky
Claude Vilvens
Javier Sellanes
Roland Houart
Robert Moffitt
A review of the Recent Pandoridae (Bivalvia) in the Panamic Province, with
descriptions of three new species 55
Descriptions of a new species and a new subspecies of freshwater mussels,
Epioblasma ahlstedti and Epioblasma florentina aureola (Bivalvia: Unionidae),
in the Tennessee River drainage, USA 77
New species of Bolma (Gastropoda: Vetigastropoda: Turbinidae) from
the tropical deep sea 93
The use of aquatic plants by populations of the zebra mussel ( Dreissena
polymorpha ) (Bivalvia: Dreissenidae) in a small glacial lake 100
Description of Calliostorna ceciliae new species (Gastropoda: Chilodontidae:
Calliotropinae) from off Chile 107
Anew Scabrotrophon (Gastropoda: Muricidae) from Hawaii and discussion
about the generic classification ol Boreotrophon kamchatkanus Dali, 1902,
a related species 112
THE NAUTILUS 124(2):55-76, 2010
Page 55
A review of the Recent Pandoridae (Bivalvia) in the Panamic
Province, with descriptions of three new species
Paul Valentich-Scott
Carol Skoglund
Santa Barbara Museum of Natural History
2559 Puesta del Sol Road
Santa Barbara, CA 93105 USA
[email protected]
[email protected]
ABSTRACT
Six genera and 16 species of Panamic Pandoridae are described
and illustrated. Three species are described as new, namely
Pandora ( Pandora ) rachaelae , Pandora ( Pandorella ) sarahae,
and Clidiophora dorsorectus , and one new genus, Coania.
Diagnoses are provided for the genera, subgenera, and species,
as well as illustrations of the type specimens of the nominate
species. Frenanuja , Clidiophora , Heteroclidus, and Foveadens
are herein elevated to generic rank. The high diversity of
Pandoridae in the tropical Panamic Province is compared with
other tropical regions along with more temperate climes.
INTRODUCTION
The Greek myth of Pandora portrays her as the first
mortal woman, one of exceptional beauty. Pandora also
opened the forbidden box, releasing all the evils of
humankind. So it is with the members ol the biv; live
family Pandoridae, species of amazing beauty, but also
those with taxonomic confusion and peril. We herein
review the Pandoridae of the Panamic Province, accom-
panied by full descriptions, diagnostic characters between
genera and species, and provide photographs of types and
typical specimens.
The functional morphology of the Atlantic Pandora
inaequivalvis (Linnaeus, 1758) and P. pinna (Montagu,
1803) was detailed by Allen (1954). The biology and
functional morphology of the Pacific P. filosa was exam-
ined by Thomas (1994). Through experimental studies,
Allen and Allen (1955) postulated that the primary life
position of P. inaequivalvis is with the curved side down,
but the species is capable of surviving in almost any
orientation for considerable periods. However, Allen
and Allen also noted that specimens buried more than
2 cm below the sediment surface had a low rate ol sur-
vival, which likely limits the distribution ol most Pandora
to low energy habitats. Additional pandorid functional
morphology was elucidated by Yonge and Morton
(1980) and Morton (1984), with particular emphasis on
the ligament and lithodesma. The functional morphology
and natural history of all Panamic Pandoridae remains
undocumented.
In their monograph ol the Western Atlantic Pandoridae,
Boss and Merrill (1965) presented the first modem review
of the family in the New World. Due to a paucity ol
literature at the time, they postulated that the family is
not diverse in the tropical regions, a hypothesis which will
be refuted by the data herein. Importantly, Boss and Mer-
rill provided detailed anatomical descriptions and precise
illustrations to accompany their shell moiphology descrip-
tions. Unfortunately, subsequent workers did not follow
the dentition and ligament nomenclature defined in this
important paper.
Boss (1965) included all known generic, subgeneric,
specific, and subspecific names in the Pandoridae. This
has provided a base for our current research, in particu-
lar with documenting generic and subgeneric names.
Panamic pandorids were first described by G.B.
Sowerby, I (1835), in his review of new species collected
by Cuming in South America. Carpenter (1856, 1865)
described additional species from Mexico, and Dali
(1915) added more species from Mexico and Panama.
Keen (1958) presented the first complete accounting ol
the Panamic pandorids, including diagnoses ol Pandora
subgenera and illustrations ol several type specimens, and
slightly revised this treatment thirteen years later (Keen,
1971). Olsson (1961) provided keys to the southern
Panamic Pandora subgenera and species, and extended
the geographic distribution of several species.
Thus, with the seemingly ardent work by the authors
above, we were perplexed to have great difficulty iden-
tifying common pandorid species in the Panamic Prov-
ince. When examining museum and private collections
we found that the identifications were almost random,
with little continuity between identifications, sometimes
even within a single collection. Upon examination ol the
type specimens ol the Panamic species, we further
noted that most of the species in collections were incor-
rectly identified. It was with this backdrop that we
Page 56
THE NAUTILUS, Vol. 124, No. 2
developed the diagnoses below, with a goal of providing
useful tools to identify this difficult and plastic group of
bivalves.
Abbreviations and Text Conventions: Each valid
taxon is followed by a synonymy, a description, distribu-
tion and habitat data, information on tvpe specimens and
type locality, and additional remarks about the taxon.
Distribution information is based on Recent specimens
we have examined, unless otherwise noted. We have not
examined any fossil material. Sadly, no wet preserved
specimens were located during this study, thus we did
not describe the anatomy of the species covered below.
All references to valve convexity and concavity refer to
the external Hew the specimens.
Abbreviations used in the text are as follows: BMNH -
The Natural Histoiy Museum, London, United King-
dom; CAS - California Academy of Sciences, San
Francisco, California, USA; LACM - Natural History
Museum of Los Angeles County, Los Angeles, Califor-
nia, USA; MCZ - Museum of Comparative Zoology,
Harvard University, Cambridge, Massachusetts, USA;
PRI - Paleontological Research Institution, Ithaca, New
York, USA: SBMNH - Santa Barbara Museum of Natu-
ral Histoiy, Santa Barbara, California, USA; UMiVIL -
University of Miami Marine Laboratory, Rosenstiel
School of Marine and Atmospheric Science, Miami,
Florida, USA; USNM - National Museum of Natural
History, Smithsonian Institution, Washington DC, USA.
SYSTEM ATICS
Pandoridae Rafinesque, 1815
Diagnostic characters between genera and subgenera
are given in Table 1, and species-level characters are
given in Table 2.
Genus Pandora Bruguiere, 1797
Pandora Bruguiere, 1797. Type species (SD Children,
1823): Pandora rostrata Lamarck, 1818, = Salem
inaequivalvis Linnaeus, 1758. Recent, Mediterranean.
Description: Shell strongly inequilateral, posterior
end longer; right valve flat to concave; left valve flat to
convex; hinge plate vestigial to well developed, with
weak to strong cardinal teeth bordering resilifer;
lithodesma usually present; sculpture of irregular
commarginal striae or ribs, some with radial ribs or
grooves; interior nacreous. Siphons short.
Distribution: The genus is cosmopolitan in distribu-
tion, found from intertidal to abyssal depths.
Remarks: Considered by Boss and Merrill (1965) to
be primarily a cold-water genus, the findings in this
paper indicate a high tropical diversity. It is likely other
tropical regions have a much higher diversity than cur-
rently reported.
Subgenus Pandora sensu stricto
Hinge of left valve narrow, gready reduced, anterior car-
dinal tooth a small tubercle or broadly flattened, posterior
cardinal tooth absent to reduced. Right valve with small to
moderate anterior cardinal tooth, posterior tooth short to
moderately long. Exterior sculpture of commarginal striae
or ribs, some wit 1 1 very faint radial striae.
Pandora ( Pandora ) brevifrons G.B. Sowerby I, 1835
(Figure 1)
Pandora brevifrons G.B. Sowerby I, 1835: 93.
Description: Shell Shape: Ellipsoid-elongate; very
inequivalve, left valve veiy inflated, right valve very con-
cave; entire shell strongly twisted dorsoventrally; anterior
end short; anterodorsal margin straight; posterior end
attenuate, without discrete rostrum; ventral margin of left
valve broadly rounded, slightly straighter mid-ventrally.
Sculpture and Color: Anterior end of left valve not set
off by a change in sculpture or color; left valve with 2 low
radial ribs extending from beaks to posterior margin,
commarginal striae over entire valve; right valve sculp-
ture of fine commarginal striae, with long, deep, furrow
along posterodorsal margin.
Hinge: Left valve with anterior tubercle, and an elon-
gate, oblique resilifer; right valve with two short, sub-
equal cardinal teeth; lithodesma unknown.
Muscle Scars: adductor muscle scars subequal,
subcircular.
Length: to 22 mm [BMNH].
Distribution: Currently only known from the type
locality at Bahia Panama, Panama (9.0°N) [BMNH].
Type Material: BMNII 1966572, 3 syn types - paired
valves.
Type Locality: Panama, 18 m (originally 10 fathoms),
sandy bottom.
Remarks: Records from the region around San Felipe,
Baja California, Mexico (Gemmell et ah, 1987; Dushane
and Brennan, 1969) are Pandora sarahae new species.
In spite of intensive collecting in Panama, this species
has not been found since its description in 1835. It is
possible that the type is mislocalized. However, study of
specimens from adjacent and far reaching provinces has
also not yielded any material of this species.
Literature: Keen (1971: 287), Olsson (1961: 454).
Pandora (Pandora) rachaelae new species
(Figures 2-4)
Description: Shell Shape: Ovate-elongate; inequivalve,
left valve slightly inflated, right valve flat; posterodorsal
margin of light valve overlapping left, ventral margin of left
valve overlapping right; entire shell not twisted to slightly
twisted; anterior end short; anterodorsal margin slightly
recurved; posterior end broadly rounded, with wide, short,
truncate rostrum; ventral margin broadly rounded, with
P. Valentich- Scott and C. Skoglund, 2010
Page 57
Table 1. Generic and subgeneric characteristics of the Pandoridae in the Panamic Province.
Genus
(Subgenus)
Sculpture of
valves
Left hinge
Pandora
( Pandora )
right valve
commarginal only
Right hinge
Pandora right valve with
( Pandorella ) radial grooves
anterior tooth, ends anterior of
adductor scar
Clidiophora
right valve
commarginal only
anterior tooth, ends anterior of
adductor scar
Foveadens
right valve
commarginal only
right valve with
radial grooves;
left valve with
radial ribs
Coania
(Continued)
Taxa
Shell Shape
Left Valve Dentition
Right Valve Dentition
Clidiophora
cornuta
Frenamya
radians
Clidiophora
claviculata
Clidiophora
dorsorectus
Foveadens
panamensis
Coania rhypis
Heteroclidus
punctata
Page 60
THE NAUTILUS, Vol. 124, No. 2
Figures 1-4. 1. Pandora brevifrons, syntype, BMNH 1966572, Panama, sandy bottom, 18 m; length = 22 mm. 2-4. Pandora
rachaelae new species, 2. Holotype, SBMNH 347835, Mexico, Baja California Sur, off Cabo Pulmo, 23°26'00" N, 109°25/21" W, 13-
17 m; length = 13.9 mm. 3—4. Paratypes, SBMNH 84939, same locality as holotype; 3. Length = 14.5 mm, 4. Length = 14.2 mm.
shallow indentation approximately one-third of total length
from anterior end.
Sculpture and Color: Left valve sculpture of
commarginal striae and irregular, low commarginal
undulations; left valve with one low radial rib extending
from beaks to posterior margin, in some top of rib
with granules or nodes; in most, anterior end of left
valve demarcated by change in color, without sulcus;
right valve sculpture of commarginal striae, with wide
commarginal undulations in some, long furrow along
posterodorsal margin weak to absent.
Hinge: Left valve with anterior tubercle, and a short
obique resilifer; right valve with two cardinal teeth; anterior
tooth short, curved in some, not reaching posterior end of
anterior adductor muscle scar; posterior toodi, thin, elon-
gate, paralleling dorsal margin; lithodesma thin, narrow.
Muscle Scars: Both adductor muscle scars subcircular.
Length: To 14 mm [SBMNII].
Distribution: Los Frailes, Baja California Sur
(23.4°N) [SBMNH], to San Felipe, Baja California
(31.0° N) [SBMNH], to Puerto Huatulco, Oaxaca
(15.8° N) [CAS], Mexico; also at Isla Socorro, Islas Revil-
lagigedo, Colima, Mexico (18.8° N) [CAS]; intertidal
zone to 60 m, sand [SBMNH].
Type Material: Holotype SBMNH 347835, length =
13.88 mm, height = 6.18 mm, coll, by Carl and Laura Shy,
January 1969. Paratypes: SBMNH 84939, same locality as
P. Valentich- Scott and C. Skoglund, 2010
Page 61
holotype, 3 pairs; USNM 1132899, same locality as holo-
type, 1 pair. Additional paratypes: CAS 181543, 6 pairs,
Mexico, Colima, Islas Revillagigedo, Isla Socorro, 20 m.
Type Locality: Mexico, Baja California Sur, off Cabo
Pulmo, 23°26'00" N, 109°25'21" W, 14-18 m (originally
7-9 fathoms).
Etymology: Named in honor of the senior author’s
oldest daughter, Rachael Gwinn, in thanks for her con-
tinual support and positive attitude.
Comparisons: This species has a more compressed
left valve than P. brevifrons, has a more ventrally sloping
anterodorsal margin, and has a broader, more tubercular
anterior cardinal tooth.
Literature and Additional Records: Not seen in
previous literature. This species has frequently been
misidentified in museum and private collections as
Pandora brevifrons or P. gramdata. SBMNH has 13
additional lots.
Pandora ( Pandora ) uncifera Pilsbry and Lowe, 1932
(Figure 5)
Pandora uncifera Pilsbry and Lowe, 1932: 104.
Description: Shell Shape: Ellipsoid-elongate; equi-
valve, both valves compressed, flat; anterior end short;
anterodorsal margin curved ventrally in a distinctive
hook; posterior end attenuate, with wide, moderately
long, truncate rostrum; ventral margin broadly rounded
to straight, except for broad, shallow indentation approx-
imately one-third of length from anterior end.
Sculpture and Color: Anterior end of left valve demar-
cated by change in color, without sulcus, commarginal
striae and undulations over entire surface, more sub-
dued anteriorly; left valve with one very low, broad
radial rib extending from beaks to posteroventral mar-
gin; right valve sculpture of wide commarginal undula-
tions, broad region on posterodorsal margin with vertical
striations.
Hinge: Left valve with two cardinal teeth, anterior tooth
moderately short, posterior tooth elongate, paralleling
dorsal margin; right valve with two weak cardinal teeth,
anterior tooth narrow, moderately short, posterior tooth
elongate, narrow, resilifer narrow, oblique; lithodesma
moderately thick, narrow.
Muscle Scars: Both adductor muscle scars subcircular
to subovate.
Length: To 13 mm [SBVINII],
Distribution: Bahia de las Palmas, Baja California Sur
(23.7°N), north to Bahia San Luis Gonzaga, Baja Califor-
nia (29.8°N) [SDNHM, CAS], and Cabo Tepoca, Sonora
(30.3°N) [SBMNH], Mexico, to Manta, Manabi, Ecua-
dor (0.9°S) [PRI]; 5-66 m [SBMNH],
Type Material: Holotype ANSP 155632.
Type Locality: Acapulco, Guerrero, Mexico, 37 m
(originally 20 fathoms).
Literature: Gemmell et al. (1987: 61-62), Hertlein
and Strong (1946: 97), Keen (1971: 287), Olsson (1961:
454), Pilsbry and Lowe (1932: 104-105).
Subgenus Pandorella Conrad, 1863
Pandorella Conrad, 1863. Type species (M): Pandora
arenosa Conrad, 1834. Miocene, Virginia.
Kennerlia Carpenter, 1864. Type species (SD Stoliczka,
1870): Pandora(Kennerlia) bicarinata Carpenter, 1864,
= P. bilirata Conrad, 1855. Recent, California. Kennerleijia ,
Kennerlijia, Kenerlyia, Kenerleyia, of authors, unintentional
alterations of an established name.
Description: Hinge of left valve greatly reduced, ante-
rior cardinal tooth a small tubercle or broadly flattened,
posterior cardinal tooth absent to reduced. Right valve
with two cardinal teeth; anterior small to moderate; pos-
terior short to moderately long. Lithodesma present.
External sculpture of right valve with radial grooves
or ribs.
Remarks: Tl ae dentition ol this subgenus is very
similar to that of Pandora s.s. The prime distinguishing
character of Pandorella is the presence of radial ribs or
grooves in the right valve.
Other eastern Pacific Ocean species in this subgenus
include Pandora (Pandorella) bilirata Conrad, 1855,
P. (P) filosa (Carpenter, 1864), P. ( P. ) glacialis Leach,
1819, and P. ( P. ) wardiana A. Adams, 1860.
Pandora (Pandorella) gramdata Dali, 1915
(Figure 6)
Pandora gramdata Dali. 1915: 449.
Description: Shell Shape: Subquadrate to subovate;
inequivalve, left valve moderately inflated, right valve
flat to concave; anterodorsal margin straight; anterior
end produced, sharply rounded; posterior end only
slightly attenuate, some with very broad, short, sub-
truncate rostrum; posterodorsal margin straight; right
valve overlapping left along posterodorsal margin; ven-
tral margin broadly rounded, with shallow indentation.
Sculpture and Color: Anterior end ol left valve
demarcated by change in sculpture, without sulcus,
with a few commarginal undulations on anterior end,
central and posterior slopes with commarginal striae
only; left valve with two sharp, narrow, radial ribs
extending from beaks to posterior margin, with strong
commarginal ribs overlying radials forming nodes,
granules or scales on some; right valve sculpture of
veiy fine commarginal striae, with few to many
(1-10) fine radial grooves that are less prominent or
numerous in juveniles.
Hinge: Left valve with one short, obscure anterior cardi-
nal tooth; right valve with two cardinal teeth; anterior
Page 62
THE NAUTILUS, Vol. 124, No. 2
Figures 5-6. 5. Pandora uncifera, SBMNH 347838, Mexico, Baja California Sur, off Cabo Pulmo, 23°26'00" N, 109°25'21" W,
1.3-17 m; length = 13 mm. 6. Pandora granulata , syntype, USNM 211348, Mexico, Baja California Sur, off La Paz, 24° 18' N, 110°22' W,
48 m; length = 7.2 mm.
short, stout; posterior thin, elongate, paralleling dorsal
margin; some right valves with additional internal rib,
near end of posterior cardinal, paralleling dorsal margin;
ligament narrow, short, oblique; lithodesma broad, stout,
short.
Muscle Scars: Anterior adductor muscle scar ovate-
elongate, posterior scar subcircular.
Length: To 10 mm [SBMNH],
Distribution: La Paz, Baja California Sur (24.2° N)
[USNM], into the Golfo de California as far north as
Puerto Libertad, Sonora (29.9°N) [SBMNH], to
Teacapan, Sinaloa (22.2°N) [SBMNH], Mexico; 15-80
m [LACM, SBMNH], in sand and mud [SBMNII].
Type Material: USNM 211348, syntypes, about 100
open valves, about 12 closed pairs.
Type Locality: Off La Paz, Baja California Sur, Mex-
ico, 24° 18' N, 1 10° 22' W, 48 m (originally 26.5 fathoms),
broken shell bottom (Albatross 2823).
Remarks: Synonymized in error by Valentich-Scott
(1998) and Coan et al (2000). Pandora bilirata Conrad,
1855, has more prominent radial grooves on the exterior
of the right valve and does not have granulations on the
radial ribs of the left valve.
Literature: Keen (1971 : 289).
Pandora ( Pandorella ) radiata G.B. Sowerby, 1835
(Figure 7)
Pandora radiata G.B. Sowerby I, 1835: 94; P. (. Kennerlia )
bicarinata Carpenter, 1864: 638; 1865: 603; P. (. Kennerlyia )
convexa Dali, 1915: 449.
Description: Shell Shape: Subovate; left valve mod-
erately to highly inflated, right valve flat to very concave,
deeply fitting inside left valve; anterodorsal margin with
nearly straight slope, slightly upturned on end; posterior
end broadly subtruncate, with short broad rostrum in
some specimens; posterodorsal margin straight; right
valve moderately overlapping left along posterodorsal
P. Valentich-Scott and C. Skoglund, 2010
Page 63
margin; ventral margin broadly rounded, with shallow to
significant indentation towards anterior end.
Sculpture and Color: Anterior end of left valve demar-
cated by shallow sulcus, entire surface of irregular
commarginal striae, some with low, broad, obscure radial
ribs; left valve with one narrow radial rib extending from
beaks to posterior margin, frequently eroded in larger
specimens, some specimens with faint dorsal rib; right
valve sculpture of very fine commarginal striae, and
strong, widely spaced radial grooves.
Hinge: Left valve with one long, obscure anterior cardi-
nal tooth, in some hinge plate depressed anterior of
tooth; right valve with two cardinal teeth; anterior tooth
short, stout; posterior tooth thin, elongate, wider ven-
trally; ligament narrow, moderately short, oblique;
lithodesma broad, thick.
Muscle Scars: Both adductor muscle scars subequal,
subcircular.
Length: To 31 mm [USNM],
Distribution: Catalina Island, Los Angeles County,
California (33.5°N) [USNM], into the Golfo de Cali-
fornia as far north as Isla Smith, Baja California
(29.1°N) [SBMNH] and Cabo Lobos, Sonora (29.9°N)
[SBMNH], Mexico, to Zorritos, Tumbes, Peru (3.5°S)
[SBMNH]; 20-170 m [SBMNH],
Type Material: Pandora radiata : BMNH 1964469,
holotype, one pair; Pandora bicarinata : USNM 592440,
1 pair mounted on glass slide; Catalina Island, California.
Pandora convexa : USNM 171068, syn types, 2 pairs; oil
lower California, Ballenas, Mexico [Puerto Abreojos,
Baja California Sur], 10 m (originally 5.5 fathoms),
Albatross 2835, 26°42'30"N, 113°34,15"W.
Type Locality: Insularum Muerte, Columbiae
Occidentalis [Isla del Muerto, Guayas, Ecuador],
Remarks: The relationship with Pandora bilirata
Conrad, 1855, should be examined more thoroughly,
preferably with molecular data. It is possible that this
northern species is a junior synonym of P. radians.
Literature: Hertlein and Strong (1946b: 97-98, as
P. convexa ), Keen (1971: 289-291).
Pandora ( Pandorella ) sarahae new species
(Figure 8)
Pandora brevifrons G.B. Sowerby I, of authors , not
G.B. Sowerby I, 1835
Description: Shell Shape: Ellipsoid-elongate; veiy
inequivalve, left valve veiy inflated, right valve veiy
concave; entire shell slightly to moderately twisted
dorsoventrally; anterior end short; anterodorsal margin
slightly recurved in most; posterior end attenuate, with
short, subtruncate rostrum; ventral margin ol left valve
straight to slightly rounded, broadly curved along
anteroventral and posteroventral margins.
Sculpture and Color: Anterior end of left valve set off by
a change in sculpture, with commarginal striae anterior of
beaks, and fine commarginal ribs posterior of beaks,
extending over posterior end, with fine sulcus demarcat-
ing the two regions; left valve with one moderate radial
rib extending from beaks to posterior margin, with heavy
commarginal ribs extending across it to the dorsal margin;
right valve sculpture of fine commarginal striae, with long,
deep, wide furrow along posterodorsal margin, larger spec-
imens with irregular radial grooves near ventral margin.
Hinge: Left valve with two teeth; anterior tooth low,
thickened tubercle; posterior tooth short, thin, extending
anterior of ligament; ligament long, oblique, with thin
groove or thickening posterior to it; lithodesma veiy thin,
narrow; right valve with two cardinal teeth; anterior
tooth stout, short, curved, not reaching posterior portion
of anterior adductor muscle scar; posterior tooth long,
thin, paralleling dorsal margin.
Muscle Scars: Anterior adductor muscle scar sub-
trigonal to subcircular, posterior subcircular.
Length: To 12 mm [SBMNH],
Distribution: Bahia Magdalena, Baja California Sur
(24.6°N) [SBMNH] and San Felipe, Baja California
(31.0°N) [SDNHM], Mexico; 2-10 m, sand [SDNHM,
SBMNH],
Type Material: Holotype SBMNH 84940, length =
12.04 mm, height = 5.09 mm. collected by Carol and
Paul Skoglund, October 1979. Paratypes, locality same
as holotype: SBMNPI 84941, 3 specimens; SBMNH,
2 specimens; CAS 181988, 1 specimen, length = 10.63
mm; USNM 1132897, 1 specimen, length = 11.13 mm;
Paratypes, SDNHM 90076, Mexico, Baja California, San
Felipe, 10 specimens.
Type Locality: Mexico, Baja California Sur, Balria
Magdalena, Puerto San Carlos, 24°48'7.60" N,
1 12°7' 17.61" W, 2-10 m, in sand.
Etymology: Named in honor of the senior author’s
youngest daughter, Sarah Gwinn, who has a keen biolog-
ical spirit, and a twisted sense of humor.
Comparisons: No other Panamie pandorid has the
strong lateral twisting found in P. sarahae. In comparison
to P. granulata , P. sarahae has a narrower, more produced,
anterior end, and fewer radial grooves on the exterior of
the right valve. Pandora radiata is much wider dorsoven-
trally than either of the two aforementioned species, and
lias more, deeper radial grooves in the right valve. Pan-
dora rachaelae is not twisted, and most specimens are
compressed.
Literature: Gemmell et al. (1987: 6 1 , as P. brevifrons).
Genus Frenamya Iredale, 1930
Frenamya Iredale, 1930. Type species (OD): Coelodon
patulus Tate, 1889. Recent, Australia.
Page 64
THE NAUTILUS, Vol. 124, No. 2
Figures 7-8. 7. Pandora radiata , holotype, BMNH 1964469, Ecuador, Guayas, Isla del Muerto; length 13 mm. 8. Pandora
sarahae , holotype SBMNH 84940, Mexico, Baja California Sur, Bahia Magdalena, Puerto San Carlos, 24°48,7.60"N, 112° 7/17.61,/
W, 2-10 m, sand; length = 12 mm.
Coelodon Carpenter, 1865, non Audinet-Serville, 1832.
Type species (SD Stoliczka, 1871): Pandora ceylanica
G.B. Sowerby I, 1835. Recent, Ceylon.
Description: Shell strongly inequilateral, posterior
end longer; right valve flat to concave; left valve flat to
convex. Hinge of left valve with strong, moderate to long
anterior cardinal tooth. Right valve with 3 cardinal teeth,
the central cardinal strong, elongate to diamond shaped.
Lithodesma absent. External sculpture of eommarginal
striae or ribs only.
Frenamya arcuata (G.B. Sowerby I, 1835)
(Figures 9-15)
Pandora arcuata G.B. Sowerby I, 1835: 93.
Description: Shell Shape: Ham-shaped; left valve
moderately inflated, right valve flat to slightly concave,
not fitting inside left valve; anterior end relatively short;
anterodorsal margin with straight, strong trigonal serra-
tions in most large specimens; posterior end strongly
rostrate; posterodorsal margin moderately to very
strongly recurved, some more recurved posteriorly; right
valve overlapping left along posterodorsal margin, more
so near posterior end; ventral margin evenly rounded,
almost circular, without indentation.
Sculpture and Color: Anterior end of left valve demar-
cated by veiy slight change in color, with shallow sulcus
in some, eommarginal striae over entire surface, with
one or two veiy low eommarginal undulations in some;
P. Valentieh- Scott and C. Skoglund, 2010
Page 65
Figures 9-15. 9-14. Frenamya arcuata, syntypes, BMNH 1964467, Ecuador, Guayas, Santa Elena; 9, 13 length = 22 mm;
10 length = 27 mm; 11, 12 length — 25 mm. 15. Frenamya arcuata , SBMNH 119375, Mexico, Baja California Sur, Bahia Santa
Maria, 24°44'0" N, 112° 12' W, 15 fm; length 14 mm.
left valve with one low, broad radial rib extending from
beaks to posterior margin, with strong commarginal bars
crossing posteriorly; right valve sculpture of veiy fine
commarginal striae, with shallow posterodorsal groove,
and rib dorsal to it; right valve without change in color on
anterior end.
Hinge: Left valve with three cardinal teeth; anterior
tooth long, curved ventrally directed, widest near beaks,
ending at the top ot the anterior adductor scar; central
tooth very small, short, directly below beaks; posterior
tooth very thin, moderately long, paralleling dorsal
margin; without furrow posterior to ligament; ligament
moderately long, broad, oblique; right valve with three
cardinal teeth; anterior thin, long, curved, extending to
top of anterior end of muscle scar; central tooth moder-
ately short, very stout, diamond shaped, slightly bifid;
posterior thick, slightly granulate on top, moderately
elongate, paralleling dorsal margin, reaching only half
way to posterior adductor muscle scar.
Muscle Scars: Anterior adductor muscle scar
subcircular, posterior scar ovate-elongate, posterior scar
almost touching dorsal margin.
Length: To 26 mm [SBMNH], reported in literature to
40 mm [Keen, 1971], but no specimens ol this length
were found.
Distribution: In the Gulf of California as far north as
Bahia Santa Maria, Baja California Sur, Mexico (24.7° N)
[SBMNH], south to Maneora, Tumbes, Peru (4.1° S)
[UMML, CAS]; 15-30 m [SBMNH],
Type Material: BMNH 1964467/1-3, syntypes, 3 left
valves.
Type Locality: Ecuador, Guayas, Santa Elena.
Remarks: Unfortunately the type specimens of
F. arcuata are only left valves, which has led to
many misinterpretations of the species. We have found
it to be much less common than previously reported.
Page 66
THE NAUTILUS, Vol. 124, No. 2
Olsson (1961: Plate 81, figs, la-g) figured a number
of species as a single species, and Keen (1971) followed
this lead.
The record of F. arcuata in Keen (1971) from
Laguna Ojo de Liebre, on the Pacific side of Baja
California Sur, remains unverified. Specimens of this
species were not located from that locality at CAS,
which would be the likely repository for specimens that
Keen vouchered.
Literature: Carpenter (1865: 596-597), Hertlein and
Strong (1946: 98, as P. cristata), Hertz et al. (1985), Keen
(1971: 287), Olsson (1961: 456).
Frenamija cristata (Carpenter, 1865)
(Figure 16)
Clidiophora cristata Carpenter, 1865: 597
Description: Shell Shape: Subovate-elongate; both
valves compressed, twisted to right posteriorly; left
valve moderately convex, right valve slightly concave;
anterodorsal margin straight, sloping ventrally, some
with veiy weak serrations; posterior end attenuate, with
short, truncate, well-demarcated rostrum especially in
right valve; posterodorsal margin strongly arcuate; right
valve overlapping left along posterodorsal margin; ven-
tral margin broadly rounded, without indentation.
Sculpture and Color: Anterior third of left valve demar-
cated by change in color, without sulcus, commarginal
striae over anterior end; left valve with one heavy broad
to narrow radial rib extending from beaks to posterior
margin, with shallow groove ventral to it; right valve
sculpture ol very fine commarginal striae, and irregular
low commarginal undulations.
Hinge: Left valve with two cardinal teeth; anterior
elongate, narrow, anteroventrally directed towards
anterior end of anterior adductor muscle scar; posterior
tooth very thin, moderately short, adjacent to the dorsal
margin; right valve with three cardinal teeth; anterior
elongate, narrow; central tooth short, stout; posterior
tooth, elongate, narrow thin, not granulate on top,
paralleling dorsal margin; ligament moderately wide,
oblique, short; without furrow between ligament and
posterior tooth.
Muscle Scars: Adductor muscle scars subequal, anterior
subcircular, posterior ovate-elongate.
Length: To 24 mm [BMNH],
Distribution: Only known from the type locality in
the Golfo de California, Mexico (general type locality)
[BMNH], Records from Guatemala and El Sal-
vador reported by Hertlein and Strong (1946: 98)
remain unverified. Likely these were confused with
P. arcuata.
Type Material: Holotype BMNH 1963441, 1 pair.
Type Locality: Gull of California, Mexico.
Frenamija radians (Dali, 1915)
(Figures 17-19)
Pandora ( Coelodon ) radians Dali, 1915: 450; P. arcuata
G.B. Sowerby I, auctt. non G.B. Sowerby I, 1835.
Description: Shell Shape: Subovate-elongate; left
valve slightly to moderately inflated, l ight valve flat to
slightly concave, fitting inside left valve; anterior end
moderate to long; anterodorsal margin with straight to
broadly rounded, with strong trigonal serrations in large
specimens; posterior end attenuate, with narrow, moder-
ately long, truncate rostrum; posterodorsal margin
evenly recurved; right valve overlapping left along
posterodorsal margin; ventral margin broadly rounded,
without indentation.
Sculpture and Color: Anterior end of left valve demar-
cated by change in color, without strong sulcus,
commarginal striae over entire surface, some with a few
commarginal undulations; left valve with one veiy low,
veiy broad radial rib extending from beaks to posterior
margin; right valve sculpture of veiy fine commarginal
striae, with deep posterodorsal groove.
Hinge: Left valve with one long, thin to stout, ventrally
directed anterior cardinal tooth, widest near beaks, end-
ing at top of anterior adductor scar; long, narrow furrow
posterior to ligament; ligament narrow, oblique; right
valve with three cardinal teeth; anterior long, thin; cen-
tral tooth short, stout, diamond shaped; posterior thin to
thick, smooth to granulate on top, veiy elongate,
paralleling dorsal margin, not quite reaching posterior
adductor muscle scar.
Muscle Scars: Both adductor muscle scars nearly
circular, posterior scar moderately close to dorsal
margin .
Length: To 24 mm [SBMNH],
Distribution: Puerto Abreojos, Baja California Sur
(26.8° N) [USNM], and Bahia Jolotemba, Nayarit, Mex-
ico (21.4° N) [CAS, Kaiser Collection], to Zorritos,
Tumbes, Peru (3.5° S) [Olsson, 1961]; 4-300 m
[SBMNH, CAS], mud [SBMNH],
Type Specimens: USNM 171053, holotype, 1 open
pair; off lower California, Ballenas, Mexico [Puerto
Abreojos, Baja California Sur], 10 m (originally 5.5
fathoms), Albatross 2835, 26°42'30" N, 113034'15" W.
Literature: Dali (1915: 450-451), Keen (1971: 289),
Olsson (1961: plate 81, figure Id as P. arcuata).
Genus Clidiophora Carpenter, 1864
Clidiophora Carpenter, 1864. Type species (OD): Pan-
dora claviculata Carpenter, 1856. Recent, tropical east-
ern Pacific.
Description: Shell strongly inequilateral, posterior
end longer; right valve flat to concave; lelt valve flat
to convex. Hinge of left valve with veiy strong, long
P. Valentich-Scott and C. Skoglund, 2010
Page 67
Figures 16-19. 16. Frenamya cristata , holotype, BMNH 1963441, Mexico, Gulf of California [general locality]; length = 22.5 mm.
17. Frenamya radians , holotype, USNM 171053, Mexico, Baja California Sur, Puerto Abreojos, 26°42,30// N, llS^l'lS" W, 10 m;
lengtli = 15.5 mm. 18-19. Frenamya radians , SBMNH 360635, Mexico, Jalisco, Bahia Tenacatita, Caleta de Los Angeles, 6—20 m;
Figure 18, length = 20 mm; Figure 19, length = 24 mm.
Page 68
THE NAUTILUS, Vol. 124, No. 2
Figures 20-21. 20. Clidiophora claviculata , syntype, BMNH 1962052, Mexico, Sinaloa Mazatlan; length = 44.5 mm.
21. Clidiophora claviculata, SBMNH 347854, Mexico, Sonora, off Bahia Kino, 28°47,06" N, 111°57'16" W, 13 m; length = 45 mm.
anterior cardinal tooth, which ends posterior of the
anterior adductor muscle, posterior tooth veiy long,
thin. Right valve with two or three cardinal teeth, the
central cardinal very small or absent. Lithodesma
present. External sculpture of commarginal striae or
ribs only
Clidiophora claviculata (Carpenter, 1856)
(Figures 20-21)
Pandora claviculata Carpenter, 1856: 228.
Description: Shell Shape: Variable from subovate-elon-
gate to subquadrate; both valves compressed, left valve
slightly concave or convex, right valve flat to slightly
convex or concave; most specimens twisted to the
left; anterodorsal margin straight to curved, rarely with
very weak serrations; posterior end broadly rounded to
straight, with short, truncate, upturned, well-demarcated
rostrum; posterodorsal margin straight to strongly re-
curved; right valve slightly overlapping left along pos-
terodorsal margin; ventral margin broadly rounded,
without indentation.
Sculpture and Color: Anterior half to two thirds of
left valve demarcated by change in color in some, with-
out sulcus, commarginal striae over posterior end,
becoming more prominent anteriorly, worn specimens
with weak radials posteriorly; sculpture of both valves
of irregular commarginal undulations and striae; both
valves with one heavy broad radial rib extending from
beaks to posterior margin, with deep groove ventral
to it.
Hinge: Left valve with three teeth; anterior tooth
elongate, broad, ventrally directed, ending posterior of
P. Valentich-Scott and C. Skoglund, 2010
Page 69
anterior adductor muscle scar; central tooth short to
moderate in length, thin; posterior tooth very elongate,
narrow, some granulate on top, directed to dorsal portion
of posterior adductor muscle scar; ligament narrow,
oblique, long; lithodesma broad, long; long, narrow fur-
row between ligament and posterior cardinal tooth; right
valve with two cardinal teeth; anterior tooth moderate to
long, narrow dorsally, wide medially, narrow ventrally,
sometimes with secondary tooth projecting past middle
of anterior adductor muscle scar; posterior tooth thin,
very elongate, paralleling dorsal margin, most granulate
or serrate on top.
Muscle Scars: Both adductor muscle scars subcircular,
posterior scar larger, region dorsal to anterior scar thick-
ened in many.
Length: To 45 mm [BMNH],
Distribution: Laguna Manuela, outer coast of Baja
California Sur (28.2° N) [CAS], into the Golfo de Califor-
nia to near its head at San Felipe, Baja California
(31.0°N) [SDNJIM, SBMNH, CAS] and Puerto
Pehasco, Sonora (31.3°N) [SBMNH], south to Mazatlan,
Sinaloa (23.2°N) [BMNH], Mexico; 15-60 m [SBMNH],
Type Material: BMNH 1962052/1-3, syntypes, 3 pairs.
Type Locality: Mazatlan, Sinaloa, Mexico.
Remarks: Olsson (1961: 456) and Keen (1971: 287)
synonymized Clidiophora claviculata with Frenamya
arcuata. Clidiophora daviadata is much more com-
pressed and has the anterior tooth in the left valve
directed to the posterior portion of the anterior adductor
muscle scar when compared to F. arcuata. When com-
pared to C. comuta, C. clavicidata has a more arcuate
posterodorsal margin and a longer rostrum.
Clidiophora claviculata is perhaps the most variable in
shell outline of all of the Panamic pandorid species. The
type series is very quadrate in overall shape, but com-
monly specimens we have examined are more ovate-
elongate, with a longer rostrum. With further study, it is
possible that more than one species might be present
in this group. Based on the curvature of the shell and
rostrum, this species appears to lay with its right side
on the sediment, unlike most other Panamic pandorid
species, which lay on their left side.
Literature: Gemmell et al. ( 1987: 62-63, as P. comuta ),
Hertz et al. (1985).
Clidiophora comuta (C. B. Adams, 1852)
(Figures 22-23)
Pandora comuta C. B. Adams, 1852: 519 [repr.: 295], ex
Gould ms; Clidiophora acutedentata Carpenter, 1865:
598, nomen vanum (an unjustified intentional emenda-
tion of an established name).
Description: Shell Shape: Subovate; both valves
compressed, twisted to left posteriorly; left and right
valves slightly convex, right valve slightly concave in
some; anterodorsal margin straight and sloping ventrally
to slightly curved; posterior end straight to broadly
rounded, rostrum short or absent; posterodorsal margin
straight, some slightly arcuate terminally; right valve
narrowly overlapping left along posterodorsal margin;
ventral margin broadly rounded, without indentation.
Sculpture and Color: Anterior half to two-thirds of left
valve diagonally demarcated by change in color, without
sulcus; left valve sculpture of irregular commarginal
striae, with one heavy broad radial rib extending
from beaks to posterior margin, without shallow groove
ventral to it; right valve sculpture of irregular
commarginal striae, with moderately broad groove
paralleling dorsal margin; escutcheon absent to long,
narrow, shallow.
Hinge: Left valve with three cardinal teeth; anterior
tooth elongate, broad, ventrally directed, ending in mid-
dle of posterior side of anterior adductor muscle; central
tooth very small, short, not well demarcated in small
specimens; posterior tooth thin, very elongate, removed
from dorsal margin; right valve with two cardinal teeth;
anterior tooth short, broad; posterior tooth, elongate,
narrow, not granulate on top, removed from dorsal mar-
gin; ligament moderately wide, oblique, very long;
lithodesma broad, long; with slight furrow between liga-
ment and posterior tooth.
Muscle Scars: Adductor muscle scars subequal,
subcircular.
Length: To 36 mm [SBMNH],
Distribution: Laguna Ojo de Liebre, Pacific Coast oi
Baja California Sur (27.8°N) [SBMNH], into the Golfo
de California as far north as San Felipe, Baja California
(31.0°N) [SBMNH], and offshore south of Bahia la
Choya, Sonora (31.0°N) [CAS], Mexico, to Panama
[MCZ]; intertidal zone to 70 m [SBMNH],
Type Material: MCZ 186309, holotype (broken),
1 pair.
Type Locality: Panama (no specific locality).
Remarks: This species is the most common species
found in the museum collections, and perhaps is the
most common large species in the Panamic Province.
It has been mislabeled in collections as Pandora
claviculata, P. panamensis , and P. radians.
Carpenter (1865) renamed this species on the grounds
that C. B. Adams’ name was misleading, having been
based on a broken type specimen that appeared to be
“cornuate”, e.g. to have posterior horns.
Literature: Hertz et al. (1985), Keen (1971: 289),
Olsson (1961: 455).
Clidiophora dorsorectus new species
(Figure 24)
Description: Shell Shape: Subovate-elongate, very
fragile, thin, translucent; both valves compressed, left
Page 70
THE NAUTILUS, Vol. 124, No. 2
Figures 22-23. 22. Clidiophora comuta, liolotype, MCZ186309, Panama [no specific locality]; length, 16 mm. 23. Clidiophora
cornuta , SBMNH 83351, Mexico, Sonora, off Bahia Kino, 28°47' N, 111°58' W, 55 m; length = 37 mm.
valve flat to slightly convex, right valve flat to slightly
concave; most specimens flat, few twisted slightly to the
left; anterodorsal margin straight, not curving ventrally,
slightly recurved dorsally, without serrations; posterior
end broadly to narrowly rounded, rostrum poorly
defined, when visible, short, broad; posterodorsal margin
straight; right valve slightly overlapping left along
posterodorsal margin; ventral margin broadly rounded,
expanded posteriorly, without indentation.
Sculpture and Color: Left valve not demarcated by
change in color, without sulcus; sculpture of left valve
of coinmarginal striae and irregular commarginal undula-
tions, stronger posteriorly; left valve with one sharp,
broad radial rib extending from beaks to posterior margin,
fine commarginal ribs from radial rib to dorsal margin.
Hinge: Lett valve with three cardinal teeth; anterior
tooth moderately long, moderately broad, ending about
one-third of length of the posterior side ol the anterior
adductor muscle scar; medial tooth short, moderately
narrow; posterior tooth thin, very elongate, angling well
down from dorsal margin, granulate on top, not quite
reaching dorsal end of posterior adductor muscle scar;
dorsal to posterior tooth a deep furrow extending from
beaks to posterior margin; right valve with two cardinal
teeth; anterior tooth short, slightly curved, ventrally
directed, ending well short of posterior end of anterior
P. Valentich-Scott and C. Skoglund, 2010
Page 71
Figures 24-25. 24. Clidiophora dorsorectus , holotype, SBMNIl 83944, Mexico, Baja California Sur, off Punta la Gringa;
29.0321° N, 113.5196° W; 20-40 fathoms [40-80 m]; length = 34 mm. 25. Heteroclidns punctata, SBMNIl 118713. California, San
Diego County, Coronado Island, intertidal; length = 47 mm.
adductor muscle scar; posterior tooth very elongate,
narrow, granulate on top, directed to dorsal portion ol
posterior adductor muscle scar; ligament long, narrow,
oblique; lithodesma broad, thick.
Muscle scars; Anterior adductor muscle scar
subcircular, posterior scar ovate-elongate, region dorsal
to anterior scar not thickened.
Length: To 34 mm [SBMMH],
Distribution: In the Golfo de California at Punta la
Gringa, Baja California (31.3°N) [SBMNH], and Isla
Danzante, (24.7°N) [SBMNH], Baja California Sur,
Mexico; 20-90 m [SBMNH],
Type Material: Holotype SBMNH 84944, length =
33.96 mm. Height - 19.79 mm, collected by Carol and
Paul Skoglund from 1976 through 1993, from type local-
ity. Paratypes, from type locality, SBMNH 84945 (1 spec-
imen); CAS 181987, 1 specimen, length = 21.61 mm;
USNM 1132898, 1 specimen, length = 21.12 mm.
Paratypes, Mexico, Baja California Sur, west of Isla
Danzante, 25. 794660° N, 1 1 1.281876°W; 30-45 m; col-
lected by Carol and Paul Skoglund, 1984; SBMNH 4
specimens.
Type Locality: Mexico, Baja California, off Punta la
Gringa; 29.0321° N, 1 13.5196° W; 40-80 m (originally
20-40 fathoms).
Page 72
THE NAUTILUS, Vol. 124, No. 2
Etymology: Named alter the diagnostic feature - a
straight dorsal margin - dorsorectus.
Remarks: Like Pandora clavicidata, this species
appears to lay with its right side on the sediment, unlike
most other Panamic Pandora species, which lay on their
left side.
Literature: Not seen in previous literature.
Genus Heteroclidus Dali, 1903
Heteroclidus Dali, 1903. Type species (OD): Pandora
punctata Conrad, 1837. Recent, California.
Description: Hinge of left valve with veiy strong,
long anterior cardinal tooth, which ends anterior of the
anterior adductor muscle, posterior tooth very long, thin,
paralleling dorsal margin. Right valve with three cardinal
teeth, the central cardinal robust, long. Lithodesma
present. External sculpture ol commarginal striae or
ribs only.
Heteroclidus punctata (Conrad, 1837)
(Figure 25)
Pandora punctata Conrad, 1837: 228.
P[andora], (Heteroclidus) p. g abbi Dali, 1903: 1521.
Description: Shell Shape: Subovate-oblique; both
valves compressed, both valves slightly convex, left slightly
more convex than right; anterodorsal margin broadly
rounded, without serrations; posterior end broadly
rounded, with short, truncate, poorly defined rostrum;
posterodorsal margin strongly arcuate; right valve
overlapping left along posterodorsal margin; ventral margin
broadly rounded, with indentation towards anterior slope.
Sculpture and Color: Anterior third of left valve demar-
cated by change in color and sculpture, with very shallow
sulcus, anterior end with irregular commarginal striae and
fine granules; posterior two-thirds with commarginal striae;
left valve with one veiy low, broad radial rib extending
from beaks to posterior margin, with shallow groove ven-
tral to it; right valve sculpture of veiy fine commarginal
striae, and irregular commarginal undulations.
Hinge: Left valve with two cardinal teeth; anterior tooth
elongate, thick, anteroventrally directed; posterior tooth
short, narrow, obscure; ligament long, moderately wide,
oblique; lithodesma broad, thick, long; right valve with
three cardinal teeth; anterior tooth long, narrow; central
tooth long, broad; posterior tooth, elongate, narrow.
Muscle Scars: Adductor muscle scars subequal,
subcircular; both valves with irregular, widely spaced
punctuations dorsal to pallial line.
Length: To 47 mm [SBMNH],
Distribution: Esperanza Inlet, Vancouver Island,
British Columbia (49.9°N) [RBCM], to Punta Pequena,
Pacific coast of Baja California Sur, Mexico (26.2°N)
[LACM]; subtidal zone to 50 m [SBMNH], in mud.
Known from the middle Pliocene ol California.
Type Material: BMNH 1966304, possible holotype,
1 left valve.
Type Locality: Santa Barbara, California, USA.
Literature: Carpenter (1865: 598), Coan et al. (2000:
520), Grant and Gale (1931: 262-263), Hertlein and
Grant (1972: 336), Keen (1971: 289).
Genus Foveadens Dali, 1915
Foveadens Dali, 1915. Type species (OD): Pandora
( Foveadens ) panamensis Dali, 1915. Recent, tropical
eastern Pacific.
Description: Hinge of left valve with two short,
curved anterior cardinal teeth; posterior tooth long, par-
tially united with the dorsal margin with a septum. Right
valve with three cardinal teeth; anterior cardinal small,
tubercular; central short, bulbous; posterior elongate.
Lithodesma absent. External sculpture of commarginal
striae or ribs only.
Foveadens panamensis (Dali, 1915)
(Figures 26-27)
Pandora ( Foveadens ) panamensis Dali, 1915: 451.
Description: Shell shape: Subquadrate to subovate;
both valves very compressed, both valves slightly convex,
right slightly more convex than left; anterodorsal margin
straight, without serrations; posterior end subtruncate,
with short, truncate, poorly defined rostrum; postero-
dorsal margin straight near beaks, slightly upturned pos-
teriorly; right valve overlapping left along posterodorsal
margin; ventral margin broadly rounded, with indenta-
tion towards anterior slope.
Sculpture and Color: Anterior third of left valve demar-
cated by change in color and sculpture in fresh spec-
imens, anterior end opaque, posterior end translucent,
with veiy shallow sulcus, anterior end with irregular
commarginal ribs and striae; posterior two-thirds with
weak radial and commarginal striae; left valve with one
heavy broad radial rib extending from beaks to posterior
margin, with shallow groove ventral to it; right valve
sculpture of very fine commarginal striae, and irregular
commarginal undulations.
Hinge: Left valve with three cardinal teeth; anterior tooth
short, stout, trigonal, ventrally directed; central tooth, veiy
short, narrow; posterior tooth elongate, fused to dorsal
margin near beaks, forming tunnel between tooth and
dorsal margin; ligament moderately wide, oblique, short;
without furrow between ligament and posterior tooth;
right valve with two cardinal teeth; anterior tooth short,
stout, directed towards middle ol anterior adductor mus-
cle; posterior tooth, elongate, veiy thick, sinuous in some;
right valve with an additional minute anterior cardinal
visible in some specimens.
Muscle Scars: Both adductor muscle scars subovate,
posterior slightly larger.
P. Valentich-Scott and C. Skoglund, 2010
Page 73
Figures 26-27. 26. Foveadens panamensis, holotype, USNM 252276, Panama, “Old Panama,' intertidal; length — 19 mm.
27. Foveadens panamensis , SBMNH 83338, Panama, “Old Panama,” intertidal; length 23 mm.
Length: To 26 mm [SBMNH],
Distribution: This species is uncommon in collec-
tions, known from Ciudad Panama, Panama (9.0°N)
[SBMNH, USNM, UMML], and Archipelago de las
Perlas, Panama (approximately 8. 5°N) [Olsson, 1961].
Type Material: USNM 252276, holotype, 1 opened
pair, badly damaged;
Type Locality: Old Panama, Panama, beach drift.
Literature: Hertlein and Strong (1946: 98), Keen
(1971: 289), Olsson (1961: 457).
Coania new genus
Type Species: Pandora ( Kennerlia ) rhypis Pilsbry and
Lowe, 1932: 105.
Description: Hinge of left valve with three cardinal
teeth; two moderately short, straight anterior teeth; poste-
rior tooth of moderate length, some slightly united with
the dorsal margin with a septum. Right valve with two
cardinal teeth; anterior cardinal modertately short, stout;
posterior tooth elongate, stout. Lithodesma present. Ante-
rior end of left valve strongly demarcated with notch.
External sculpture of left valve with radial sculpture cen-
trally and posteriorly; right valve sculpture of fine
commarginal striae and weak, irregular radial grooves.
Etymology: Named in honor of Eugene V. Coan, for
his tremendous contributions to our understanding of
the eastern Pacific Ocean Bivalvia.
Distribution: Thus far only known from the type
locality of the type species, in El Salvador.
Page 74
THE NAUTILUS, Vol. 124, No. 2
Figure 28. Coania rhypis , paratype, SBMNH 39009, El Salvador, La Union, Golfo de Fonseca, La Union; length 24 mm.
Comparisons: The distinct radial sculpture on the left
valve and arrangement of the cardinal teeth separate
Coania from all other genera in the family.
Coania rhypis (Pilsbry and Lowe, 1932)
(Ligure 28)
Pandora ( Kennerlia ) rhypis Pilsbry and Lowe, 1932: 105.
Description: Shell Shape: Subovate-oblique;
inequivalve, left valve slightly larger, moderately inflated,
right valve flat; anterior end relatively long; anterodorsal
margin gently bowed; posterior end veiy broadly
rounded, with short, narrow, truncate rostrum;
posterodorsal margin slightly recurved; ventral margin
broadly rounded, with deep, broad indentation towards
anterior end.
Sculpture and Color: Anterior end of left valve strongly
demarcated with notch, anterior end with irregular
commarginal striae, central slope with narrow, moder-
ately spaced radial ribs, becoming obscure posteriorly in
some specimens; left valve with two narrow to broad
radial ribs extending from beaks to posterior margin;
right valve sculpture of veiy fine commarginal striae,
and a few weak, irregular radial grooves, most evident
ventrally.
Hinge: Left valve with three cardinal teeth, two teeth
anterior of ligament, one longer posterior tooth; ligament
narrow, oblique; lithodesma narrow, thin; right valve
with two cardinal teeth, moderately elongate, anterior
tooth slightly bifid.
Muscle Scars: Anterior adductor muscle scar
subcircular, posterior ellipitical.
Length: To 25 mm [SBMNH],
Distribution: Only known from the type locality at
La Union, Golfo de Fonseca, El Salvador (13.4°N)
[SBMNH, ANSP]; 80 m [ANSP].
Type Material: ANSP 155503, holotype, 1 open pair.
T\pe Locality: La Union, Gulf of Fonseca, El
Salvador.
Literature: Keen (1971: 291), Pilsbry and Lowe
(1932: 105).
DISCUSSION
Surprisingly little attention has been paid to understand-
ing the taxonomy of members of the Pandoridae, within
the Panamic Province, as well as globally. They are not
an uncommon component of the offshore bivalve fauna.
Perhaps it is their fragile, laterally flattened shell that has
led to the lack of interest. Or possibly, as we have
encountered, dealing with the variability of shells shapes
leads one to give up in disgust. Whatever the reason, we
hope that this work will encourage other bivalve taxono-
mists to tackle the group in their geographic region.
With 16 pandorid species found in the Panamic Prov-
ince, one can postulate that there is likely much
unexplored diversity in other tropical and temperate
regions around (he world. Mikkelsen and Bieler (2007)
P. Valentich-Scott and C. Skoglund, 2010
Page 75
only reported three species of Pandora from southern
Florida, even with extensive offshore collecting. Simi-
larly, Lamprell and Healey (1998), found only two
pandorids in all of Australia. Oliver (1992) included two
species living in the Red Sea, and further stated that the
“Pandoridae is a small group of bivalves. . .' The Chinese
coastline includes only three species ol pandorids
(Valentich-Scott, 2003; Xu, 2004), and only four species
are reported from Japanese waters (Okutani, 2000).
We have found the best diagnostic identification char-
acters to be in the hinge, rather than the overall shell
shape or inflation. We also suspect if live specimens or
wet presewed material becomes available, additional
anatomical characters will immediately become appar-
ent. Molecular data will undoubtedly yield further
advancement in the understanding of this challenging
group of bivalves.
ACKNOWLEDGMENTS
We are very thankful to Ellen Strong (National Museum
of Natural History, Smithsonian Institution), Paul
Callomon (Academy of Natural Sciences, Philadelphia),
and Kathie Way (The Natural History Museum,
London) for allowing access to their general and type
collections, and providing excellent workspace to
examine and photograph specimens. We wish to grate-
fully thank the following individuals and institutions for
the loan of specimens; Adam Baldinger (MCZ), Carole
and Jules Hertz, Elizabeth Kooks (CAS), Nancy Voss
(UMML), Lindsey Groves (LACM), and Margi Dyke ns
(SDNHM). Eugene Coan provided useful comments on
an early draft oi this manuscript. Andre Sartori critically
reviewed the manuscript, and provided many helpful
observations and suggested modifications. Patricia Sa-
deghian took digital photographs ol all non-type spec-
imens, and assisted with image editing and preparation.
LITERATURE CITED
Adams, A. 1860. Description of a new conchiferous mollusc of
the genus Pandora. Zoological Society of London, Pro-
ceedings for 1859[27] : 487.
Adams, C.B. 1852. Catalogue of shells collected at Panama,
with notes on synonymy, station and habitat Lyceum
of Natural History of New York, Annals 5: 229-296 (June);
297-549.
Allen, J.A. 1954. On the structure and adaptations of Pandora
inaequivalvis and P. pinna. Quarterly Journal of Micro-
scopical Science 95(4)1(3)32]: 473-482. '
Allen, M.F. and J.A. Allen. 1955. On the habits of Pandora
inaequivalvis (Linne). Proceedings of the Malacological
Society of London 31: 175-185.
Boss, K. J. 1965. Catalogue of the family Pandoridae (Mollusea:
Bivalvia). Harvard University, Museum of Comparative
Zoology, Department of Mollusks, Occasional Papers on
Mollusks 2(33): 413-424.
Boss, K. J. and A. S. Merrill. 1965. The family Pandoridae in the
western Atlantic. Johnsonia 4:181-215, pis. 115-126.
Bruguiere, J.G., G.P Deshayes, and C.H. Hwass. 1789-1832.
Encyclopedic methodique. Histoire naturelle de vers.
Paris (Panckoucke). Vol. 1: xviii + 757 pp.; vol. 2: vii +
256 + 594 pp.; vol. 3: 595-1152 .
Carpenter, P. P. 1856. Descriptions of (supposed) new species
and varieties of shells, from the Californian and west Mex-
ican coasts, principally in the collection of Hugh Cuming,
Esq. Proceedings of the Zoological Society of London
1855J23]: 228-232 (5 Feb.); (299): 233-235 (23 Feb.).
Carpenter, PP 1864. Diagnoses of new forms of mollusks col-
lected at Cape St. Lucas by Mr. Xantus. Annals and Mag-
azine of Natural History (3)13:311-315 (1 April); (78):
474-479 (1 June); 14(79): 45-19 (1 July).
Carpenter, P. P. 1865. Contributions towards a monograph of
the Pandoridae. Proceedings of the Zoological Society' of
London 1864: 596-603.
Children, J.G. 1822-1823. Lamarcks genera of shells. The
Quarterly Journal of Science, Literature, and the Arts, 14
(27): 64-87, pis. 3, 4 (Oct. 1822); 14(28): 298-322, pis. 5, 6
(Jan. 1823); 15(29): 23-52, pis. 2, 3 [referred to as "1" and
"2" in text] (April 1823); 15(30): 216-258, pis. 7, 8 (July
1823); 16(31): 49-79, pi. 5 (Oct. 1823); 16(32): 241-264,
pi. 6 ("Jan. 1824", but probably Dec. 1823).
Coan, E.V, P. Valentich-Scott, and F.R. Bernard. 2000. Bivalve
seashells of western North America. Marine bivalve mol-
lusks from Arctic Alaska to Baja California. Santa Barbara
Museum of Natural History, Monographs 2: viii + 764 pp.
Conrad, T. A. 1834. Descriptions of new Tertiary fossils from
the southern states. Journal of the Academy of Natural
Sciences of Philadelphia 7: 130-157.
Conrad, T.A. 1837. Descriptions of new marine shells from
Upper California, collected by Thomas Nuttall, Esq. Jour-
nal of the Academy of Natural Sciences of Philadelphia 7:
227-268, pis. 17-20.
Conrad, T.A. 1855. Report ... on the fossil shells collected in
California by W. P. Blake, geologist of the expedition,
under the command of Lieutenant R. S. Williamson,
United States Topographical Engineers, 1853. In: W. P.
Blake, Prelimiminary Geological Report, United States
Pacific Railroad Explorations, Appendix [Palaeontology]:
5-21.
Conrad, T.A. 1863. Catalogue of the Miocene shells of the
Atlantic slope. Proceedings of the Academy of Natural
Sciences of Philadelphia 1862[14]: 559-583.
Dali, W. If. 1903. Contributions to the Tertiary fauna of Flor-
ida, with especial reference to the silex beds of Tampa and
the Pliocene beds of the Caloosahatehie River, including
in many cases a complete revision of the generic groups
treated of and their American species. Part VI. Conclud-
ing the work. Transaction of the Wagner Free Institute of
Science of Philadelphia 3: xiv + 1219-1654, pis. 48-60.
Dali, W. H. 1915. A review of some bivalve shells of the group
Anatinacea from the west coast of North America.
Proceedings of the United States National Museum 49:
441-456.
Dushane, H. and E. Brennan. 1969. A preliminary survey of
the mollusks for Consag Rock and adjacent areas. Gulf of
California, Mexico. Veliger 11(4): 351-363.
Gemmell, J.B., B.W. Myers, and C.M. Hertz. 1987. A faunal
survey of the bivalves of San Felipe and environs. Gulf of
California, from the Gemmell collection (1965 to 1976).
The Festivus 18 (Supplement): 72 pp.
Grant, U.S., IV and 11. R. Gale. 1931. Catalogue of the marine
Pliocene and Pleistocene Mollusea of California and
Page 76
O
THE NAUTILUS, Vol. 124, No. 2
adjacent regions .... Memoirs of the San Diego Society of
Natural History 1: 1036 pp., 32 pis.
Hertlein, L.G. and A. M. Strong. 1946. Eastern Pacific expedi-
tions of the New York Zoological Society. XXXV. Mollusks
from the west coast of Mexico and Central America. Part IV.
New York Zoological Society, Zoologiea 31: 93-120, pi. 1.
Hertlein, L.G. and U.S. Grant, IV. 1972. The geology and paleon-
tology of the marine Pliocene of San Diego, California. Part
2B: Paleontology: Peleeypoda. Memoirs of the San Diego
Society of Natural History 2: 135-409, frontis., pis. 27-57.
Hertz, C M., B.W. Myers, and J.B. Gemmell. 1985. Pandora
( Clidiophora ) comuta C. B. Adams, 1852, and new infor-
mation on its distribution. The Festivus 17(2): 101-110.
Iredale, T. 1930. More notes on the marine Mollusca of New
South Wales. Records of the Australian Museum 17(9):
384-407, pis. 62-65.
Keen, A.M. 1958. Sea shells of tropical west America; marine
mollusks from Lower California to Colombia, 1st ed.
Stanford University Press, Stanford, xii + 624 pp., 10 pis.
Keen, A.M. 1971. Sea shells of tropical west America; marine
mollusks from Baja California to Peru, 2nd ed. Stanford
University Press, Stanford, xiv + 1064 pp., 22 pis.
Lamarck, J.B. PA. d. M. d. 1818. Histoire naturelle des
animaux sans vertebres, ... 5. Paris (Verdiere, Detemlle
& chez f auteur). 612 pp.
Lamprell, K.L. and Healy, J.M. 1998. Bivalves of Australia,
Vol. 2. Leiden (Baekhuys). 288 pp.
Leach, W. E. 1819. Descriptions of the new species of animals
discovered by his Majesty’s ship Isabella , in a voyage to the
Arctic regions. Annals of Philosophy 14(9) [S 1 ] : 201-206.
Linnaeus, C. 1758. Systema naturae per regna tria naturae . . .
editio decima, reformata, vol. 1 (Regnum animale). Salvii,
Stockholm, 824 + iii pp.
Mikkelsen, PM. and Bieler, R. 2007. Seashells of southern
Florida. Living marine mollusks of the Florida Keys and
adjacent regions. Bivalves. Princeton University Press,
Princeton, vii + 703 pp.
Montagu, G. 1803. Testacea Britanniea, or natural history of
British shells, marine, land, and fresh-water, including the
most minute: systematically arranged and embellished
with figures. Romsey (Hollis). 2 vols. 1: xxxvii + 292 pp.;
2: 293-606, 16 pis.
Morton, B. 1984. The adaptations of Frenami/a ceijlanica
(Bivalvia: Anomalodesmata: Pandoracea) to life on the
surface of soft muds. Journal of Conchology 31: 359-371.
Okutani, 4’. 2000. Subclass Anomalodesmacea. In: T. Okutani,
(ed.), Marine mollusks in Japan. Tokai University Press,
Tokyo, pp. 1032—1047.
Oliver, P. G. 1992. Bivalved seashells of the Red Sea. Wales,
Cardiff, and Hemmen,Wiesbaden, 330 pp.
Olsson, A. A. 1961. Mollusks of the tropical eastern Pacific
particularly from the southern half of the Panamic-
Pacific faunal province (Panama to Peru). Panamic-Pacific
Peleeypoda. Paleontological Research Institution, Ithaca,
574 pp.
Pilsbry, H. A. and H.N. Lowe. 1932. West Mexican and Central
American mollusks collected by H. N. Lowe, 1929-31.
Proceedings of the Academy of Natural Sciences of Phila-
delphia 84 [for 1932]: 33-144, pis. 1-17.
Rafinesque, C.S. 1815. Analyse de la nature, ou tableau de
l’univers et des corps organizes. Palermo, 223 pp.
Sowerby, G.B., I. 1835. [. . . the new species of shells contained
in the collection of Mr. Cuming], Proceedings of the Zoo-
logical Society of London 1835[3]: 21-23.
Stoliczka, F. 1870-1871. Cretaceous fauna of southern India,
vol. 3: The Peleeypoda, with a review of all known genera
of this class, fossil and Recent, .... Memoirs of the
Geological Survey of India, Palaeontologica Indica, xxii +
538 pp.
Tate, R. 1889. Descriptions of some new species of marine
Mollusca from South Australia and Victoria. Transac-
tions of the Royal Society of South Australia 11: 60-66,
pi. 11.
Thomas. K.A. 1994. The functional morphology and biology
of Pandora filosa (Carpenter, 1864) (Bivalvia: Anomalo-
desmata: Pandoracea). The Veliger 37: 23-29.
Valentich-Scott, P. 1998. Class Bivalvia. In: PH. Valentieh-Scott
and |. A. Blake (eds.) Taxonomic atlas of the benthic fauna of
the Santa Maria Basin and the western Santa Barbara Chan-
nel. Volume 8. The Mollusca Part 1. The Aplacophora,
Polyplacophora, Scaphopoda, Bivalvia, and Cephalopoda.
Santa Barbara Museum ot Natural History, Santa Barbara,
pp. 97-173.
Valentich-Scott, P. 2003. A taxonomic, distributional and
bibliographic checklist of Hong Kong marine bivalve
mollusks and research published on them from
1971-2000. In; B. Morton (ed.) Perspectives on Marine
Environmental Change in Hong Kong and Southern
China. University of Hong Kong Press, Plong Kong,
pp. 259-310.
Xu, F. 2004. Pholadomyoida. In: Q. Zhongyan (ed.) Seashells of
China. China Ocean Press, Beijing, pp. 326-332.
Yonge, C.M. and B. Morton. 1980. Ligament and lithodesma in
the Pandoracea and the Poromyaeea with a discussion on
evolutionary history in the Anomalodesmata (Mollusca:
Bivalvia). Journal of Zoology 191: 263-292.
THE NAUTILUS 124(2):77-92, 2010
Page 77
Descriptions of a new species and a new subspecies of freshwater
mussels, Epioblasma ahlstedti and Epioblasma florentina aureola
(Bivalvia: Unionidae), in the Tennessee River drainage, USA
Jess W. Jones
U.S. Fish and Wildlife Service
Department of Fisheries and Wildlife Sciences
Virginia Polytechnic Institute and State University
Blacksburg, VA 24061 USA
[email protected]
Richard J. Neves
Department of Fisheries and Wildlife Sciences
Virginia Polytechnic Institute and State University
Blacksburg, VA 24061 USA
ABSTRACT
A new species and a new subspecies of Epioblasma are de-
scribed from the Tennessee River drainage, USA. Epioblasma
ahlstedti (Duck River Dartersnapper) currently is restricted
to the Duck River in west-central Tennessee (TN). However,
museum collections indicate that the species likely occurred in
the Buffalo River, TN, a tributary to the Duck River, and in the
Tennessee River at Muscle Shoals, Alabama (AL), and lower
Shoal Creek, AL. The following diagnostic morphological char-
acteristics of E. ahlstedti are based on the female: (1) pro-
nounced posterior-ventral shell expansion of the adult female
shell; (2) slate-gray to dark-purple mantle-pad; (3) spongy tex-
ture of the mantle-pad; and (4) display of a single, tan-colored
micro-lure that moves slowly side-to-side. Epioblasma florentina
aureola (Golden Riffleshell) currently is restricted to Indian
Creek, a tributary to the upper Clinch River, Virginia. Histori-
cally, the species occurred in numerous tributaries in the Ten-
nessee River drainage downstream at least to the Duck River.
The following diagnostic morphological characteristics of
E. florentina aureola are based on the female: (1) gray mantle-
pad with a black mottled background; and (2) mantle-pad is
pustuled but the pustules are rounded. The genus Epioblasma
represents the most endangered group of freshwater mussels in
North America; 18 of the recognized 25 species or subspecies
are already extinct. Likewise, these newly described species and
subspecies are critically endangered and despite being listed as
endangered under the Endangered Species Act remain in need
of focused conservation to prevent their extinction.
Additional keywords: Endangered, molecular DNA markers,
phylogenetic analysis, Tennessee River basin
INTRODUCTION
The Tennessee River and its tributaries support the most
species-rich mussel assemblage in North America (NA)
(Figure 1), with 102 species known historically from the
system (Parmalee and Bogan, 1998). Unfortunately, pol-
lution and hydrological modifications (e.g., dams) to the
river system over the past 100 years have reduced mussel
diversity to approximately 80 extant species (Parmalee
and Bogan, 1998; Williams et al., 2008). The decline of
species belonging to the genus Epioblasma was the most
severe (Johnson, 1978). Of the 18 species and subspecies
known from the system, only four remain, and of those
lost, most are considered extinct and one is extirpated
but remains in a small isolated population in Ohio. Spe-
cies in this genus have specialized reproductive traits,
including species with shell morphologies and mantle-
lures that can attract and capture their fish hosts to
facilitate infestation by the gloehidia (Jones et al., 2006;
Barnhart et al., 2008). Epioblasma shells are character-
ized by small to medium sizes (~30-70 mm) and sexual
dimorphism. The posterior- ventral end of the female
shell is expanded, to form a distinct protrusion, or an
area of the shell herein termed, the shell expansion
(Figures 2, 3, 5, 8). This distinctive feature of female
Epioblasma was considered by Walker (1910) to be the
“highest expression of unionid development. The shell
expansion houses a modified portion of the mantle,
known as the mantle lure that functions to attract host
fish. The focal species of the current study belong to the
Epioblasma subgenus Tondosa (Johnson, 1978), which
have a prominent shell expansion and a mantle-lure that
contains a mantle-pad and micro-lure (Figures 7, 9-14).
The mantle-pad is a folded and articulated portion of the
mantle, and the micro-lure is a modified and innervated
incurrent aperture papilla that moves to attract fish
hosts, seemingly mimicking aquatic insect larvae (Jones
et al., 2006; Barnhart, 2008).
Such morphological and life history specialization may
have contributed to the decline of Epioblasma species, as
changes in environmental conditions over the 19 1 and
20th centuries may have disrupted this complex life cycle.
Unfortunately, the loss of numerous taxa in the genus has
prevented a more complete understanding of the life
history and taxonomy of the group, based on modern
diagnostic methods using DNA and mantle-lure displays.
Since only 7 of the 25 species and subspecies in NA
Page 78
THE NAUTILUS, Vol. 124, No. 2
Figure 1. Distribution of Epioblasma ahlstedti (current •, historic O) and E florentina aureola (current ■ historic □) in the
Tennessee River system, USA. Also shown is the distribution of E. florentina walkeri (current A historic A) in the Cumberland River
system.
remain (Williams et ah, 1993), it is possible that
additional taxa were never identified before their extinc-
tion, while other described taxa may have been pheno-
typic variants of the same species or subspecies.
The diverse phenotypic variation within Epioblasma ,
especially the varied shell morphologies and mantle-lure
displays of females, has allowed for a more comprehen-
sive approach to understanding the taxonomy of extant
species within the group, one that includes both tradi-
tional phenotypic characters and molecular markers.
The study conducted by Jones et al. (2006) showed that
the population of Epioblasma capsaefonnis in the Duck
River, Tennessee (TN) was distinct from the population
in the Clinch River, TN and Virginia (VA), and that the
population of Epioblasma florentina walkeri in Indian
Creek, VA, a tributary to the upper Clinch River, was
distinct from the population in the Big South Fork
Cumberland River, TN and Kentucky (KY). Based on
extensive phenotypic data (e.g., shell morphology,
mantle-lures, fish host specificity) and molecular data
(e.g., mitochondrial DNA, nuclear DNA microsatellites),
these authors recommended the reclassification of the
Duck River and Indian Creek populations of Epioblasma ,
respectively. I lowever, the study did not formally describe
and provide taxonomic recognition to these populations.
Thus, the purpose of this paper is to present formal de-
scriptions and provide scientific and common names for
the new species and new subspecies of freshwater mussel
in the Tennessee River system.
Figure 2. The height (axis- A) and length of the base (axis-B)
of the shell expansion are shown. The arrows on axis-B point to
the articulation points of the posterior-ventral shell expansion
with the main body of the shell. The figure was modified from
Burch (1975) and with permission from Dr. J.B. Burch.
MATERIALS AND METHODS
Type specimens, other shell material, and collection records
for Epioblasma ahlstedti , E. capsaefonnis, E. florentina
aureola , E. florentina florentina and E. florentina walkeri
were examined at the following museums: Academy of
J.W. Jones and R. J. Neves, 2010
Page 79
Figures 3-4. 3. Holotype (OSUM 68523) of Epioblasma ahlsteclti (female), 50.7 mm long and 37.8 mm high; 4. Paratype (OSUM
82238) of Epioblasma ahlsteclti (male), 45.8 mm iong and 32.0 mm high. Photos by G. Thomas Watters.
Natural Sciences of Philadelphia, Pennsylvania (ANSP);
Carnegie Museum, Pittsburgh, Pennsylvania (CM);
Florida Museum of Natural History, University of
Florida (UF), Gainesville, Florida; Museum of Comparative
Zoology, Harvard University, Cambridge, Massachusetts
(MCZ); Ohio State University Museum of Biological
Diversity, Columbus, Ohio (OSUM); and National
Museum of Natural History, Smithsonian Institution,
Washington, D.C. (USNM) [see Jones (2004) for all
examined lots]. Type specimens provided standard
references for comparing shell material from various
rivers, and collection records were used to construct
species distributions. Museum specimens of E. ahlsteclti
were identified using only female shells.
To assess differences in the shell expansion of adult
female shells among populations, simple linear regres-
sion equations of total length (x-axis) versus the height
((/-axis) of the shell expansion were computed for each
population. The height of the shell expansion was
measured from its base, which is the length between
the two articulation points with the main body of the
shell (Figure 2). Digital calipers were used to measure
shell dimensions to the nearest 0. 1 mm. To test for
differences, the slopes of the fitted-lines of each
regression equation were compared among populations
using the homogeneity of regression coefficients test
statistic.
Fecundity was estimated by counting the number of
glochidia from each of 6-10 females per population.
Although not a diagnostic trait in this study, it helped to
demonstrate quantitative differences among species.
Live female mussels for fecundity analysis were col-
lected from the following river locations: (1) E. ahlsteclti ,
Duck River, Lillard Mill [River Kilometer (RKM) 2S7.7],
Marshall County (Co.), TN; (2) E. capsaeformis , Clinch
River between Horton Ford (RKM 321) and Swan
Island (RKM 277), Hancock Co., TN; (3) E. florentina
aureola , Indian Creek, a tributary to the upper Clinch
River at R K M 518.2, Tazewell Co., Virginia (VA);
(4) E. f. walked, Big South Fork Cumberland River,
Station Camp Creek, Scott Co., TN, downstream to
Bear Creek, McCreary Co., KY (Jones et al. 2006).
Page 80
THE NAUTILUS, Vol. 124, No. 2
Figures 5-6. 5. Holotype (OSUM 82239) of Epioblasma florentina aureola (female), 44.1 mm long and 34.8 mm high; 6. Paratype
(OSUM 82240) of Epioblasma florentina aureola (male), 48.1 mm long and 33.4 mm high. Photos by G. Thomas Watters.
Fecundity was compared using analysis of variance
(ANOVA). All statistical analyses of shells and glochidia
were conducted in MINITAB 14 Statistical Software
(Minitab, Inc., State College, PA).
Samples of mantle tissue from live mussels were
collected from the above river locations and, additionally,
individuals of E. torulosa rangiana were collected
from the Allegheny River, Venango Co., Pennsylvania
(PA) (Jones et ah, 2006). Other subspecies were not
included in the study because they are presumed extinct,
i.e., E. florentina florentina , E. florentina curtisi , and
E. t. torulosa. A small piece of mantle tissue (20-30 mg)
was collected non-lethally from 8-20 live mussels from
each population (Naimo et ah, 1998).
Sequences of three regions of mitochondrial DNA
(mtDNA) and one region of nuclear DNA (nDNA) were
amplified by polymerase chain reaction (PCR) using
primers and conditions reported in: (1) 16S , ribosomal
RNA (Lydeard et ah, 1996) (2) ND1, first subunit of
NADI I dehydrogenase (Buhay et ah, 2002; Serb et ah.
2003), (3) cytochrome-b (Merritt et ah, 1998; Bowen and
Richardson, 2000), and (4) ITS-1 (King et ah, 1999). All
PCR products were sequenced with a Big Dye Termina-
tor Cycle Sequencing kit with AmpliVhq DNA Polymer-
ase (Applied Biosystems). Cycle sequence reactions
were purified using a Qiagen DNA Purification kit
(Qiagene), and subjected to electrophoresis and
sequencing using an Applied Biosystems 3100 auto-
mated sequencer [detailed PCR methods are available
in Jones (2004) and Jones et ah (2006)].
Phylogenetic analysis of DNA sequences and mor-
phological characters were conducted to infer genealog-
ical relationships among Epioblasma spp. Sequences
from mtDNA and nDNA were combined, and six mor-
phological characters (Table 1) were included in the
character matrix for a total evidence analysis (Kluge,
1989). DNA sequences were edited and aligned using
the program SEQUENCHER (version 3.0, Gene
Codes Corporation), and phylogenetic analysis was per-
formed using PAUP* (version 4.0bl0, Swofford, 1998).
J.W. Jones and R.J. Neves, 2010
Page 81
Figures 7-14. Mantle-pad displays of female Epioblasma ahlstedti , E. florentina aureola and congeners. 7. Mantle-pad and micro-
lure of E. ahlstedti. Duck River, Marshall Co., TN. 8. Protruded shell expansion of female E. ahlstedti. 9. E. capsaefonnis mantle-
pad, Clinch River, Hancock Co., TN. 10. Double micro-lure display of E. capsaefonnis ; 11. E. florentina aureola mantle-pad. Clinch
River, Tazewell Co., VA. 12. Micro-lure of E. florentina aureola. 13. E. florentina walked mantle-pad and micro-lure, Big South Fork
Cumberland River, Scott County, TN. 14. Pustuled mantle surface ofE. florentina walked. The gaps between shell valves of female
mussels are approximately 2 cm. The arrows are pointing at microlures. This figure was previously published in Jones et al. (2006) but
updated in this study to include the new species and new subspecies scientific names; photograph in Figure 9 has not been previously
published. Photographs of the mantle-pad display of E. torulosa rangiana are available in Jones (2004).
Page 82
THE NAUTILUS, Vol. 124, No. 2
Table I. Matrix and coding for shell and mantle-lure
characters for Epioblasma species. Character states were
determined from direct observation and from those reported
in Jones et al. (2006). A gap ( — ’) indicates the character was not
applicable to the species.
CHARACTER MATRIX
CHARACTERS:
(1) Prominent posterior- ventral shell expansion of adult
female. 0=absent or diminutive; l=present.
(2) Denticulations present along margin of posterior-ventral
shell expansion. 0=absent; 1 =present.
(3) Periostracum color and ray pattern. 0=yellow-green
periostraeum with irregularly spaced green rays;
l=honey-yellow periostracum with line green rays
evenly spaced over entire shell surface; 2=brown
periostracum with irregularly spaced green rays.
(4) Mantle-pad color. 0=dark purple to slate gray; l=blue to
bluish-white; 2=gray with mottled black background;
3=brown with mottled tan background; 4=white.
(5) Mantle-pad texture. 0=spongy; l=smooth; 2— pustules.
(6) Mantle-pad pustules. 0=rounded; l=pointed.
(7) Number of micro-lures prominently displayed. 0=0;
1=1; 2=2.
(8) Mantle-pad is invaginated where it meets incurrent aper-
ture. 0=yes; l=no; 2=incomplete.
Phylogenetic trees were evaluated using the maximum
parsimony (MP) criterion because the extent of
sequence divergence was low among in-group taxa (Nei
and Kumar, 2000; Felsenstein, 2004). Characters were
treated as unordered and of equal weight for the analysis
due to in-group taxa being closely related (Nei and
Kumar, 2000). The tree search was conducted using
the branch-and-bound method with ACCTRAN and
TBR options; insertions and deletions were treated as
missing data. Bootstrap analyses (10,000 replicates) were
conducted using the FAST step-wise addition option of
PAUP* to assess support for the individual nodes of each
phylogenetic tree (Felsenstein, 1985). An additional phy-
logenetic analysis was conducted using Bayesian infer-
ence in MrBayes v3.0b4 (Huelsenbeek and Ronquist,
2001), where the DNA and morphological data sets
were combined following the approach of Nylander et al.
(2004). MrBayes was run for I million generations,
sampling trees every 100 generations and posterior prob-
abilities were computed after a burn-in of 40,000 genera-
tions. In-group taxa were E. ahlstedti, E. capsaeformis,
E. florentina aureola , E. florentina walkeri , and E. torulosa
rangiana. Because of significant differences in morphol-
ogy and DNA sequences, the Cumberland Combshell
(Epioblasma brevidens ) and Snuffbox (Epioblasma
triquetra) were designated as out-group taxa. The study
by Jones et al. (2006) showed that DNA sequences from
these two species are diverged from the in-group taxa
by ~5%, and based on obvious differences in shell mor-
phology, Johnson (1978) classified E. brevidens and
E. triquetra into different Epioblasma subgenera, Plagiola
and Truncillopsis , respectively. Furthermore, previous
phylogenetic studies have demonstrated the monophyly
of the Epioblasma among North American unionids
and that E. brevidens and E. triquetra are basal to the in-
group taxa (Campbell et al., 2005; Zanatta and Murphy,
2006). Thus, available morphological and genetic data jus-
tify use of these two species as appropriate out-group taxa.
Photographs of the mantle-pad and micro-lures of live
female mussels were taken using a Nikonos V underwater
camera with 28 or 35 mm macro-lenses and Kodak 200
Ektachrome film. Female mussels were held in tempera-
ture-controlled water in recirculating artificial streams
with gravel-filled bottoms. This setup allowed females to
display their mantle-pad and behavioral observations of
micro-lure movements to be recorded under controlled
conditions [photographic methods were previously
published in |ones et al. (2006)].
Epioblasma ahlstedti new species
Duck River Dartersnapper
Figures 3, 4, 7, 8
Diagnosis: The following diagnostic morphological
characteristics of Epioblasma ahlstedti are based on the
female and are summarized in Table 2: (1) pronounced
posterior-ventral shell expansion of the adult shell;
(2) slate-gray to dark purple mantle-pad; (3) spongy tex-
ture of the mantle-pad; and (4) display of a single,
tan-colored micro-lure that moves slowly side-to-side. In
young individuals, the base of the shell expansion is con-
stricted, appearing narrow but distinctly protruded. How-
ever, as the female shell grows, the shell expansion
becomes extremely protruded and enlarged, compared to
the main body of the shell. The shell expansion of
E. ahlstedti is distinguishable from that of E. capsaeformis
using the following criteria: (1) length of the shell expan-
sion base in young individuals (~3-5 y), ranging in size
from ~35-45 mm, typically appears constricted, being
~5-10 mm narrower basally than those of female
E. capsaeformis of similar age and size, and (2) mean
height (9.6 mm) and maximum height (24.6 mm) of the
shell expansion of adult females is significantly greater
than that of female E. capsaeformis (Table 3; Figure 15).
Description: Length of the female shell can reach
60 to 70 mm, with mean length ~42 mm (Table 3). Male
shell lengths are similar. The shell outline of males is
typically elliptical, appearing pointed at the posterior
end (Figure 4), whereas the shell outline of females is
more sub-oval and rounded, with a veiy enlarged and
protruded posterior-ventral shell expansion (Figures 3, 8).
The mean height of the shell expansion of the female is
~10 mm or ~23% of shell length, but maximum height is
J.W. Jones and R. J. Neves, 2010
Page S3
Table 2. Diagnostic morphological and molecular genetic characters for Epioblasma alilstedti , E. florentina aureola and closely
related taxa. Data are summarized from Jones et al. (2006).
Table 3. Mean shell length, mean height of shell expansion, and linear regression equations of shell expansion height (y- axis) to
total length (x-axis) of adult female mussels. Pairwise comparisons of regression equation slopes were significantly different
(p<0.001), except equations A vs D, and C vs D. *The p -value indicates the significance level of the slope for each regression
equation.
~25 mm (Table 3), and it is dark green, sometimes
appearing almost black. Denticulations occur along the
margin of the shell expansion and are typically ~0.5 to
1 mm long and spaced ~0.5 to 1 mm apart. The
periostracum of adults is yellowish green, becoming more
yellowish at the anterior end. The shell surface contains
distinct broad to fine green rays that are typically irregu-
larly spaced. The male shell is short and high with a
shallow sulcus. Nacre color is white, but hues of blue
and salmon may be present, especially near the beak
cavities.
The color of the foot and gills of E. ahlstedti is dull
white. In females, only the two outer gills are marsupial
(i.e., the outer water-tubes contain and brood glochidia
when gravid). Located at the distal end of each marsupial
water-tube is a pore, which allows for release of glochidia.
The mantle-pad is slate-gray to dark purple and has a
spongy texture, and the micro-lure is tan (Figure 7). The
posterior portion of the mantle-pad is invaginated where
it meets the incurrent aperture, so the attachment points
of the micro-lures cannot be seen when the female is
displaying (Jones et al., 2006).
Page 84
THE NAUTILUS, Vol. 124, No. 2
30
03035404550566065 70
Figure 15. Relationship of posterior-ventral shell expansion height versus shell length of female Epioblasma ahlstedti and
E. capsaeformis, and of female E. florentina aureola and E. florentina walked. Pairwise comparison of regression equation slopes
was significantly different (p<0.001) between Epioblasma ahlstedti and E. capsaeformis but not significantly different between
E florentina aureola and E. florentina walked. However, the slope of each regression equation is significant lor all four taxa
(see Table 3).
Type Material: Holotype: Designated herein as
OSUM 68523, collected by 11.15. Athearn, from type local-
ity, 30 Sep. 1956. Paratypes: CM 61.1 1669, Duck River,
Lillard Mill, Marshall Co., TN, collected by A.E. Ortmann,
25 Aug. 1923; MCZ 236214, Duck River, Lillard Mill,
Marshall Co., TN, collected by H.D. Athearn, 30 Sep.
1956; OSUM 52509, Duck River, Lillard Mill, Marshall
Co., TN, collected by S.A. Ahlstedt, I Oct. 1982; OSUM
82238, Duck River, Lillard Mill, Marshall Co., TN, col-
lected by S.A. Ahlstedt, I Oct. 1999 (see Appendix for
other material examined); OSUM 82241, Duck River,
Lillard Mill, Marshall Co., TN, collected by H.D. Athearn,
30 Sep. 1956.
Type Locality: Duck River, Lillard Mill, Marshall Co.,
TN, 35°35'09.08" N; 86°47' 14.07" W.
Comparison with Similar Species: The shell of adult
Epioblasma capsaeformis (. sensu stricto ) in the Clinch
River is of small to medium length (~30-50 mm). The
shell surface contains distinct broad to line green rays
that are irregularly spaced, and veiy similar to those of
E. ahlstedti. However, the following diagnostic, morphol-
ogical characteristics of female E. capsaeformis distin-
guish it from E. ahlstedti: (1) bluish-white mantle-pad
(Figure 9), (2) smooth texture of the mantle-pad, and
(3) simultaneous display ol two micro-lures that move
J.W. Jones and R.J. Neves, 2010 Page 85
Table 4. Fecundity estimates of female Epioblasma.
Mean number ol
*Mean fecundity for Epioblasma ahlstedti is significantly different (p<0.05) from the other taxa.
synchronously in a circular motion; the left micro-lure
moves clockwise, and the right micro-lure moves coun-
terclockwise (Figure 10). The dorsal margin of the man-
tle-pad is black, forming a discrete uniform band
~2— 3 mm wide. The posterior portion of the mantle-pad
is not invaginated where it meets the incurrent aperture,
so the attachment points of the micro-lures can be seen
when the female is displaying. The dentieulations along
the margin of the shell expansion of E. capsaeformis
are typically finer and more closely spaced than those
of E. ahlstedti. The shell expansion is greenish, but not as
dark as that of E. ahlstedti.
Life History: The typical habitat of E. ahlstedti is
gravel shoals in medium to large rivers. It is a long-term
brooder, gravid from late summer to the following spring
and early summer. In the Duck River, at least some
females will emerge from the substrate in early spring
(e.g., Mareh-April) to display their mantle-pad lure to
attract host fishes, while others emerge later in the
spring and summer (e.g., May-July). Mean fecundity of
females was 18,757 glochidia, and ranged from 6,668 to
38,716 (Table 4). The largest females were not examined;
hence maximum fecundity is unknown but likely exceeds
50,000 glochidia. Known fish hosts for E. ahlstedti
include three darter species, the greenside darter
(Etheostoma hlennioides), fantail darter ( Etheostoma
flabellare ), and redline darter ( Etheostoma rufilineatum)
(Jones et ah, 2006). However, tested hosts were not col-
lected from the Duck River, but from the North Fork
Holston River, VA, in the upper Tennessee River drain-
age. Although all three darters are widely distributed and
common in Duck River, the native Duck River hosts
remain uncertain.
Molecular DNA Markers anti Phylogenetic Analysis:
The Duck River population of E. ahlstedti contains pre-
sumably diagnostic nucleotides at three mitochondrial
DNA gene regions [16S (n= 1), cytochrome-b (n— 4), and
ND 1 (n=2)] and at one non-coding nuclear DNA region
[ITS-] (n=2)] (Table 2). Rased on analysis of 10 nuclear
DNA microsatellite loci, the population is moderately
diverged (FST=0.12) from the Clinch River population of
E. capsaeformis (Jones et ah, 2006). The MP and Rayesian
phylogenetic analyses showed high statistical support lor
the E. ahlstedti clade (Figures 16, 17); a finding previously
demonstrated by Jones et al. (2006) using only the DNA
sequences. Furthermore, die MP tree in Jones et al. (2006)
shows E. ahlstedti as the basal member of the in-group taxa,
whereas the MP tree (Figure 16) reported in this study
shows E. tomlosa rangiana as basal. However, several inte-
rior nodes in both MP trees are weakly supported and
collapse in the respective consensus trees (not shown). A
50% majority-rule Bayesian consensus tree depicting a
more conservative topology is given in Figure 17.
Distribution: Epioblasma ahlstedti is currently
restricted to 48.3 RKM in the Duck River from Lillard
Mill (RKM 286.5) downstream to the backwaters of the
Old Columbia Dam reservoir (RKM 238.2) in Marshall
Co. and Maury Co., west-central Tennessee (Figure 1).
Based on shells, the species likely occurred historically in
the Buffalo River, TN (Parmalee and Bogan, 1998), a
tributary to the Duck River, and the Tennessee River at
Muscle Shoals and Shoal Creek, Lauderdale Co., AL
(Jones, 2004).
Conservation Status: The oyster mussel ( Epioblasma
capsaeformis) was listed as endangered under the Endan-
gered Species Act (ESA) in 1997, to include the Duck
River population. Now that E. ahlstedti has been designated
a separate species, it is restricted to only the Duck River
population. Being linearly distributed to 48 river kilome-
ters and susceptible to a stochastic impact, this species
should be considered critically endangered and continue
to receive full protection under the ESA.
Etymology: The species name is given in honor ol
biologist Steven A. Ahlstedt, U.S. Geological Survey
(retired), Knoxville, TN, who has dedicated over 30
years of sendee to freshwater mussel conservation in
the United States. The common name denotes the
snapping behavior of many female Epioblasma species
(i.e., displaying females wall quickly close their shells
when touched, which can capture a host fish to facili-
tate infestation with glochidia on the host) ( Jones et al.,
2006).
Epioblasma florentina aureola new subspecies
Golden Riffleshell
Figures 5, 6, 11, 12
Diagnosis: The following diagnostic morphological
characteristics of E. florentina aureola are based on the
female and are summarized in Table 2: (1) gray mantle-
pad with a black mottled background, and (2) mantle-
pad has rounded pustules.
Page 86
THE NAUTILUS, Vol. 124, No. 2
E. capsaeformis 1 (A/=4)
E. capsaeformis 2 (AM)
E. capsaeformis 5 (A/=1)
E. capsaeformis 6 (AM)
E. capsaeformis 3 (N=2)
E. capsaeformis 4 (AM)
E. fiorentina aureola 1 (N=5)
E. fiorentina aureola 2 (A/=1)
E. fiorentina walkeri 1 (AMO)
E. fiorentina walkeri *
E. ahlstedti 1 (A/=9)
E. ahlstedti 2 (AM)
E. torulosa rangiana 1 (AM)
E. torulosa rangiana 2 (A/=3)
E. torulosa rangiana 3 (A/=2)
E. triquetra (AM)
E. brevidens (AM)
Figure 16. Cladogram showing phylogenetic relationships among Epioblasma ahlstedti , E. fiorentina aureola and congeners,
inferred from the combined mitochondrial DNA regions of 16'S (468 bp), cytochrome-b (360 bp), A’/J I (568 bp), the nuclear DNA
region ITS-1 (515 bp) and eight morphological characters (see Table 1) using maximum parsimony (MP) (31 equally parsimonious
trees were resolved; length=195 steps; 0=0.92; RI=0.89). Numbers above the branches (MP) represent bootstrap support (10,000
replicates); only values >50% are shown. All E. fiorentina walkeri were identical; however, to demonstrate the monophyly of this
population, an additional sequence was added to the analysis. Out-group taxa are E. triquetra and E. brevidens.
Description: Length of the female shell can reach
46 mm in Indian Creek and the upper Clinch River, with
mean length of 40 mm (Table 3). Shell lengths of males
are similar. The shell outline of females is sub-oval and
rounded with a moderately protruded shell expansion
(Figure 5). The mean height of the female shell expan-
sion is 5.7 mm or ~14% of shell length, but maximum
height can reach ~10 mm (Table 3; Figure 15). Dentic-
ulations occur along the margin of the shell expansion
and are fine and narrowly spaced ~0.5 mm apart. The
shell outline of males is elliptical, appearing pointed at
the posterior end (Figure 6), and may have a shallow
sulcus, especially older individuals. The periostracum of
adults can range from golden honey-yellow, to tan and
J.W. Jones and R. J. Neves, 2010
Page 87
Figure 17. Phylogenetic relationships. 17. A 50% majority-rule consensus tree (phylogram) showing phylogenetic relationships
among the ingroup taxa. The tree was produced from the same DNA sequences and morphological characters listed above and
evaluated using Bayesian inference. The analysis was run for 1 million generations with a burn-in of 40,000 generations (mean log
likelihood=-3,667). Numbers at the nodes are calculated posterior probabilities (>50%) indicating proportion of trees containing the
inferred nodes. Numbers in parentheses at the end of each taxonomic name represent the number of observed DNA haplotypes. * All
E. florentina walkeri haplotypes were identical; however, to demonstrate the monophyly of this population, an additional sequence
was added to the analysis. Out-group taxa are E. triquetra and E. hrevidens.
brown, but coloration is usually evenly distributed over
the shell, although occasionally the shell expansion of the
female is tinted green. The periostracum contains distinct
fine green rays that are evenly spaced over the shell. Nacre
color is white, but hues of blue and salmon may be present.
The color of the foot and gills of E. florentina aureola
is dull white. In females, only the two outer gills serve as
marsupia. Each marsupial water-tube contains a distal
pore to allow for release of glochidia. The mantle-pad
is gray with a black-mottled background and with
rounded pustules (Figures 11, 12). The dorsal margin
of the mantle-pad is tan, forming a discrete, uniform
band ~2-3 mm wide. Micro-lures are darkly colored,
and only a single micro-lure is prominently displayed.
Page 88
THE NAUTILUS, Vol. 124, No. 2
which moves slowly side-to-side in a sweeping motion
(Figure 12). The posterior portion of the mantle-pad is
invaginated where it meets the incurrent aperture, so
attachment points of the micro-lures cannot he seen
when the female is displaying. The undisplayed
microlure is obscured from view inside the invaginated
area of the mantle pad (Figure 12).
Type Material: Holotype: Designated herein as
OSUM 82239, collected by Leroy Koch, from type local-
ity, 1 Sep. 1998. Paratypes: OSUM 16266, Clinch
River, Route 460 Bridge, Cedar Bluff, Tazewell Co., VA,
collected by D.H. Stansbery and J.f. Jenldnson, 6 Oct.
1965; OSUM 42321, Clinch River, Route 460 Bridge,
Cedar Bluff, Tazewell Co., VA, collected by C.R. Ciola,
I July 1978; OSUM 42434, Clinch River, below railroad
bridge. Cedar Bluff, Tazewell Co., VA, collected by C.R.
Ciola and G. Wargowsky, 10 Aug. 1978; OSUM 43294,
Clinch River, below railroad bridge. Cedar Bluff, Tazewell
Co., VA, collected by J.M. Condit and C.R. Ciola, 15 July
1978; OSUM 53252, Clinch River, Cedar Bluff, Tazewell
Co., VA, collected by R. Taylor, 10 July 1983; OSUM
82240, Clinch River, Route 460 Bridge, Cedar Bluff,
Tazewell County, VA, collected by Leroy Koch, I Sep.
1998. (See Appendix for other material examined.)
Type Locality: Clinch River, Route 460 Bridge,
Cedar Bluff, Tazewell County, VA, 36°05/16.13,/ N;
81°46'05.98" W.
Comparison with Similar Species: The shell of adult
E. florentino walked ( sensu stricto ) in the Big South
Fork Cumberland River is of small to medium length
(~30-45 mm) (Table 3), and nearly indistinguishable in
shape and color to those of E. florentina aureola. The
mean height (8.5 mm) and maximum height (14.1 mm)
of the shell expansion of adult females is slightly
larger than that of female E. florentina aureola , but it
is not significantly greater (Table 3; Figure 15). The
periostracum color of both is honey-yellow, to tan and
brown, with fine green rays evenly spaced across the
shell. However, the following diagnostic morphological
characteristics of female E. florentina walked distinguish
it from E. florentina aureola-. (1) mantle-pad is brown
with a tan-mottled background (Figure 13); and (2) while
the mantle-pad also is pustuled, the pustules are pointed
and not rounded (Figure 14). The denticulations along
the margin of the shell expansion of the female shell are
larger and more widely spaced ~1 mm apart, compared
to those of E. florentina aureola. Similarities include
display of a single micro-lure, which moves slowly side-
to-side, and the dorsal margin of the mantle-pad is tan,
forming a distinctive band ~2-3 mm wide. Similarly the
posterior portion of the mantle-pad is invaginated where
it meets the incurrent aperture, so the attachment points
of the micro-lures cannot be seen when the female is
displaying.
Life History: The typical habitat of E. florentina aure-
ola is stable sand and gravel substrates in headwater
reaches of rivers and creeks. The subspecies is a long-term
brooder, gravid from late summer to the following spring
and early summer (Rogers et al., 2001). In Indian Creek,
females will emerge in spring and summer (April-July)
to display their mantle-pad lure to attract host fishes.
Based on an estimate from a single female, maximum fe-
cundity is at least 20,000 gloehidia (Rogers et ah, 2001).
However, mean fecundity based on six females during
this study was 7,602 gloehidia per female, ranging from
3,261 to 12,558 gloehidia (Table 4). Known fish hosts for
E. florentina aureola based on laboratory trials include:
greenside darter ( Etheostoma blennioides) , fantail darter
(£. flabellare ), redline darter (E. nifilineatum), snubnose
darter (£. simoterum), black seulpin ( Coitus baileiji ), mot-
tled sculpin (C. bairdi), and banded seulpin (C. carolinae )
(Jones and Neves, 2001; Rogers et ah, 2001).
Molecular DNA Markers ancl Phylogenetic Analysis:
The Indian Creek and upper Clinch River population
of £. florentina aureola contains presumably diagnostic
nucleotides at two mitochondrial DNA gene regions [cyto-
chrome-b (n=l), and ND1 (n=l)] (Table 2). Further,
based on analysis of 10 nuclear DNA microsatellite loci,
the population is diverged (Est=0.39) from the Big South
Fork Cumberland River population of £. florentina
walked (Jones et ah, 2006). The MP and Bayesian phylo-
genetic analyses showed high statistical support for the
£. florentina aureola clade (Figures 16, 17), a finding
previously reported by Jones et ah (2006).
Distribution: Epiobla.sma florentina aureola is cur-
rently restricted to the lower ~1.6 KM of Indian Creek
in southwestern Virginia (Figure 1). Historically, this sub-
species presumably occurred in numerous tributary
streams of the middle and upper Tennessee River system
downstream to the Duck River. However, all of these
historical populations are considered extirpated. There-
fore, the color and texture of the mantle pad and other
traits of those populations are unknown. Thus, it is
unknown whether these historical populations repre-
sented £. florentina aureola or other undescribed taxa.
Conservation Status: The Tan Riifleshell (£. florentina
walked) was listed as endangered under the ESA in 1977.
Now that £. florentina aureola has been designated herein
as a separate subspecies, the subspecies only occurs as a
single small population in the lower reach ot Indian
Creek, VA. This subspecies is one of the most critically
endangered populations of freshwater mussel in the
United States being linearly distributed to a short stream
section and highly susceptible to a stochastic event. This
subspecies should continue to receive maximum protec-
tion under the ESA.
Etymology: The subspecies name aureola is the
diminutive form of the Latin adjective for golden, and is
here chosen to denote the honey-yellow to occasionally
golden color of the shell.
Remarks: The anatomical characteristics of females,
such as the distal pores, mantle-pad, and micro-lure.
|.YV. (ones and R.J. Neves, 2010
Page 89
and the shell expansion with denticulations along the
margin of the shell are considered advanced traits among
unionids, based on their complexity and uniqueness to
Epioblasma (Jones et ah, 2006). the prominent shell
expansion of female E. ahlstedti is a defining trait first
recognized around the turn of the 20th century by the
American malacologist Bryant Walker (1856-1936). The
following undated letter was written by him and found in
a small box in the ANSP shell collection (ANSP 100538).
The letter was a hand-written note to a physician and to
our knowledge has never been published. The hand-
writing was difficult to read but was deciphered exactly
as is by JWJ, with assistance from Paul Callomon, Elana
Benamy, and Earle Spamer of ANSP, on 8 Jan. 2003:
“I also send some Truncillas [ Epioblasmas ] that
may be of interest. The Shoal Creek form is typical
capsaeformis as I understand it. The male of the
Duck R. form is very similar, but the females
have invariably the enormous expansion of the
specimen sent. In the Clinch, on the other hand,
the females are quite typical in form, but the males
are usually decidedly more elongated. The Duck
R. form has been generally called "turgidulus" but
it is not. Lea’s turgidulus is the male of deviata as I
proved to my own satisfaction, at least, while I was
in Washington.”
“P.S. The element of uncertainty in capsaeformis
matter is the fact that we don’t know what the $
form of the Cumberland is. The $ shell I had at
Phila. & which agreed best with Leas figure ol the
type was from the Duck R., variety expansa. The
only Cumberland R. $ I have seen is an immature
shell belonging to Ferris, and it is apparently like
the Tenn. R. & Shoal Crk. form. It the 9 Cumber-
land R. form is expansa like the Duck R. shell, that
would be typical capsaeformis & expansa could
not be used”.
These observations by Bryant Walker indicate that the
taxonomic position of the Duck River population was
being questioned nearly 100 years ago, and that the
expansion of the female shell was seen as a diagnostic
trait when compared to specimens collected from other
rivers in the region, including shells from the Clinch
River. In Walker’s view, the size of the shell expansion
of adult females is a signature phenotypic character,
reaching a mean and maximum height that is greater
than those of other species and subspecies belonging
to the Epioblasma subgenus Tondosa [sensu Johnson
(1978)]. Thus, the combination of key phenotypic traits,
especially the unique shell morphology and mantle-lure
display of females, unambiguously define E. ahlstedti as
a valid species.
The population of Epioblasma florentina aureola
in the upper Clinch River watershed is not deserving
of a separate species designation because of several
shared traits with E. florentina walkeri in the Big South
Fork Cumberland River: (1) honey-yellow to tan-
colored periostracum, (2) similar fish host specificity,
(3) pustuled mantle-pads, and (4) preference for head-
water stream habitats. These two populations also have
similar-sized gloehidia, similar fecundity, and are
closely related phylogenetically. In addition, the
periostracum color of the nominal species E. florentina
florentina is also yellow and was thought to simply
represent clinal variation; i.e., the large river form of
the subspecies complex. Ortmann (1918; 1924; 1925)
considered the two forms as merely clinal variants, a
claim supported by his observation that the big river
form appeared to grade into the headwater form as
one progressed upstream. However, based on the shell
material examined in Jones (2004) and Jones et al.
(2006), it is uncertain whether E. florentina florentina
merely represents clinal variation, a subspecies or per-
haps even a separate species for the following reasons:
(1) large distances of seemingly unoccupied habitat
commonly occurred between mainstem and headwater
populations (e.g.. Clinch and Holston rivers >200
RKM), and ecological conditions between mainstem
and headwater locations are substantial (e.g. distribution
of host fishes, water temperature, stream size, etc.); (2)
a transitional series of shells representing a continuously
distributed population of this species from mainstem to
headwaters does not exist ■ and (3) because most
populations are extirpated, additional genetic, morphol-
ogical and life history data are unobtainable. For exam-
ple, available specimens of E. florentina florentina
collected from the lower Clinch River near its mouth
are short (~30-35 mm), solid, and thick-shelled, and are
quite distinctive from the larger-sized headwater form E.
florentina aureola (Jones, 2004). However, because E.
florentina florentina is extinct, adequate comparisons of
the mantle-lure and DNA cannot be made with the
other subspecies. Therefore, since each nominally
described subspecies occurred or occurs in distinct geo-
graphic regions and habitats, we believe E. florentina
ssp. minimally was a polytypic species complex and best
categorized by the current trinomial designations.
The current taxonomy of Epioblasma recognizes 20
species and 5 subspecies (Turgeon et al., 1998; Williams
et al., 1993). Thus, with the description of E. ahlstedti
and E. florentina aureola , 21 species and 6 subspecies
now are recognized in the genus. The historical distribu-
tions of E. florentina aureola and E. florentina walkeri
are unclear because most populations are extirpated
and only shell material and collection records are
available to assess the distribution of each subspecies.
Furthermore, the anatomy of live individuals cannot
be compared among historical populations. Therefore, a
practical approach to delineating the distribution of
each subspecies is to consider all records of E. florentina
walkeri in the Tennessee River drainage as E. florentina
aureola , and all respective records in the Cumberland
River drainage as E. florentina walkeri. This approach
would simplify the management and recovery of each
subspecies within their respective river drainages.
Page 90
THE NAUTILUS, Vol. 124, No. 2
ACKNOWLEDGMENTS
Financial support for this project was provided by the
U.S. Fish and Wildlife Service (USFWS) and the
Tennessee Wildlife Resources Agency. We thank Brett
Ostby, Virginia Tech University, for assistance in
preparing the distribution map. We especially thank
Robert Butler, USFWS, Jim Williams, U.S. Geological
Survey (Retired), Daniel Graf, University of Alabama,
and an anonymous reviewer tor their respective peer
reviews of this work, which greatly improved the
manuscript. We also gratefully acknowledge G. Thomas
Watters and Clarissa Lawlis at the Museum of Biological
Diversity, Ohio State University for cataloging and
photographing the shell holotypes and paratypes, and
Jose H. Leal, The Bailey- Matthews Shell Museum, for
his assistance in preparing the figures. The views
expressed in this publication are the authors and do
not necessarily represent those of the USFWS.
LITERATURE CITED
Barnhart, M.C., W.R. Haag, and W.N. Roston. 2008. Adapta-
tions to host infection and larval parasitism in Unionoida.
Journal of the North American Benthologieal Society 27:
370-394.
Bowen, B.S. and W. Richardson. 2000. Genetic characteriza-
tion of Lampsilis higginsii. Final Report. U.S. Fish and
Wildlife Service, Bloomington, Minnesota, 36 pp.
Buhay, J.E., J.M. Serb, R. Dean, and C. Lydeard. 2002. Con-
servation genetics of two endangered unionid bivalve
species, Epioblasma florentina walkeri and Epioblasma
capsaeformis (Unionidae: Lampsilini). Journal of Mollus-
ean Studies 68: 385-391.
Burch, |.B. 1975. Freshwater Unionaeean Clams (Mollusea:
Peleeypoda) of North America. Malacologieal Publica-
tions, Hamburg, Michigan, 204 pp.
Campbell, D.C., J.M. Serb, J.E. Buhay, K.J. Roe, R.L. Minton,
C. Lydeard. 2005. Phylogeny of North American
amblemines (Bivalvia, Unionoida): prodigious polyphyly
proves pervasive across genera. Invertebrate Biology 124:
131-164.
Felsenstein, f. 1985. Confidence limits on phylogenies: an
approach using the bootstrap. Evolution 39: 783-791.
Felsenstein, J. 2004. Inferring phylogenies. Sinauer Associates,
Inc., Sunderland, 580 pp.
Huelsenbeck, J.P. and F. Ronquist. 2001. MrBayes: Bayesian
inference of phylogenetic trees. Bioinformatics 17: 754-755.
Johnson, R.I. 1978. The systematics and zoogeography of
Plagiola (= Djsnomia = Epioblasma ), an almost extinct
genus of freshwater mussels (Bivalvia: Unionidae) from
middle North America. Bulletin of the Museum of Com-
parative Zoology 148: 239-321.
Jones, J.W. 2004. A holistic approach to taxonomic evaluation
of two closely related endangered freshwater mussel
species, the oyster mussel ( Epioblasma capsaeformis )
and tan riffleshell ( Epioblasma florentina walkeri). M.S.
Thesis. Virginia Polytechnic Institute and State University,
Blacksburg, (available at: http://scholar.lib.vt.edu/theses/
available/etd-03302004- 153 1 27/)
Jones, J.W., R.J. Neves, S.A. Ahlstedt and E.M. Hallerman.
2006. A holistic approach to taxonomic evaluation of two
closely related endangered freshwater mussel species, the
oyster mussel ( Epioblasma capsaefonnis ) and tan riffleshell
( Epioblasma florentina walkeri). Journal of Molluscan
Studies 72: 267-283.
Jones, J.W. and R.J. Neves. 2001. Life history and artificial
culture of endangered freshwater mussels. Annual Report.
Tennessee Wildlife Resources Agency, Nashville, 90 pp.
King, T.L., M.S. Eackles, B. Gjetva, and W.R. Hoeh. 1999.
Intraspecific phylogeography of Lasmigona subviridis
(Bivalvia: Unionidae): conservation implications of range
discontinuity. Molecular Ecology 8: 65-78.
Kluge, A.G. 1989. A concern for evidence and a phylogenetic
hypothesis of relationships among Epicrates (Boidae,
Serpen tes). Systematic Zoology 38: 7-25.
Lydeard, C., M. Mulvey, and G.M. Davis. 1996. Molecular
systematics and evolution of reproductive traits of North
American freshwater unionaeean mussels (Mollusea:
Bivalvia) as inferred from 16S rRNA DNA sequences.
Proceedings of the Royal Society of London Series B 351:
1593-1603.
Merritt, T.J.S., L. Shi, M.C. Chase, M.A. Rex, R.J. Etter, and
J.M. Quattro. 1998. Universal cytochrome b primers facil-
itate intraspecific studies in molluscan taxa. Molecular
Marine Biology and Biotechnology 7: 7-11.
Naimo, T.S., E.D. Damschen, R.G. Rada, and E.M. Monroe.
1998. Nonlethal evaluations of the physiological health of
unionid mussels: methods for biopsy and glycogen analy-
sis. Journal of the North American Benthologieal Society
17: 121-128.
Nei, M., and S. Kumar. 2000. Molecular evolution and phylo-
genetics. Oxford, University Press, Oxford, 333 pp.
Nylander, J.A., F. Ronquist, J.P. Huelsenbeck, and J.E. Nieves-
Aldrey. 2004. Bayesian phylogenetic analysis of combined
data. Systematic Biology 53: 47-67.
Ortmann, A.E. 1918. The nayades (freshwater mussels) of the
upper Tennessee drainage with notes on synonymy and
distribution. Proceedings of the American Philosophical
Society 57: 521-626.
Ortmann, A.E., 1924. The naiad-fauna of the Duck River in
Tennessee. American Midland Naturalist 9: 18-62.
Ortmann, A.E., 1925. The naiad-fauna of the Tennessee River
system below Walden Gorge. American Midland Natural-
ist 9: 321-372.
Parmalee, P.W. and A.E. Bogan. 1998. The Freshwater Mussels of
Tennessee. University' of Tennessee Press, Knoxville, 328 pp.
Rogers, S.O., B.T. Watson, and R.J. Neves. 2001. Life history
and population biology' of the endangered tan riffleshell
( Epioblasma florentina walkeri) (Bivalvia: Unionidae).
Journal of the North American Benthologieal Society 20:
582-594.
Serb, J.M., J.E. Buhay, and C. Lydeard. 2003. Molecular sys-
tematics of the North American freshwater bivalve genus
Quadrula (Unionidae: Ambleminae) based on mitochon-
drial ND1 sequences. Molecular Phylogenetics and Evo-
lution 28: 1-11.
Swofford, D.L. 1998. PAUP* Phylogenetic analysis using parsi-
mony and other methods, computer program. Sinauer
Associates, Sunderland.
Turgeon, D.D., J.F. Quinn, A.E. Bogan, E.V. Qian, F.G.
Ilochberg, W.G. Ly'ons, P.M. Mikkelsen, R.J. Neves,
C.F.E. Roper, G. Rosenberg, B. Roth, A. Scheltema, F.G.
Thompson, M. Vecchione, and |. Williams. 1998. Common
and Scientific Names of Aquatic Invertebrates from the
United States and Canada: Mollusks. 2nd edition. AFS
(Continued)
Page 92
THE NAUTILUS, Vol. 124, No. 2
APPENDIX
(Continued.)
THE NAUTILUS 124(2):93-99, 2010
Page 93
New species of Bolma (Gastropoda: Vetigastropoda: Turbinidae)
from the tropical deep sea
Axel Alf
University of Applied Sciences Weihenstephan-Triesdorf
91746 Triesdorf, GERMANY
Philippe Maestrati
Philippe Bouchet
Museum National d’Histoire Naturelle
57 rue Cuvier
75231 Paris Cedex, FRANCE
ABSTRACT
Five new species of Bolma are described, three from
New Caledonia, one from Mozambique and one from French
Polynesia, all from deep reef (75-155 m) to bathyal (230-580 m)
depths. Four of the new species have been sequenced, and their
holotypes are also voucher specimens for COI sequences, thus
contributing to a new generation of name-bearing types. The
descriptions and names are provided in advance oi a forthcom-
ing shell-based revision of the genus Bolma , and in advance of a
detailed molecular- and morphology-based study ol Bolma in
New Caledonian waters.
INTRODUCTION
The gastropods of the turbinid genus Bolma Risso, 1826,
live at tropical and warm-temperate latitudes in the
Mediterranean, West African, South African, and Indo-
West Pacific biogeographical provinces; there are no
Bolma in the western Atlantic or eastern Pacific. With
the exception of the type species Bolma rugosa (Lin-
naeus, 1767), which occurs commonly near-shore to
about 200 meters deep, Bolma species are uncommon
to rare, mostly on hard bottoms between 100 and 500-
800 meters deep. Ben and Ponder (1979) revised the
Recent and fossil species, and recognized 19 valid spe-
cies (two of which with, respectively, 2 and 3 subspecies),
from among 29 nominal species. Ongoing explorations
have since added 12 more species, all from South Africa
and the Indo-West Pacific. Some of the t&xa treated by
Beu and Ponder as synonyms or subspecies have also
been re-evaluated, and the genus Bolma , with about 35
valid species, is the subject of a forthcoming monograph
by Axel Alf and Kurt Kreipl, to appear in the Concholog-
ical Iconography. The purpose of the present paper is
to describe several new species prior to the publication
of that monograph. Three of them originate from
New Caledonia, which has been intensively sampled
since the late 1970s through the Tropical Deep-Sea
Benthos program (Bouchet et al., 2008). Early in the
program, Bouchet and Metivier (1983) reported three
species of Bolma from New Caledonia, namely B. guttata
(A. Adams, 1863), B. henica (Watson, 1885), and
B. opaoana Bouchet and Metivier, 1983. Since then, the
program has been extended to other island groups in the
South Pacific and, more recently, in the Indian Ocean,
revealing still more species of Bolma. One of the new
species is thus described based on material collected from
seamounts surveyed off Madagascar in 1980, and then
again off Mozambique in April 2009. And finally, while
this paper was being put together, another very distinctive
new species was collected in September-October 2009 off
the Society/ Islands in French Polynesia.
One difficulty of Bolma systematic^ — in common with
other vetigastropods with their non-feeding short-lived
planktonic larvae — is the understanding of what consti-
tutes geographical vs. population variation (Meyer et al.
2005). In this respect, the Bolmas of New Caledonia and
the Solomon Islands have been the subject of molecular
work by Magalie Castelin, as part of her Ph.D. thesis, the
results of which wall be reported elsewhere. The purpose
of the present paper is also to provide names and facilitate
the presentation and discussion of this molecular work.
Abbreviations and Text Conventions: lv, live-taken
specimen; dd, empty shell; stn, station; MNHN, Museum
National d’Histoire Naturelle, Paris, France; NMNZ,
Museum of New Zealand Te Papa, Wellington, New
Zealand; NMP, Natal Museum, Pietermaritzburg, South
Africa; ZRC, Raffles Museum, Zoological Reference Col-
lection, National University, Singapore.
SYSTEMATICS
Family Turbinidae Rafinesque, 1815
Genus Bolma Risso, 1826
Type Species: Turbo rugosus Linnaeus, 1767 (by
monotypy).
Bolma castelinae new species
(Figures 1-7)
Description: Shell of average size for genus, trochoid
with straight sides, as tall as wide, spire angle about 75°,
Page 94
THE NAUTILUS, Vol. 124, No. 2
rather thin-shelled and light. Teleoconch of 6% whorls,
first two planispiral, subadult and adult whorls convex
with angular peripheral cord overhanging narrow, flat,
subsutural ramp, giving the impression of deep suture.
Basal cord delimiting distinct basal disc. Sculpture
consisting of beaded spiral cords, number of cords in-
creasing from single subsutural cord above periphery on
third whorl, to 3 on last 3 whorls, and with 3 additional
secondary cords on last 1/3 whorl behind aperture;
strong peripheral and weaker basal cords bearing short,
scaly spines; space between peripheral and basal cords
almost vertical, overall smooth except for one cord bear-
ing short, scaly spines; base smooth, polished. Columella
smooth and evenly rounded, thickened, but basal callus
indistinct. Aperture oval, outer lip sharp in holotvpe
(expanded in fully adult specimens). No umbilicus.
Background color pinkish salmon, beads, adapertural
side of spines, and interspace between peripheral and
basal cords lighter, base porcellaneous white; columella
white and nacreous, aperture nacreous within. Opercu-
lum thick, convex, smooth, white. Dimensions of holo-
type: height 25.2 mm, diameter 25.1 mm. Adults may
reach a height of 30 mm, diameter 28 mm.
Holotype: MNHN 22823 (lv).
Paratypes: I, MNHN 22824 [Ebisco, stn CP2579,
20°2T S, 158°40' E, 440-455 m, I Oct. 2005]; 1, MNHN
22840 [Halical 1, stn DW02, 18°54' S„ 163°24' E, 352-
397 m, 23 Nov. 1994]; 1, ZRC.MOL.2954 [Smib 4, stn
DW34, 24° 55' S, 168°22' E, 515 m, 7 March 1989];
1, NMNZ M. 297232 [Smib 4, stn DW34],
Material Examined and Distribution: More than
60 lots, until several hundred live-talcen specimens and
empty shells, from the Norfolk Ridge, mainland New
Caledonia off lie des Pins, Grand Passage between main-
land New Caledonia and Recifs d’Entrecasteaux, and
banks on Lord Howe Ridge, alive at depths between
350 and 580 meters. Not found during research cruises
to the Solomon Islands, Vanuatu, or Fiji.
Type Locality: South of New Caledonia: Norfolk
Ridge, Kaimon Mam Bank, 24045, S, 168°06; E, 600-
896 m [Norfolk 2, stn DW 2091],
Remarks: Tl iroughout their range, populations of
Bolma castelinae are remarkably stable in shape and
sculpture, and do not show geographical or bathymetri-
cal variation. In Magalie Castelin’s molecular tree (pers.
comm.), B. castelinae is nearest to a possibly new species
from the Solomon Islands tentatively identified by us as
B. cl. bartschii (Dali, 1913). The latter has a peripheral
cord with fewer, stronger spines, overhanging a broader,
concave subsutural ramp; the spiral cords are broad,
with narrow interspaces; and the basal disc is sculptured
with headed cords and bears a thin callus. Of the species
present in New Caledonia, B. castelinae most resembles
B. recens (Dell, 1967), but molecular analyses have con-
firmed that they are distinct. B. castelinae always has
3 rows of short scaly spines on the middle part of the last
whorl: one on peripheral and basal angles and one
between them, and a smooth and glossy base. In
B. recens, the central row of spines is weak or absent,
and flanked by numerous spiral grooves, and the basal
disc is sculptured with concentric cords.
Etymology: The species is named after Dr (Ms)
Magalie Castelin, whose molecular work has resulted in
robust species delimitations in the genus Bolma.
Bolma pseudobathyraphis new species
(Figures 8-14)
Bolma guttata — Bouchet and Metivier, 1983: 10, figs. 4-6
[not figs. 7-8, which represent B. fuscolineata Alf and
Kreipl, 2009] .
Description: Shell large for genus, trochoid with veiy
convex whorls, taller than wide, spire angle about 75°,
rather thin shelled and light. Teleoconch of 7 to 714
whorls, first 2 whorls planispiral, next 3 rather flat-sided,
last two strongly convex with narrow, flat, subsutural
ramp and overhanging peripheral cord, giving impres-
sion of a veiy deep, channelled suture. Periphery and
basal cords weakly delimited, peripheral cord bearing
row of short to very short, triangular, scaly spines which
become evanescent near the peristome. Sculpture of
fine, prosocline, axial lamellae extending on spire as well
as on base, and strong, beaded spiral cords; on third
whorl, single subsutural cord above periphery number
increasing to 4 on penultimate whorl, and to 7 on last
whorl; space between peripheral and basal cords with
three cords, central one stronger, bearing short scaly
spines; base with 5 beaded cords. Columella smooth
and evenly rounded, basal callus thick around columellar
margin, thin on basal disc. Aperture oval, outer lip
expanded, but not flaring, in adult specimens. No umbi-
licus. Background color light brown or light purple, occa-
sionally more white or pink, distinctly darker above
periphery, and with or without small, purple-brown spots
between the beads on spire as well as on base. Columella
white and nacreous, aperture nacreous within. Opercu-
lum thick and heavy, oval with convex, sometimes wrin-
kled, surface, white. Dimensions of holotype: Height
42 mm, diameter 37.5 mm, operculum largest diameter
17.1 mm.
Holotype: MNHN 22825 (lv).
Paratypes: 1, MNHN 22826, same locality as holo-
type; E ZRC.MOL.2955 [Smib 4, stn DW65, 22° 55' S,
167° 15' E, 400-420 m, 10 Mar. 1989]; 1, NMNZ
M. 297233 [Smib 2, stn DW6, 22°56' S, 167°16' E, 442-
460 m, 17 Sep. 1986].
Material Examined and Distribution: Bolma
pseudobathyraphis is the most abundant Bolma species
in New Caledonia, with about 200 lots comprising ca.
1000 live-taken specimens and shells, from the Norfolk
Ridge, mainland New Caledonia off lie des Pins, Grand
Passage between mainland New Caledonia and Recifs
d’Entrecasteaux, banks on Lord Howe Ridge, and the
A. Alfetal.,2010
Page 95
Loyalty Ridge, alive at depths between 240 and
530 meters. Not found during research cruises to the
Solomon Islands, Vanuatu or Fiji.
Type Locality: Norfolk Ridge, south of New Caledo-
nia, 23°42' S, 168° 16' E, 377 m [Norfolk 2, stn CP2050,
24 Oct. 2003]
Remarks: Bolma pseudobathijraphis is very stable in
shape, sculpture and size, except on Lord Howe Ridge
where there exists a morph with long spines on the
periphery (Figure 14), which however is not molecularly
distinct.
Rouchet and Metivier (1983) had assigned their New
Caledonia material to Bolma guttata (A. Adams, 1863),
because of its superficial resemblance to the Indian
Ocean populations described as Bolma bathyraphis
(E.A. Smith, 1899), treated by Ben and Ponder (1979) as
a subspecies of B. guttata. However, B. pseudobathijraphis
differs from B. bathyraphis by its veiy convex whorls and
deep suture, and a spiral sculpture of spiny, rather than
rounded, beads. Juveniles of B. pseudobathijraphis also
superficially resemble B. fuscolineata Alf and Kreipl,
2009, and had been confused with it by Bouchet and
Metivier (1983), but they differ by their much higher last
whorl and aperture, more widely spaced peripheral and
basal cords, and more uniform color pattern (Figures 11-
12 vs. 15-16).
In Magalie Castelin’s molecular tree, Bolma
pseudobathijraphis is nearest to to B. millegranosa
(Kuroda and Habe, 1958) and to material from off
Mozambique identified by us as B. gilchristi (Sowerby,
1903) [which may or may not be a synonym of
B. bathyraphis]. Bolma millegranosa and B. gilchristi have
smaller adult size, less convex whorls, and a peripheral
cord situated veiy low on the whorl, bearing long
deltoid spines on the periphery, albeit shorter in gilcli risti
than in millegranosa. Bolma millegranosa also differs
by having a flaring outer lip in fully adult specimens.
Two other species which have not been sequenced
resemble Bolma pseudobathijraphis because of their rel-
atively high spire, namely B. girgylla (Reeve, 1843) and
B. kermadecensis Beu and Ponder, 1979. Bolma girgylla
is broadly distributed but rare in the Southwest Pacific
(including New Caledonia); it differs by its flatter base,
primary rows of wide, bilobed spines on the peripheral
and basal cords, and the orange color of the columellar
callus covering only part of the umbilical region. Bolma
kermadecensis, only known from the dead and worn
holotype from the Kermadec Islands, also has a flatter
base, and has a dark pinky fawn color.
Etymology: From its superficial resemblance with
Bolma bathyraphis, with which it had originally been
identified.
Bolma kreipli new species
(Figures 17-20)
Description: Shell small for genus, trochoid, slightly
taller than wide, spire angle 70°, thick and solid.
Teleoconch of 5 3A whorls, first two whorls planispiral,
third whorl with flat sides, last two whorls rather convex
with low peripheral cord bearing strong, projecting
spines (the spines were significantly chipped during
shipping after the photos were taken), basal cord weakly
delimiting convex base. Sculpture of indistinct, fine axial
lamellae and beaded spiral cords, number of cords in-
creasing from 4 on third whorl to 10 above periphery of
last whorl, adapical cord stronger; interspace between
periphery and basal cord with 3 beaded cords; base axi-
ally (radially) lamellate with 6 beaded cords, unevenly
spaced with gap between the 2 cords that surround
umbilical callus and rest of cords. Columella smooth
and evenly rounded, bearing an indistinct tooth
abapically, basal callus veiy thin, transparent, aperture
oval, outer lip barely expanded. No umbilicus. Color
and color pattern variable, background color creamy
white, light brown or beige, with irregular purple, red or
brown flames, base with purple dots irregularly placed
between beads. Columella white, aperture nacreous
within. Operculum thick and heavy, oval with a convex,
wrinkled surface and small, flat marginal edge, white.
Dimensions of holotype: height 14.2 mm, diameter
13.5 mm. Operculum diameter 4.9 mm.
Holotype: MNHN 22827 (lv).
Paratype: 1 (lv), MNHN 22828, from 22°32’S,
167°32/E, 155 m, 9 Sept. 1989 [Smib 5, stn DW82],
Other Material Examined: Musorstom 4: stn
DW203, 22° 36' S, 167°05' E, 105-110 m, 27 Sept. 1985,
2 dd. Lagon: stn 316, 22°35.3/S, 166°54.0' E, 68 m, Nov.
1984, 1 lv; stn 386, 22°37' S, 167°09’ E, 128 m, Nov. 1984,
1 dd; stn 397, 22°39' S, 167° 11' E, 125 m, Nov. 1984, 1 lv.
Type Locality: Between New Caledonia and lie des
Pins, 22°34' S, 167° 10' E, 75 m [Musorstom 4, stn
DW231, I Oct. 1985],
Discussion: We have had no molecular material of
Bolma kreipli, and our comparisons are entirely based
on phenotypic resemblance. Bolma kreipli resembles
B. persica (Dali, 1907) but differs from it by its overall
higher shape, more convex whorls and base, less angular
periphery and basal angle, distinct periumbilical cords,
and non-nacreous columella. At 22 mm, Bolma persica
also reaches a larger adult size than B. kreipli.
Etymology: After Kurt Kreipl, an authority on Bolma
and other turbinids.
Bolma mainbaza new species
(Figures 21-24)
Description: Shell medium-sized for genus, trochoid,
as tall as wide, spire angle about 75°, rather thin shelled.
Teleoconch of 6 whorls, first 2 whorls planispiral, next
whorls regularly convex, separated by narrow, deep
suture; on spire whorls, peripheral cord covered by suc-
cessive whorl, on last whorl not demarcated and re-
sembling any of the spiral cords; basal cord distinctly
Page 96
THE NAUTILUS, Vol. 124, No. 2
Figures 1-16. Bolma species from New Caledonia. 1-7. Bolma castelinae new species. L-3. Holotype, MNI4N 22823, height
25.2 mm. 4. Paratype, MNIIN 22840, adult witli fully developed outer lip, 18°54' S, 163°24' E, 352-397 m [Halical 1, stn DVV02],
height 27,5 mm. 5-6. Juvenile, 24°56' S, 168°22' E, 520 m [Smib 3, stn DW01], height 9.7 mm. 7. Holotype, detail of last whorl. 8-14.
Bolma pseudohathyraphis new species. 8-10. Holotype, MNIIN 22825; height 42 mm. 11-12. Juvenile, 18°56S, 163°24'E, 380-400 m,
Halical 1, stn DW01], height 8,5 mm. 13. Holotype, detail of last whorl. 14. Specimen with unusually spinose sculpture, 24” 45 S,
159° 43' E, 328-463 m [Ebisco, stn CP2505], height 34.6 mm. 15-16. Bolma fuscolineata Alf and Kreipl, 2009, 22°56' S, 167” 15' E,
427-433 m [Norfolk 1, stn DW1733], height 8.6 mm.
A. Alfetal.,2010
Page 97
Figures 17-28. Bolma species. 17-20. Bolma kreipli new species, holotype, MNHN 22827, height 14.2 mm. 21-24. Bolma
mainbaza new species, holotype, MNHN 22829, height 21.2 mm. 25-28. Bolma tantalea new species, holotype, MNHN 22831, height
23.4 mm.
Page 98
THE NAUTILUS, Vol. 124, No. 2
stronger, delimiting poorly defined basal disc. Sculpture
of fine prosocline lamellae and beaded spiral cords,
number above peripheral cord increasing from 2 on
third whorl, to 6 on penultimate whorl and 9 on last
whorl, adapical cord stronger; peripheral cord bearing
spines on spire whorls, simply beaded on last whorl;
interspace between peripheral and basal cords bearing
one beaded cord. Base moderately convex, sculptured by
5 beaded cords, unevenly spaced, with gap to basal cord.
Columella smooth and evenly rounded, with thin,
polished basal callus extending over the base. No umbi-
licus. Outer lip expanded in adult specimens. Back-
ground color light pinkish brown to fawn, beads usually
lighter, white to brown, not forming any pattern. Colu-
mella porcellaneous white. Operculum ovate, outer side
white, regularly convex, weakly pustulose at center.
Dimensions of holotype: Height 21.4 mm, diameter
20.4 mm, operculum largest diameter 8.6 mm. Largest
specimen reaching a size of about 24 mm.
Holotype: MNHN 22829 (lv).
Type locality: Mozambique Channel, off southern
Mozambique, Almirante Leite Bank, 26° 12' S, 35°02' E,
228-230 m [Mainbaza, stn DW3167, 16 April 2009].
Paratypes: 14: MNHN 22830, I 1 (6 lv, 5 dd); Natal
Museum L7886/T2579, 1 (lv); Museu de Historia Natu-
ral de Maputo, Mozambique, 1 (dd); Coll. J. Rosado,
Maputo, 1 (lv); all from the type locality.
Remarks: Magalie Castelin has obtained DNA from
the tissues of this new species, but sequencing has, at the
time of writing, been unsuccessful. Our comparison with
other species is thus purely phenotypical. Of the six spe-
cies of Bolma recorded until now from the southwestern
Indian Ocean, Bolma mainbaza resembles B. flava Beu
and Ponder, 1979 [a full species, or a geographical sub-
species of B. tamikoana (Shikama, 1973), as treated by
Beu and Ponder] but the latter differs by having more
depressed whorls, a distinct, spine-bearing peripheral
cord, more numerous and finer spiral cords (10 above
periphery of last whorl, 3 between peripheral and basal
cords, 16 on base), and a color pattern consisting of
brownish to purplish flames on a yellowish background;
B. mainbaza lacks spines and is fawn-colored with irreg-
ularly scattered, small, well defined brown spots.
Etymology: Named after the cruise Mainbaza, an
acronym for MAputo, /Miambane, BAzaruto and
ZAmbeze, Mozambique localities off of which deep-
water transects were carried out.
Bolma tantalea new species
(Figures 25-28)
Description: Shell of average size for the genus, tro-
choid, slightly broader than tall (h/d — 0.95), spire angle
about 85°, shell thick and solid. Teleoconch of about
5.5 whorls, suture shallow, adapical whorls almost flat,
last whorl moderately convex, periphery and basal disc
poorly demarcated. First 2.5 teleoconconeh whorls
smooth between subsutural, strongly beaded cord and
peripheral cord bearing blunt spines, 14 per whorl, cov-
ered by successive whorl. Subadult and adult whorls with
narrow smooth ramp adapically of subsutural cord, addi-
tional spiral beaded cords occupying space between
subsutural and spineless, peripheral cord; 4 cords on 3rd
whorl, 5 on exposed part of penultimate whorl, 7 plus a
couple of secondary ones above periphery of on last
whorl; 2 primary and 2 secondary cords between periph-
ery and basal angle, beads on periphery and basal cord
coalescent. Base slightly convex, sculptured with 2 weakly
beaded and ea. 12 smooth spiral cords that become'
obsolete toward columellar region. Columella smooth
and evenly rounded, umbilicus closed by thick, slightly
yellowish white polished callus, covering about 1/3 of
the basal disc. Outer lip hardly reflected at all. Back-
ground color pinkish ivory, with darker, 1 irownish-purple
axial veins. Columella and aperture nacreous. Opercu-
lum rounded, outer side white, nucleus veiy slightly
depressed, greenish brown. Dimension of holotype:
Height 23.4mm, diameter 26.3nnn, operculum largest
diameter 10.0 mm.
Holotype: MNHN 22831 (lv).
Paratype: MNHN 22832, 1 (dd) from off Raiatea,
Society Islands, 16°53' S, 151°2T W, 440-490 m, 18
Oct. 2009 [Tarasoc, stn DW3451],
Material Examined and Distribution: Only known
from the type material and several fragments from the
western part of the Tuamotus chain attributed to the
species.
Type Locality: French Polynesia, Society Islands,
Tahiti, 17°48' S, 149°22' W, 390-790 m [Tarasoc, stn
DW3488, 23 Oct. 2009],
Remarks: Bolma tantalea is veiy distinctive among
South Pacific Bolmas by its veiy compact overall appear-
ance. It vaguely resembles B. recens which differs by a
pointed spire, deep and often even canaliculate suture,
well marked peripheral and basal angles separated by an
almost flat interspace, a spiral sculpture with fewer (usu-
ally up to 5 above periphery) beaded cords and short
triangular spines on the periphery, at least on spire
whorls. Spineless forms of Bolma tamikoana can be sep-
arated by their orange columellar callus. Bolma opaoana
has a pointed spire and its color is fawn with brownish
flames, and a slight orange blotch on the columella and
columellar callus. Bolma midwaijensis Habe and Kosuge,
1970, has a pointed spire and deep suture, and its color is
whitish with pink clouds.
Etymology: Tantaleus, - a , -um, is an adjective formed
after Tantalus, the mythological character symbolic of
torment. During the Tarasoc cruise only tantalizing shell
fragments were first sampled, then during the third week
a broken adult was taken, and the live-taken holotype
was finally obtained after more than 120 dredge hauls,
just three days before the end of the cruise.
A. All et al., 2010
Page 99
ACKNOWLEDGMENTS
The New Caledonia material originates From many
cruises listed by Bouchet et al. (2008), and we are
especially grateful to our colleagues Marie-Catherine
Boisselier, Magalie Caste lin, Pierre Lozouet, Bertrand
Richer de Forges, and Sarah Samadi for companionship
at sea and unpublished molecular results in the
laboratory. The specimens from off Mozambique were
collected by R.V. Vizconde de Eza during the MAIN-
BAZA cruise in April 2009. The cruise was operated by
Museum National d’Histoire Naturelle (MNHN) and
Institute Espahol de Oceanografia (IOE), as part of a
cluster of Mozambique-Madagascar expeditions funded
by the Total Foundation, Prince Albert II ol Monaco
Foundation, and Stavros Niarchos Foundation, and
conducted by VI N 1 1 N and Pro-Natura International
(PNI). Philippe Bouchet is grateful to Ana Ramos and
Eduardo Balguerias for making this cruise possible.
Like many other expeditions in the Tropical Deep-Sea
Benthos program, the Tarasoc cruise took place on
board IRD’s (Institnt de Recherche pour le Developpe-
ment) R.V. Alis, and its success owes much to the skills
ol its officers, Raymond Proner, |ean-Franyois Barazer
and Loi'c Le Gofl. Finally, we are grateful to Magalie
Castelin tor having made her molecular results available
to us to facilitate species-level comparisons ol the new
species described in this paper.
LITERATURE CITED
All, A. and K. Kreipl. 2009. An updated list of the recent Bolma
species (Gastropoda: Turbinidae) with description of two
new species from French Polynesia and New Caledonia.
Novapex 10: 17-24.
Beu, A. and W. Ponder. 1979. A revision of the species of
Bolma Risso, 1826 (Gastropoda: Turbinidae). Records of
the Australian Museum 32: 1-68.
Bouchet, P. and B. Metivier. 1983. The genus Bolma (Mollusca:
Gastropoda) in the bathyal zone of New Caledonia, with
description of a new species. Venus 42: 8-12.
Bouchet, P., V. Heros, P. Lozouet, and P. Maestrati. 2008.
A quarter-century ol deep-sea malacologieal exploration in
the South and West Pacific: Where do we stand? How far to
go? Tropical Deep Sea Benthos, volume 25. Memoires du
Museum National d’Histoire Naturelle 196: 9-40.
Meyer, C.P, J.B. Geller, and G. Paulay. 2005. Fine scale
endemism on coral reefs: archipelagic differentiation in
turbinid gastropods. Evolution 59: 113-125.
THE NAUTILUS 124(2): 100-106, 2010
Page 100
The use of aquatic plants by populations of the zebra mussel
( Dreissena polymorpha) (Bivalvia: Dreissenidae) in a small
glacial lake
B.L. Bodamer1
M.L. Ostrofsky2
Biolog)' Department
Allegheny College
Meadville, PA 16335
ABSTRACT
We examined the early life history of the zebra mussel
(. Dreissena polymorpha) in a small Pennsylvania lake with lim-
ited natural hard substrate. Veligers first appear in May, and
settled on Nuphar (Yellow Water Lily) stems and concrete sub-
strates in equal densities. Later cohorts, however, did not settle
on the stems. Juveniles on stems abruptly abandoned their
attachment in late August as the plant tissue began senescence.
Aquarium experiments demonstrated that juveniles retained the
ability to seek and find alternate substrates even after several
months. Year-old zebra mussels were markedly unsuccessful in
comparison. We speculate that in lakes with limited natural hard
substrates aquatic plants may play an important role in zebra
mussel recruitment, although juveniles must be able to locate
alternate substrates as plant populations senesce at the end
of the season. The resulting high mortality may limit mussel
populations in these lakes.
Additional keywords: Invasions, substrate, life history, aquatic
macrophytes
INTRODUCTION
Following the introduction of the zebra mussel ( Dreissena
polymorpha) to Lake St. Clair in the 1980s, much atten-
tion has been focused on the rapid dispersal and the
environmental requirements of this invader (Griffiths
et al. 1991, Strayer 1991, Hincks and Mackie 1997).
Ludyanskiy et al. (1993) predicted that by the year 2000
the zebra mussel would inhabit all of North America’s
rivers, lakes, and reservoirs that fit within its broad range
of ecological requirements. However, due to the limita-
tions of overland dispersal the invasion of small inland
lakes disconnected from navigable waters is taking much
longer than initially anticipated (Kraft and Johnson 2000,
1 Current address: The Lake Erie Center, University of Toledo,
6200 Bayshore Rd, Oregon, OH 43618 USA
“ Corresponding author: [email protected]
Bossenbroek et al. 2001). The glaciated portion of north-
western Pennsylvania, for example, has eight natural
lakes all between 18 and 74 km from the south shore of
Lake Erie, the most immediate source of veligers and
adults, and all meeting the ecological requirements of
D. polymorpha. To date, however, only two of them have
established populations of D. polymorpha (Butkas and
Ostrofsky, 2006) in spite of considerable recreational boat
traffic among these inland lakes, and between these lakes
and Lake Erie where D. polymorpha was first observed
in 1989 (Griffiths et al. 1991). Observations from other
inland lake districts in Illinois, Indiana, Michigan,
New York, and Wisconsin have reported similarly slow
dispersal and colonization (Miller and Haynes 1997, Kraft
and Johnson 2000, Johnson et al. 2001). Consequently,
the bulk of the published North American work on
D. polymorpha has been from the Great Lakes and major
river systems. The effects of this invader on small, inland
lake ecosystems have received far less attention.
One of the characteristics of lakes in northwestern
Pennsylvania and lakes in similar geographical settings
is the relative paucity of natural hard substrates. These
lakes tend to be small, with limited wind-generated wave
energy to move fine sediments offshore. This combina-
tion of characters results in lakes with soft, muddy or
peaty sediments right up to a shoreline that transitions
through a zone of floating-leaved and emergent aquatic
vascular plants. Rock outcrops and gravel bars are excep-
tionally rare. With the exception of the shells of native
unionid mussels, the hard substrates that do exist are
invariably man-made: docks, pilings, retaining walls, boat
hulls, and waterlogged pieces of wood and other debris.
Several studies have suggested that the colonization suc-
cess and ultimate carrying capacity of D. polymorpha
populations is determined by the availability of suitable
hard substrates for attachment rather than by the quality
and quantity of filterable food resources (Brady et al.
1995, Grigorovich and Babko 1997, Lewandowski 2001,
Burlakova et al. 2006). There have been several studies
that investigate the relative preferences displayed lor
B.L. Bodamer and M.L. Ostrofsky, 2010
Page 101
substrate type, orientation, and texture by settling
D. polymorpha veligers (Marsden and Lansky 2000,
Kobak 2004, Czarnolyski, et al. 2004) but one possible
substrate that has not received much attention is the
surface of aquatic vascular plants (Lewandowski 2001).
Dreissena polymorpha is known to attach to aquatic
vascular plants (Horvath and Lamberti 1997, Diggins
et al. 2004, Musko and Bako 2005). Hence, vascular
plants may play an important role in the establishment
and persistence of invasive populations in lakes with lim-
ited alternate hard substrates. However, while aquatic
vascular plants offer considerable surface area, and often
grow in dense stands that confer attached mussels some
protection from predation by fish, they are seasonal and
lack long term stability (Grigorovich and Babko 1997,
Ozimek 1997). Most species rapidly senesee with the
onset of cooler weather and shorter day lengths. To
survive, attached biota must have the ability to abandon
senescent plants and seek another, more permanent
substrate.
In order to fully understand the ecology of the zebra
mussel and the impacts it will cause as it continues to
spread throughout North America, it is essential that we
understand species interactions within small-lake ecosys-
tems. In this study, we examined the early life history of a
zebra mussel population in a small inland lake in Pennsyl-
vania. We were particularly interested in the potential role
of aquatic vegetation in a lake that otherwise provides lew
hard substrates. We sought to determine if aquatic plants
could provide a substrate that was as acceptable to settling
D. polymorpha veligers as more traditional hard sub-
strates, and if, at the end of the vegetative growing season,
settled juveniles retained the capacity to seek alternate
substrates as the plant tissue senesced.
MATERIALS AND METHODS
All fieldwork was conducted in Sandy Lake, a small
(~ 60 ha), moderately hard (total alkalinity ~ 70 mg/L)
kettle lake located in Mercer County, Pennsylvania (41°
20.7 L N, 80°06.43’ W). Sandy Lake has a drainage basin
area of only 7.2 km" consisting mostly of forest (52.6%)
and low intensity agriculture (pasture/hay 39.7%, row
crops 3.6%; USGS, 2000). Although no bathymetric
map has been made to date, the maximum noted depth
was 12 m. The lake stratifies from May through mid-
October, with the thermocline at approximately 5 m.
Hypolimnetie water below 9 m became anoxic by
early July. Springtime total phosphorus concentration
(~ 13 ug/L) and summer average Secchi disk visibility
(3.5 m) suggest that the lake is oligo-mesotrophic
(Ostrofsky, unpubl.). Sandy Lake is used primarily for
fishing, swimming, and waterskiing. Dreissena polymorpha
were first observed in the lake in 2000 (J. Widel, Lakeside
Park Co., personal communication) and have been a con-
spicuous feature on hard surfaces ever since.
Water samples for the enumeration of planktonic veli-
gers were collected weekly from three mid-lake locations
from mid-May to late-October 2004 (Figure 1). Two
liters of epilimnetic water from each location were fil-
tered through 0.45 pm membrane filters. Filters were
dried, cleared with immersion oil, and mounted on
slides. Veligers were identified using cross-polarized
microscopy (Johnson 1995). Lengths of 200 (or n, if
n< 200) veligers were measured to the nearest 10 pm
using an ocular micrometer.
We monitored settlement of juvenile D. polymorpha
on both artificial substrates and aquatic vascular plant
surfaces. We used 0.093 m2 concrete tiles (12"xl2")
placed in three lake locations (Figure 1) at a depth of
approximately 1.5 meters. Tiles were put in the lake in
May and retrieved in late August/September after veli-
gers had disappeared from the water column. Juveniles
found were preserved in 70% ethanol. The length of
each juvenile was measured to the nearest 0.1 mm using
a dissecting microscope and an ocular micrometer. We
monitored the settlement of juvenile D. polymorpha on
the submersed stems of the Yellow Water Lily Nuphar
variegata. We collected ten individual stems (~0.75 m in
length) from each of live macrophyte beds around the
lake at weekly intervals from mid-May through Septem-
ber. Each stem was scraped to remove all attached
organisms. All scrapings were preserved in 70% ethanol
until examined. The total number of juveniles found on
each stem was recorded. For each date sampled 200 (or
n, if n< 200) juveniles were randomly selected and mea-
sured to the nearest 0.1 mm. Both veligers and settled
juveniles were grouped into size classes and size-
frequency graphs were constructed to estimate spawning
and settling cohorts across the growing season.
To determine the ability of D polt/moipha to migrate
to alternate substrates we suspended lake-collected mac-
rophyte stems with 100 attached juvenile mussels in
coarse mesh netting at the surface of each of 3 replicate
37 L (10 gal.) aquaria in the lab. The bottom of each
aquarium was covered with a patchwork of unglazed
ceramic tiles (15x15 cm) and fine lake sediments in a
LI substrate/sediment ratio. Each tank was filled with
aerated lake water. After two weeks the macrophyte
Figure 1. Map of Sandy Lake, Pennsylvania showing sam-
pling locations for Dreissena polymorpha veligers, Nuphar
beds, and artificial substrates.
Page 102
THE NAUTILUS, Vol. 124, No. 2
stems had seneseed, and stems, tiles, and sediments
were examined for juveniles. We used to test the null
hypothesis of random settling (frequencies on tiles =
frequencies on soft sediment).
To examine differences in the ability to seek and find
new substrate as a function of mussel age, we established
8 replicate 37 L aquaria in the lab, each with fine lake
sediment, aerated lake water, and a single tile giving a 1:5
tile to soft sediment ratio. To each aquarium we intro-
duced 5 juvenile (6-1 1mm) and 5 adult (20-30 mm)
D. polymorpha individuals to the soft sediment. Very
few lake-collected mussels were found between 11 and
20 mm suggesting that these two size classes were from
different spawning seasons. Tiles were examined daily
and the number of juveniles and adults eensused for
1 week. The rates at which juvenile vs. adult mussels
accumulated on the tiles was taken as a measure of their
ability to find alternate substrates.
RESULTS
Veligers were first observed in the plankton in late May
when the epilimnetic water temperature was 21°C.
There were no significant differences (p > 0.05, ANOVA)
in veliger densities among the three lake sampling sites so
data from all sites were pooled. Veliger density increased
rapidly to a maximum of 17,500/m3 (± 5,635 s.e.) in late
June, then rapidly decreased, disappearing from the
plankton by early August (Figure 2). Measured veligers
varied in length from 60 to 250 pm, and size-frequency
analysis (Figure 3) and changes in density suggest the
presence of three cohorts: large ones in late May and late
June, and a veiy much smaller one in late July.
Settled larvae first appeared on Nuphar stems in late
June (Figure 4), reaching maximum densities in mid-July
of 62 (±20.7 s.e.) individuals per stem (approximately
1 individual/cm"). Settled juveniles showed a strong ten-
dency to aggregate on a few stems rather than to accu-
mulate evenly among all available stems. In 50% of the
25000 a
20000 -
O h- CO O CO CO T- CD CNJ
CM CNJOCNJ COOt-CNCNI O x-
lo lo co cooo
Date
Figure 2. Mean Dreisseua polymorpha veliger densities (± 1
std. error) in the epilimnion of Sandy Lake.
site x date collections the varianceunean ratio of settled
juveniles on stems was significantly greater than one
(yy-test). The smallest measured juveniles were 200 pm,
approximately the same as the maximum veliger size in
A B C D E
Size Class
Figure 3. Size-frequency distribution of Sandy Lake Dreissena
polymorpha veligers. Lines separate different cohorts suggested
by both density and size distribution data. Size class A = <110 p,
B = 111-150 p, C = 151-190 p, D = 191-230 p, E = >231 p.
B.L. Bodamer and M.L. Ostrofsky, 2010
Page 103
Figure 4. Mean density of juvenile Dreissena polymorpha
(± 1 std. error) on stems of Nuphar variegata in Sandy Lake.
the plankton. Visual analysis of size-frequency data of
the settled juveniles on stems (Figure 5) suggested
only a single cohort with high initial mortality (77%)
but very little mortality after late July. Juveniles
abruptly disappeared from stems after late August. Adult
D. polymorpha between 6 and 17 mm in length were
occasionally observed attached to Nuphar stems, partic-
ularly early in the season. Individuals of this size were
undoubtedly from the previous growing season. Con-
crete tiles collected at the end of the summer had densi-
ties of settled juveniles ranging from 0.11 to 2.69
individuals per cm" (mean =1.0, s.e. = 0.9). There was
no significant difference between the density of settled
juveniles on concrete tiles and the maximum density
measured on Nuphar stems (p > 0.05, t-test).
In the laboratory experiments approximately half
(46%) of the juveniles on suspended vascular plant stems
in the aquaria abandoned their attachment sites within
two weeks as the stem senesced (Table 1). We antici-
pated equal numbers would be recovered from the tiles
and from soft sediments if displaced juveniles were inca-
pable of migrating to firm substrates. We found that all
of the displaced juveniles were recovered either on the
tiles (26.7T7.7 s.e.) or attached to the aquarium walls
(19.0T5.1 s.e.). None was recovered from the soft sedi-
ment. Those that remained attached to the plant mate-
rial were assumed to be dead.
In the migration experiment comparing juveniles
and adults, juveniles were found on the tile early and their
numbers steadily increased (Figure 6). Adults appeared
on the tiles late and in veiy small numbers. Bates of arrival
on the hard substrate were 3.54 and 0.29 individuals/day
for juveniles and adults, respectively. These rates were
significantly different (p < 0.05, t-test lor slopes).
DISCUSSION
An overview of the life history of Dreissena polymorpha
given by Ludyanskiy et al. (1993) based largely on the
A B C D E F G
Size Class
Figure 5. Size-frequency distribution of juveniles on Nuphar
variegata stems. Data suggest a single cohort. Size class
A = <400 p, B = 401-900 p, C = 901-1400 g, D = 1401
1900 g. E = 1901-2400 p. F = 2401-2900 p, G = >2901 p.
European literature suggests that initial veliger size is
about 70 pm and that these veligers increase rapidly in
size (up to 300 pm) in 5 days to 5 weeks, at which time
they can no longer remain suspended in the plankton and
Page 104
THE NAUTILUS, Vol. 124, No. 2
Table 1. Distribution of juvenile mussels initially attached to
senescing aquatic plants after two weeks. Approximately 46%
of the mussels left the plants and successfully located an
alternate hard substrate for reattachment. No mussels were
found in the soft sediment.
Figure 6. Migration of juvenile and adult Dreissena
pohjmorpha from soft sediment to hard tile substrate in aquarium
experiment.
settle on hard substrates. Veligers first appeared in Sandy
Lake on May 20, and rapidly increased to a maximum
density of about 1 7,500/m3. The smallest veligers were
60 pm, and the largest were 250 pm. We tentatively iden-
tified three cohorts based on size-frequency analysis.
The first juveniles appeared on Nuphar stems on
June 30, and by July 21 had reached a mean density of
62 individuals/stem (approximately 1 individual/cm3).
Size-frequency analysis of settled juveniles suggested
only a single cohort (in contrast to possibly three veliger
cohorts). Similarly, Wainman et al. (1996) found only a
single three-week recruitment (settling) period in Lake
Erie, also in July. We are confident that the first veliger
cohort was the source of the settled juveniles because
the smallest settled juveniles were approximately the
same size as the largest of the veligers, and they
overlapped temporally. The single cohort that success-
fully settled on Nuphar stems appeared to suffer high
initial mortality, falling from a density of 62 individuals/
stem to 1 1/stem in the first week. There was no further
significant decrease in density until September 3, when
densities fell to zero.
The abrupt loss of juveniles from plant stems at the
end of August could be a consequence of increased
predation — those on plant stems perhaps being particu-
larly vulnerable/visible/available — or could be the result
of a mass abandonment of these attachment sites as a
consequence of some perceived change in substrate
quality. In late summer, Nuphar stems become heavily
coated with epiphytic microorganisms, and the stems
lose their firmness - either condition might signal a dete-
rioration of substrate quality to the mussels. That
Nuphar stems are attractive settlement sites early in the
summer is supported by our observation that mean juve-
nile density on stems is no different from mean density
on concrete artificial substrates collected at the end of
the summer although the aggregated distribution on
plant stems, and the data from the literature on other
hard surfaces suggest that they are attracted by slight
differences among otherwise similar surfaces or to each
other (Wainman, et al. 1996). The lack of any evidence
for the settlement of the second and third veliger cohorts
on stems as the season progresses suggests that these
sites become less attractive.
The fate of juveniles that abandon their attachment to
Nuphar stems is unknown. Newly settled juveniles have
the ability to seek alternate attachment sites by crawling
or by using byssal threads to resuspend themselves in the
water column and resettle elsewhere (Griffiths, et al.
1991, Marsden and Lansky 2000), and Martel (1993)
has documented juveniles up to 2 mm in length in the
plankton of Lake Erie under conditions of high waves
and strong currents. Lewandowski (1982) has noted the
presence of plant remains in the byssus of 1 and 2 year
old individuals found in benthic colonies. We are aware
of no studies that have directly observed the fate of
established juveniles that have abandoned their attach-
ment sites after several weeks, however. Juveniles leaving
attachment sites at the end of the summer in Sandy Lake
were large enough (77% were greater than 2 mm in
length) that resuspension is an unlikely option. Juveniles
may simply fall to the sediment surface and crawl seek-
ing a better substrate.
The aquarium experiments did show that these large
juveniles were capable of locating and successfully
attaching to hard substrates after leaving senescing plant
material. All of those that abandoned the plant stems in
aquaria were found either on the tiles or on the aquar-
ium walls. None was found on the soft sediments. This
ability to find alternate substrates is lost with time,
and year-old individuals were markedly unsuccessful
compared to the younger cohort. At Sandy Lake we
frequently encountered relatively large (6-17 mm)
D. polymorpha individuals attached to plant stems or to
the undersides of Nuphar leaves, particularly early in the
season. We speculate that these individuals represent the
previous year’s cohort that abandoned plant stems, failed
to find an alternate substrate, persisted on the surface of
the plant litter in the littoral zone over the winter, then
had a serendipitous encounter with an emerging Nuphar
shoot the following spring. Lewandowski (1982) has also
noted that 99.5% of the individuals found on plants are
less than 0.5 mm in length, indicating that they belong to
the youngest cohorts.
B.L. Bodamer and M.L. Ostrofsky, 2010
Page 105
In Sandy Lake, and in other inland lakes with limited
natural hard substrates it is likely that a significant por-
tion of the annual D. polymorpha settlement occurs on
plant surfaces - not only the relatively firm stems of
Nuphar and emergent vegetation, but on the softer foliage
of submersed plants as well. The available surface area
provided by plants vastly exceeds that of alternate attach-
ment sites. While the density of juvenile mussels on plants
may be comparable to that on other substrates, mortality
is considerably higher as a result of the need to abandon
the plant surfaces with plant senescence, and the low
probability of encountering an alternate site even though
juveniles retain the ability to seek these sites. The
resulting high mortality may be sufficient to limit the
size of the adult population in lakes with limited hard
substrate.
Why have zebra mussels failed to colonize small inland
lakes in the midwestern U S as anticipated by Ludyanskiy
et al. (1993)? Johnson et al. (2001), noting low coloniza-
tion success in spite of dispersal events estimated in the
hundreds or thousands, cite three possible reasons for
this failure. First overland transport is inefficient and
many mussels attached to boats or to aquatic plants
entangled in boats and trailers, or carried in bait wells
or in bilge water fall off or die before reaching a new
colonization site. Second, boaters do not visit lakes ran-
domly, but rather visit a small subset of the most popular
ones and long-distance dispersal fits a gravity model
rather than a diffusion model (Bossenbroek, et al. 2001).
Finally, overland transport and inoculation of new sites
may occasionally be successful, but the colonists fail to
found new populations. The causes of this failure are
certainly varied. Butkas and Ostrofsky (2006) reported
evidence of a failed introduction in Canadohta Lake
likely due to too small an inoculum. Other introductions
may fail as a result of inhospitable chemical or physical
characteristics of the new site, including a paucity of
favorable substrates for attachment. Lewandowski
(2001) has estimated the survival of settling veligers to
be usually less than 1%, and even in lakes with unusually
well developed littoral zones less than 5% simply by
failing to find an appropriate substrate. Further, those
that do find substrates may not survive winter freezing
or ice scour (Brady et al. 1995) if those substrates are in
shallow water.
Our data suggest that the earliest cohort of settling
veligers in Sandy Lake do not discriminate among sub-
strates in that there was no significant difference
between the density of juveniles on artificial hard sub-
strates (concrete tiles) and their density on Nuphar
stems. Karatayev et al. (1998) observed similar results in
a number of European lakes when comparing juvenile
mussel densities on a number of natural substrates
including aquatic plants. Later cohorts in Sandy Lake
did not settle on the stems, or settled on them in very
much reduced numbers, evidently finding them less suit-
able than did the earlier cohort. Nevertheless, the sur-
face area of plant tissue available for settlement greatly
exceeds the area of other substrates (Brady et al. 1995,
Ozimek 1997), and Lewandowski (1982) estimated that
more than 85% of the mussel population in 26 Masurian
(Poland) lakes were using aquatic plants as substrates.
However, the growing season of aquatic plants is shorter
than the life of mussels, and on senescence mussels must
abandon plant surfaces and seek alternate substrates if
they are to survive. In Sandy Lake the density of juve-
niles on plants declined abruptly at the end of August.
Lewandowski (2001) similarly found that populations of
first year mussels on plants decreased by 78% between
August and September in Lake Czos due to plant senes-
cence. Larger declines were seen in older mussels. Our
laboratory experiments illustrate that these first year dis-
placed mussels have the ability to migrate in search of
alternate substrates, and our finding larger, second year
old mussels occasionally on plant surfaces indicates that
at least some are successful in that search. Lewandowski
(1983) reported similar findings — that 2 to 3 year old
mussels were found on plant surfaces in low numbers,
99.8% of the individuals were juveniles that had settled
that year. However the cumulative effect of low settle-
ment success and low survival of those settling on aquatic
plants must severely limit the populations of zebra mus-
sels in lakes lacking more permanent hard substrates.
ACKNOWLEDGMENTS
We are grateful to | . Widel for access to Sandy Lake and
to j. Cass for his capable field assistance.
LITERATURE CITED
Bossenbroek, J.M., C.E. Kraft, and J.C. Nekola. 2001. Predi-
ction of long-distance dispersal using gravity models: zebra
mussel invasion of inland lakes. Ecological Applications 1 1 :
1778-1788.
Brady, V.J., B.|. Cardinale, and T. M. Burton. 1995. Zebra mus-
sels in a coastal marsh: the seasonal and spatial limits of
colonization. Journal of Great Lakes Research 21: 587-593.
Burlakova, L. E., A.Y. Karatayev, and D.K. Padilla. 2006.
Changes in the distributionand abundance of Dreissena
polymorpha within lakes through time. Hydrobiologia 571:
133-146
Butkas, K.J. and M.L. Ostrofsky. 2006. The status of unionoid
and dreissenid mussels in northwestern Pennsylvania inland
lakes. The Nautilus 120: 106-111.
Czamnolgski, M., L. Michalczyk, and A. Pajdak-Stos. 2004.
Substrate preference in settling zebra mussels Dreissena
polymorpha. Archiv fur Ilydrobiologie 150: 263—270.
Diggins, T. P, M. Weimer, K.M. Stewart, R E. Baier, A.E.
Mayer, R.F. Forsberg, and M.A. Goehle. 2004. Epiphytic
refugium: are two species of invading freshwater bivalves
partitioning spatial resources? Biological Invasions 6: 83-88.
Griffiths, R.W., D.W. Schloesser, J.H. Leach, andW.P. Kovalak.
1991. Distribution and dispersal of the zebra mussel
( Dreissena polymorpha) in the Great Lakes region.
Canadian Journal of Fisheries and Aquatic Sciences 48:
1381-1388.
Grigorovieh, I. A. and R.V. Babko. 1997. Sessile invertebrates
in beds of aquatic macrophytes. In: D Itri, F.M. (ed.)
Page 106
THE NAUTILUS, Vol. 124, No, 2
Zebra mussels and aquatic nuisance species. Ann Arbor
Press, Inc., Chelsea, pp. 87—97.
Hincks, S.S. and G.L. Maclde. 1997. Effects of pH, calcium,
alkalinity, hardness, and chlorophyll on the survival,
growth, and reproductive success of zebra mussel
( Dreissena polymorpha) in Ontario lakes. Canadian
Journal of Fisheries and Aquatic Sciences 54: 2049-2057.
Horvath, T. G. and G.A. Lamberti. 1997. Drifting macrophytes
as a mechanism for zebra mussel ( Dreissena polymorpha)
invasion of lake-outlet streams. American Midland Natu-
ralist 138: 29-36.
Johnson, L. E. 1995. Enhanced early detection and enumera-
tion of zebra mussel ( Dreissena polymorpha) veligers
using cross-polarized light microscopy. Hydrobiologia
312:139-146.
Johnson, L. E., A. Riceiardi, and J.T. Carlton. 2001. Overland
dispersal of aquatic invasive species: a risk assessment of
transient recreational boating. Ecological Applications 1 1 :
1789-1799.
Karatayev, A.Y., L. E. Burlakova, and D.K. Padilla. 1998. Phys-
ical factors that limit the distribution and abundance of
Dreissena polymorpha (Pall.). Journal of Shellfish
Research 17: 1219-1235.
Kobak, J. 2004. Recruitment and small-scale spatial distribu-
tion of Dreissena polymorpha (Bivalvia) on artificial mate-
rials. Arehiv frir Hydrobiologie 160: 25-44.
Kraft, C.E. and L. E. Johnson. 2000. Regional differences in
rates and patterns of North American inland lake inva-
sions by zebra mussels ( Dreissena polymorpha). Canadian
Journal of Fisheries and Aquatic Sciences 57: 993-1001.
Lewandowski, K. 1982. The role of early developmental stages
I the dynamics of Dreissena polymorpha (Pall.) (Bivalvia)
populations in lakes. II. Settling of larvae and the dynam-
ics of numbers of settled individuals. Ekologia Polska 30:
223-286.
Lewandowski, K. 1983. Occurrence and filtration capacity of
young plant-dwelling Dreissena polymorpha (Pall.) in Majcz
Wielki Lake. Polslae Arehiwum Hydrobiologii 30: 255-262.
Lewandowski, K. 2001. Development of populations of Dreissena
poltpnoipha (Pall.) in lakes. Folia Malacologia 9: 171-216.
Ludyanskiy, M.L., D. McDonald, and D. MacNeill. 1993.
Impact of the zebra mussel, a bivalve invader. BioScience
43: 533-544.
Marsden, J.E. and D.M. Lansky. 2000. Substrate selection by
settling zebra mussels, Dreissena polymorpha , relative to
material, texture, orientation, and sunlight. Canadian
Journal of Zoology 78: 787-793.
Martel, A. 1993. Dispersal and recruitment of zebra mussel
( Dreissena polymorpha) in a nearshore area in west-cen-
tral Lake Erie: the significance of postmetamorphic
drifting. Canadian Journal of Fisheries and Aquatic Sci-
ences 50: 3-12.
Miller, S.J. and J.M. Haynes. 1997. Factors limiting coloniza-
tion of western New York creeks by the zebra mussel
(. Dreissena polymorpha). Journal of Freshwater Ecology
12: 81-88.
Musko, I.B. and B. Bako. 2005. The density and biomass of
Dreissena polymorpha living on submerged macrophytes
in Lake Balaton (Hungary). Arehiv frir Hydrobiologie 162:
229-251.
Ozimek, T. 1997. Submerged macrophytes as a substrate for
Dreissena polymorpha (Pall.) in five lakes of the Jorka
river watershed. Polslae Arehiwum Hydrobiologii 44:
445-455.
Strayer, D.L. 1991. Projected distribution of the zebra
mussel, Dreissena polymorpha , in North America.
Canadian Journal of Fisheries and Aquatic Sciences 48:
1389-1395.
Strayer, D.L., J. Powell, P. Ambrose, L.C. Smith, M.L. Pace,
and D.T. Fischer. 1996. Arrival, Spread, and Early
Dynamics of a Zebra Mussel ( Dreissena polymorpha)
Population in the Hudson River Estuary. Canadian
Journal of Fisheries and Aquatic Sciences 53: 1143-1149.
USGS [United States Geological Survey]. 2000. National Land
Cover Data. Edition 1. USGS. http://mcmcweb.er.usgs.
gov/catalog/metadata/usgs_nlcd_metadata.html.
Wainman, B.C., S.S. Hincks, N.K. Kaushik, and G.L. Maekie.
1996. Biofilm and substrate preference in the dreissenid
larvae of Lake Erie. Canadian Journal of Fisheries and
Aquatic Sciences 53: 134-140.
THE NAUTILUS 124(2): 107-111, 2010
Page 107
Description of Calliotropis ceciliae new species (Gastropoda:
Chilodontidae: Calliotropinae) from off Chile
Claude Vilvens
Scientific collaborator to the Museum national d’Histoire
naturelle, Paris.
Rue de Hermalle, 113
B-46S0 Oupeye
BELGIUM
[email protected]
Javier Sellanes
Universidad Catoliea del Norte, Facultad de Ciencias del M ar
Larrondo 1281 Coquimbo, CHILE
and
Centro de Investigaeion Oceanografica en el Pacffico Sur-oriental
(COPAS)
Universidad de Concepcion
Concepcion, CHILE
[email protected]
ABSTRACT
A new species of Calliotropis is described from the vicinities of
the Concepcion Methane Seep Area (~36°S) and from addi-
tional material from off Antofagasta (northern Chile, ~22°S). It
is compared to C. pelseneeri pelseneeri Cernohorsky, 1977, and
C. pelseneeri rossiana Dell, 1990, from the adjacent Antarctic
area, which differ notably from the new species by having
a thicker supra-peripheral spiral cord, more angulate whorls,
and a more lamellose sculpture present in the subspecies
pelseneeri. The new species is also separated from the wide-
spread C. infundibulum (Watson, 1879) by having a weaker PI
spiral cord and narrower umbilicus with spiral cords inside.
The radula of the new species is also typically calliotropine.
Additional keywords: Seguenzioidea, deep-sea, methane seeps
INTRODUCTION
The genus Calliotropis is known to be very widespread
and speciose: many new species, mainly from deep water,
were described, e.g. from south western Indian Ocean
(Vilvens, 2005, 2006), from the Philippines (Poppe et ah,
2006), from Australia (Jansen, 1994), and from other areas
of Indo-Paeific such as Taiwan, Indonesia, New Caledo-
nia. Fiji and Vanuatu (Vilvens, 2004, 2007).
The deep-water malaeofauna of the SE Pacific, and in
particular that of Chile, is still poorly known. A survey of
the Trochoidea including the description of two new
species was recently presented by Vilvens and Sellanes
(2006). The new species described in that work come
from the bathyal zone (^850 m) Concepcion Methane
Seep Area (CMSA). This area has been proven to be
a faunal aggregation “hotspot” that includes about 30
species of molluscs (Sellanes et ah, 2008). Many of
these species were previously unknown, mainly the
chemosymbiotic bivalves and some of the gastropods
(reviewed in Sellanes et ah, 2008). Five species of the
group Trochoidea inhabiting this seep area are currently
identified to specific level: Bathybembix macdonaldi
(Dali, 1890), Margarites huloti Vilvens and Sellanes,
2006, Otukaia chilena Rehder, 1971, O. cmstulum
Vilvens and Sellanes, 2006, and Zetela alphonsi Vilvens,
2002. An additional species of the group, collected in the
vicinities of the same area and in 2001 off Antofagasta,
was tentatively assigned to the genus Calliotropis. These
latter constitute the first records for the genus from ofl
Chile. The geographically closest records are those
of Dell (1990), who described or reported some
Calliotropis species from the adjacent Antarctic area
(Ross, Weddell, and Bellingshausen seas).
The present paper aims to describe the new species of
Calliotropis and to review the congeners for the South-
eastern Pacific and adjacent Antarctic areas.
MATERIALS AND METHODS
Material of the present study consists of specimens
obtained living (lv) from the dredge hauls performed by
R/V Vidal Gormaz during the VG-07 cruise at two sta-
tions near the CMSA (~36° S). Additional material was
collected off Antofagasta (22°48.02/ S, 70°36.7T W) in
1350 m during 2001 in a R/V Sonne expedition. Abbre-
viations used are: H: shell height: W: shell width; HA:
aperture height; TW: number ol teleoconch whorls; spi-
ral cords on teleoconch of the shells are labelled as PI,
P2, . . . etc., for primary cords (PI being the most
adapical) and SI, S2, ... etc., lor secondary cords (SI
being the most adapical). Type specimens are deposited
at Natural Histoiy Museum of Chile, Santiago
(MNI4NCL), Institut royal des Sciences naturelles de
Belgique, Brussels, Belgium (IRSNB), and Museum
national d’Histoire naturelle, Paris, France (MNHN).
SYSTEMATICS
We follow herein the arrangement of Bouchet and
Rocroi (2005) for the suprageneric allocation of
Page 108
THE NAUTILUS, Vol. 124, No. 2
Calliotropis, although several authors still prefer to
include the latter taxon in the Trochidae, as did Hickman
and McLean (1990).
Superfamily Seguenzioidea Verrill, 1884
Family Chilodontidae Wenz, 1938
Subfamily Calliotropinae Hickman and McLean, 1990
Genus Calliotropis Seguenza, 1903
Type Species: Trochus ottoi Philippi, 1844 (by original
designation) - Pliocene-Pleistocene, Italy.
Calliotropis ceciliae new species
(Figures 1 -7, 15 -19 Map 1, Table 1)
Description: Shell rather tall for genus (height up to
approximately 17.5 mm, width up to 17.9 mm), slightly
broader than high, rather thin, conical to weakly
cyrtoconoidal; spire moderately elevated, height 0.92 x
to 0.98 x width, 2.0 x to 2.6 x aperture height; umbilicus
deep and narrow. Protoconch unknown (damaged in all
available specimens).
Teleoconeh of up to 6 convex whorls, bearing 3 spiral
granular cords and prosocline threads; nodnles produced
by intersections of cords with axial folds on 3 tirst whorls;
axial threads or folds not connecting nodnles on last
whorls. Suture visible, impressed, not canaliculated.
First teleoconeh whorl convex, sculptured by about 20
prosocline smooth riblets, interspace between riblets
twice as broad as riblets; primary spiral cords PI and P3
appearing at about mid-whorl, P3 slightly stronger than
PI, both bearing rounded nodules produced by intersec-
tion with axial riblets; P2 absent. On second whorl, PI
and P3 stronger, PI still weaker than P3; P4 appearing at
end of whorl, partially covered by successive whorl, with
beads smaller and more numerous than those of other
cords. On third whorl, nodules of PI and P3 stronger,
slightly blunt sharp; beads of PI oriented at 45°, beads of
P3 horizontally oriented, slightly more numerous than
those of PI; beads becoming nodules at end of whorl.
On fourth whorl, nodules of PI slightly stronger and less
numerous than those of P3; beads of P4 much smaller
and more numerous than those of other cords. On last
whorl, P4 peripheral; periphery subangular; PI weaken-
ing, sometimes almost obsolete, and P3 strongest; axial
sculpture still visible, much stronger in upper part of
whorl; SI sometimes appearing intermediate between
PI and P3.
Aperture almost circular, with a weak, almost rounded
angle at meeting of inner and outer lip; inner lip flanged
in a curved arc projecting over umbilicus, partially
covering it; parietal lip forming thin, transparent glaze.
Columella more or less straight, without tooth, weakly
prosocline. Base moderately convex, with 6 subgranular,
similar by size, spiral cords; cords not evenly spaced,
interspace between about twice to three times as broad
as cords; very fine, poorly visible, axial, lamellate threads
between cords. Umbilicus narrow, funnel-shaped, diam-
eter 9—13 % of shell width, with very fine crowded axial
lamellae and 2, sometimes 3, spiral cords within. Color of
teleoconeh pinkish ivory, without maculation. Opercu-
lum corneous, multispiral, with a short growing
edge. Radula rhipidoglossate; formula ca. 12 + (1) +
3 + 1 + 3 + (l) + ca. 12. Rachidian tooth smaller than
lateral teeth, with a small, hooded, not elaborately
serrate cusp. Three lateral teeth per half row, similar in
size and shape, with broad, hooded, serrated cusps.
Lateromarginal plate present, with very rudimentary
shaft and cusp. Marginal teeth thin, with long shaft
and weakly serrated cutting edges; outermost marginal
mitten-shaped.
Type Material: Holotype (MNHNCL 4158) (dd),
AGOR Vidal Gormaz, stn AGT 06, from type locality;
Paratype (MNHNCL 4159) (lv), paratype IRSNB (I.G.
31 132) (dd), paratype MNHN (MNHN 21104) (dd), off
Antofagasta, 22°48.02/ S, 70°36.7T W, 1350 m; Paratype
(MNHNCL 4160) (dd), AGOR Vidal Gormaz, stn AGT
07, 35° 55. 06' S, 73°30.42' W, 998-1128 m.
Type Locality: Central Chile, NW of Concepcion,
35°31.48' S, 73°22.71'W, 1100-1300 m. South Pacific
Ocean.
Etymology: Named after Professor Dr. Cecilia Osorio,
University of Chile, in recognition of her devotion to the
study of mollusks, in particular the systematic, biological,
and ecological aspects of the Chilean malacofauna.
Remarks: Two of the five available specimens of the
new species (one of them being the largest) unfortu-
nately lack their first whorls, giving only an estimated
number of whorls. Also, some specimens from off Anto-
fagasta are strongly eroded, making it difficult to count
accurately the axial threads on the first whorls.
Calliotropis ceciliae new species is close to
C. pelseneeri pelseneeri Cernohorsky, 1977 (Figures 8-
10) from Antarctic seas, but the latter has a much more
lamellose surface, a thicker P3 that angulates the whorl,
a more convex base with more numerous spiral cords
(the two outermost cords are closely spaced and sepa-
rated from the other cords), and only a single spiral
inside the umbilicus.
The new species weakly resembles Calliotropis
pelseneeri rossiana Dell, 1990, but this subspecies has a
P3 especially thick, a more angulate periphery and a
subquadrangular aperture, giving a very different gen-
eral shape to the shell.
Callitropis ceciliae new species may also be compared
to C. infundibulum (Watson, 1879) (Figures 11-14) from
western Atlantic, Indian-Atlantic Ridge and western
Pacific, but this widespread species has a much stronger
PI cord, a wider umbilicus without a spiral cord inside,
only 4 (sometimes 5) stronger spiral cords on the base.
ACKNOWLEDGMENTS
We are indebted to the officers and crew of R/V Vidal
Gormaz, for their skilful assistance at sea. We are
especially grateful to T. Backeljau (Institut royal des
C. Vilvens and J. Sellanes, 2010
Page 109
Figures 1-14. Calliotropis spp. 1-7. Calltotropis ceciliae new species, Central Chile (scale bar = 5 mm.). 1-3. Holotype MNHNCL
(41584158), 10.4 x 11.3 mm. 4-5. Paratype MNHNCL (4159), 12.1 x 13.1 mm. 6-7. Paratype MNHNCL 4160, 17,5 (est.) x 17.9 mm.
8-10. Calliotropis pelseneeri pelseneeri Cemohorsky, 1977, holotype USNM 612941, Weddel Sea, 11.0 x 12.1 mm - photos taken by
Smidisonian National Museum of Natural History. 11-14. C. infundibulum (Watson, 1879), syntypes BMNH, Prince Edward Island -
photos taken by Phil Hurst (BMNH). 11-12. BMNPI (1887.2.9.325-7), 10.9 x 10.7 mm. 13-14. BMNH (1887.2.9.328-9), 14.8 x 12,5 mm.
Page 1 1 0
THE NAUTILUS, Vol. 124, No. 2
Figures 15-19. Calliotropis ceciliae new species, Central Chile (scale bar = 5 mm.), paratype MNI4NCL (4159), features of the
radula. 15. Central field : rachidian (r) and lateral (Is) teeth. Scale bar = 100 pm. 16. General view : rachidian (r), lateral (Is) and
marginal (ms) teeth. Scale bar = 100 pm. 17. Details of one row of the central field. 18. Details of lateral (Is) and marginal (ms) teeth
with lateromarginal plate (Imp). 19. Details of marginal teeth.
Sciences naturelles de Belgique, Brussels, Belgium) for
his help with type laons. We also thank P. Bouchet
(Museum national d’Histoire naturelle, Paris, France) for
access to the malacological resources of the MNIIN,
V. Heros (MNIIN) for her help in my search of various
scientific papers, M. Glaubrecht (Zoologisehes Museum,
Berlin), K. Way and A. McLellan (Natural History
Museum, London) for the loan of types from its
Table 1. Calliotropis ceciliae. Shell measurements (mm) of the types.
C. Vilvens and [. Sellanes, 2010
Page 111
Map 1. Map of the Chilean coast showing the locations off
Antofagasta and NW off Concepcion in which Calliotropis
ceciliae new species has been collected.
institution, and P. Hurst and R.Miguez (BMNH) for the
kind sending of photographs of the types of Calliotropis
infundibulum. The pictures of C. pelseneeri were used
with permission from the National Museum of Natural
History, Smithsonian Institution, Washington, DC.
This work was funded in part through FON D EC YT
project No. 1061217 to J.S. and the Center for
Oceanographic Research in the Eastern South Pacific
(COPAS), FONDECYT project No. 1061214 to Prax-
edes Munoz. NOAA Ocean Exploration Program,
via Seripps Institution of Oceanography, contract nr.
NOAA NA17R]1231 provided additional funding for
shiptime.
LITERATURE CITED
Bouchet, P. and J.P. Rocroi. 2005. Classification and nomencla-
tor of gastropod families. Malacologia 47: 1-397.
Dell, R.K. 1990. Antarctic mollusca, with special reference to
the fauna of the Ross Sea. Royal Society of New Zealand
Bulletin 27: 1-311.
Hickman, C.S. and J.H. McLean. 1990. Systematic revision and
supragenerie classification of troehacean gastropods. Nat-
ural History Museum of Los Angeles County, Science
Series 35, vi + 169 pp.
Jansen, P. 1994. Notes on the Australian species of Calliotropis
with descriptions of four new species. Molluscan Research
15: 45-53.
Poppe, G.T., S.P Tagaro, and II. Dekker. 2006. The
Seguenziidae, Chilodontidae, Trochiclae, Calliostomatidae
and Solariellidae of the Philippine Islands. Visaya Suppl.
2: 3-228.
Sellanes, [., E. Quiroga, and C. Neira. 2008. Megafaunal
community structure and trophic relationships of the
recently discovered Concepcion Methane Seep Area
(Chile, ~36°S). ICES Journal of Marine Sciences 65:
1102-1111.
Vilvens, C. 2004. Description of four new species of Calliotropis
(Gastropoda: Troehidae: Eucyclinae: Calliotropini) from
New Caledonia, Fiji and Vanuatu. Novapex 5:19-31.
Vilvens, C. 2005. Description of Calliotropis pidvinaris new
species (Gastropoda: Troehidae: Eucyclinae: Callio-
tropini) from western Madagascar. The Nautilus 119:
50-54.
Vilvens, C. 2006. New records and new species of Calliotropis
(Gastropoda: Chilodontidae: Calliotropinae) from Mada-
gascar, Mayotte Island and Reunion Island. Novapex 7:
55-71.
Vilvens, C. and |. Sellanes. 2006. Descriptions of Otukaia
crustulum new species (GastropodaTroehoidea: Callio-
stomatidae) and Margarites huloti new species
(Gastropoda: Trochoidea: Troehidae) from a methane
seep area off Chile. The Nautilus 120(1): 15-20.
Vilvens, C. 2007. New species and new records of Calliotropis
(Gastropoda: Chilodontidae: Calliotropinae) from Indo-
Pacific. Novapex 8 (HS 5): 1-72.
THE NAUTILUS 124(2): 112-1 16, 2010
Page 112
A new Scabrotrophon (Gastropoda: Muricidae) from Hawaii and
discussion about the generic classification of Boreotrophon
kamchatkanus Dali, 1902, a related species
Roland Houart1
Institut royal des Sciences naturelles de Belgique
Rue Vautier, 29, 1000 Bruxelles
BELGIUM
[email protected]
Robert Moffitt
National Oceanic and Atmospheric Administration (NOAA)
National Marine Fisheries Sendee
Pacific Islands Fisheries Science Center (PIFSC)
2570 Dole Street
Honolulu, HI 96822 USA
[email protected]
ABSTRACT
A small murieid collected at 414 m off the Hawaiian Island
of Oahu is described and compared, on the basis of shell char-
acters only, with a syntype and two other specimens of
Scabrotrophon kamchatkanus (Dali, 1902) (new combination)
from the Northern Pacific. SEM images of the operculum,
radula, and of the penis are illustrated for the new species.
INTRODUCTION
The discovery of a small murieid found with a sediment
collector retrieved from 414 m in the Makapuu precious
coral bed, situated in the channel between the islands
of Oahu and Molokai in the Hawaiian Archipelago led
to a note by Moffitt (2008: 16) and the search of its
true identity. The species was first illustrated as
“ Boreotrophon truncatus (Strom, 1768) look alike”, but
further investigations proved it to be a new species
closely related to Scabrotrophon kamchatkanus (Dali,
1902), an uncommon species from the North Pacific.
Abbreviations and Text Conventions: IP: Infra-
sutural primary cord (primary cord on sutural ramp);
PI: Shoulder cord; P2— P6: Primary cords ol the convex
part of the teleoeonch whorl; si— s6: Secondary cords
ol the convex part of the teleoeonch whorl; example:
si = secondary cord between P I and P2; s2 = secondary
cord between P2 and P3, etc.; USNM: National Museum
of Natural History, Smithsonian Institution, Washington,
DC, USA; RPI: collection of Roland Houart.
SYSTEMATICS
Family Muricidae Rafinesque, 1815
Subfamily Trophoninae sensu lato Cossmann, 1903
1 Research Associate
Genus Scabrotrophon McLean, 1996
Type species by original designation: Trophon maltzani
Kobelt and Kuster, 1878, Northeastern Pacific.
Scabrotrophon hawaiiensis new species
Figures 1—4, 14—17
Boreotrophon truncatus (Strom, 1768) look alike —
Moffitt, 2008: 7, text-fig.
Description: Shell medium-sized for the genus, holo-
type 18 mm in length. Width to length ratio 1.9:1.
Biconical, broad, heavy, lamellose. Shoulder strongly
sloping, straight or weakly concave. Shell grayish-white,
aperture glossy white. Spire high (teleoeonch whorls 1
and 2 missing.) Axial sculpture of last teleoeonch whorl
consisting of 17 irregular, moderately high, strong, nar-
row lamellae, more strongly developed at sutural ramp,
particularly near suture. Penultimate and ante-penulti-
mate whorls with same number but lower, more regular
lamellae. Previous whorl eroded, other whorls missing.
Spiral sculpture of 6 low, weak, primary cords, more
obvious on axial sculpture. Ontogeny unknown. Low IP,
only visible at last portion of last teleoeonch whorl. Pen-
ultimate and antepenultimate whorls with PI and P2.
Sutural ramp smooth except axial lamellae. Aperture
large, rounded-ovate. Columellar lip narrow, smooth, rim
completely adherent. Outer lip of aperture smooth within.
Siphonal canal moderately long, 36% of shell length, nar-
row, weakly abaxially bent at tip, broadly open. Opercu-
lum (Figure 17) inverted tear-shaped with apical nucleus
and numerous concentric ridges. Radula (Figure 14) with
a rachidian tooth bearing a long, central cusp, a narrow,
short, lateral denticle and a long, broad, lateral cusp. The
lateral denticles are separated. Lateral cusp weakly
broader and shorter than central cusp. Lateral teeth
sickle-shaped with broad base. Penis small, broad, flat-
tened, approximately 2 mm in length (Figures 15, 16).
Type Material: Holotype USNM I 137634
R. Houart and R. Moffitt, 2010
Page 113
Figures 1-10. Scabrotrophon species. 1—4. Scabrotrophon hawaiiensis new species, Makapuu Precious Coral Bed, 21° 17.639' N,
157 31. 966' VV, with sediment collector, 414 m, 18 mm, Holotype USNM 1137634. 5—10. Scabrotrophon kamchatkanus (Dali, 1902).
5-7. California, off Trinidad, North of Eureka, 41°4' N, 124°9' W, dredged at 100-200 fms (183-366 m), 21.3 mm, coll. RH. 8-10.
California, off Eureka, 16.1 mm, coll. RI1
Page 114
THE NAUTILUS, Vol. 124, No. 2
Figures 11-19. Scabrotrophon species. 11-13. Scabrotrophon kamcliatkanus (Dali, 1902). Southeast coast of Kamchatka, 29 m,
25 mm, illustrated syntype USNM 109178 (photo courtesy Y. Villaeampa, USNM). 14-17. Scabrotrophon hawaiiensis new species
(SEM courtesy A. Waren). 14. Radula. Scale bar - 50 pm. 15-16. Penis. Scale bars: Figure 15 = 1 mm; Figure 16 = 500 pm. 17.
Operculum (scale bar 2 mm). 18-19. Scabrotrophon maltzani (Kobelt and Kuster, 1878) 18. British Columbia, Egmont, dredged
31 m, coll. RH. 19. Radula (scale bar 10 pm) (SEM A. Waren)
R. Houart and R. Moffitt, 2010
Page 115
Type Locality: Makapuu Precious Coral Bed,
21°17.639' N, 157°31.966/ W, collected with a sediment
collector retrieved on Hawaii Undersea Research Labo-
ratory Pisces V submersible dive P5-687, 414 m.
Distribution: Currently only known from the type
locality.
Remarks: Another species of Trophoninae sensu
lato, Trophonopsis kayae Habe, 1981, was described
from deep water in Hawaii but it is not related to
S. hawaiiensis new species and is more akin to T. polycyma
Kuroda, 1953, from Japan and Fiji (Houart and Heros,
2008: 466). To our knowledge, only one species, living in
the northeastern Pacific, Scabrotrophon kamchatkanus, is
closely related. However, in S. kamchatkanus the spiral
cords are comparatively broader and more strongly devel-
oped, obviously crossing the low axial lamellae. There are
5 primary spiral cords on the last teleoeoneh whorl in the
holotype (P1-P5) with some secondary cords in other
specimens examined [PI, si, P2, s2, P3, (s3), P4, P5] .
The penultimate and ante-penultimate whorls bear 3 or
4 cords, probably PI, si, P2, (s2), the shoulder ramp is
more slightly sloping in all specimens, and narrower. The
axial lamellae in S. kamchatkanus are lower, occasionally
almost indistinct, and the siphonal canal is shorter rela-
tively to the height of the last teleoeoneh whorl. The oper-
culum is less triangular, having a more ovate outline.
The radula morphology and the penis are unknown in
S. kamchatkanus.
Scabrotrophon kamchatkanus (Dali, 1902) new combination
Figures 5-10, 11-13
Boreotrophon kamchatkanus Dali, 1902: 541; Kosuge,
1972: pi. 8, fig. 6 (illustrated syntype).
Neptunea kamchatkana — Dali, 1921: 111, pi. 10, fig. 7
(syntype).
Trophonopsis kamchatkanus (var.) — Kuroda, 1953: 189;
Tiba and Kosuge, 1985: 29, figs 1 (illustrated syntype), 2.
Trophonopsis kamchatkana — Higo et al.: 1999: 203;
2001: 62, fig. G2223 (illustrated syntype); Tsuchiya,
2000: 401, fig. 190.
Type Material: Illustrated syntype USNM 109178
(Figures 11-13); other syntypes USNM 635673 (Kantor
and Sysoev, 2006: 148).
Type Locality: Dredged by the U.S. Fish Commission
steamer Albatross on the southeast coast of Kamchatka,
at station 3644, in 96 fms, shelly bottom, temperature
33° F (=0.6°C, Dali, 1902: 542). the depth of St. 3644 is
erroneous. In checking the original publication, the
depth was listed as 96 feet (which is 16 fathoms). This
was transcribed as 96 fms on a label that had depth
pre-printed in fathoms. It seems now clear that the
correct depth for St. 3644 is 96 It (— 16 fms or 29 m)
(Harasewych, in litt.).
Other Material Examined: California, off Trinidad,
North of Eureka, 4104' N, 124° 9' W, dredged at 100-200
fms (183-366 m), ex. R. Talmadge coll., coll. RH (Fig-
ures 5-7); off Eureka, ex. R. Talmadge coll., coll. RH
(Figures 8-10).
Distribution: The Sea of Kashima-nada, Japan to the
Bering Sea (Tsuchiya, 2000) and off Eureka, California
(coll. RII), in 29-183 m. The maximum depth of 1495 m
given by Tsuchiya (2000: 401) seems doubtful for living
specimens.
DISCUSSION
The decision to include both species in Scabrotrophon is
based on the shell morphology and the comparison with
the type species of Scabrotrophon (Figures 18-19), a
genus restricted to the Northern Hemisphere. As stated
by McLean (1996: 93), the genus Boreotrophon is char-
acterized by a dominant axial sculpture and the spiral
sculpture (however rarely present in Boreotrophon ) does
not override the axial ribs. Trophonopsis has dominant
axial sculpture in early whorls and the very prominent
axial ribs of the type species Trophonopsis muricatus
(Montagu, 1803) are overridden by spiral cords that form
beads at intersection with the axial sculpture. Moreover
the outer apertural lip is strongly denticulate in
Trophonopsis. The generic allocation of other Northeast-
ern “ Boreotrophon ” or "Trophonopsis" species probably
needs to be reviewed.
ACKNOWLEDGMENTS
We are most grateful to M.G. (Jerry) Harasewych and
Yolanda Villacampa (National Museum of Natural
History, Smithsonian Institution) for the photographs
of the syntype of S. kamchatkanus , to J. Harasewych for
having solved the “mystery” of the depth of station 3644
(type locality). We are also most indebted to Anders
Waren (Natural History Museum, Stockholm, Sweden)
for preparation and SEM photographs of the radula,
operculum, and penis of the new species. We also thank
Dr. Frank Parrish (NOAA, PIFSC) who was the
principal investigator on the Pisces V dive P5-687 as
well as the Hawaii Undersea Research Laboratory and
the staff and crews of the Pisces V and R/V Ka’imikai-o-
Kanaloa, without whom this species would not have
been collected. Finally we are veiy thankful to Yuri I.
Kantor (Severtsov Institute of Ecology and Evolution of
Russian Academy of Sciences, Moscow, Russia) for his
useful remarks.
LITERATURE CITED
Dali., W. H. 1902. Illustrations and descriptions of new,
unfigured, or imperfectly known shells, chiefly American.
Proceeding of the United States National Museum 24:
499-566.
Dali, W. H. 1921. Summary of the marine shell-bearing mol-
luslcs of the northwest coast of America, from San Diego to
Page 116
THE NAUTILUS, Vol. 124, No. 2
the Polar Sea, mostly contained in the collection of the
United States National Museum, with illustrations ot hith-
erto unfigured species. Bulletin of the United States
National Museum 112: 1-217, pis. 1-22.
Iligo, S., P. Callomon, and Y. Goto. 1999. Catalogue and
bibliography of the marine shell-bearing Mollusea of
Japan. Gastropoda. Bivalvia.Polyplacophora.Scaphopoda.
Elle Scientific Publications, Osaka, 749 pp.
Iligo, S., P. Callomon, and Y. Goto. 2001. Catalogue and
bibliography of the marine shell-bearing Mollusea of Japan.
Gastropoda. Bivalvia. Polyplacophora. Scaphopoda. Type
figures. Elle Scientific Publications, Osaka, 208 pp.
Houart, R. and V. Heros. 2008. Muricidae (Mollusea:
Gastropoda) from Fiji and Tonga. In: V. Heros, R.H.
Cowie, and P. Bouehet (eds.) Tropical Deep-Sea Benthos
25. Memories du Museum national d’Histoire naturelle
196: 437-480.
Kantor, Yu. I. and A.V. Sysoev. 2006. Marine and brackish-water
Gastropoda of Russia and adjacent countries: an illustrated
catalogue. KMK Scientific Press Ltd., Moscow: 1-371.
Kosuge, S. 1972. Illustrations of Type Specimens of
Molluscs described by William Healey Dali (North-West-
ern Pacific Gastropoda) National Science Museum,
Tokyo, 29 pis.
Kuroda, T. 1953. New genera and species of Japanese gastro-
pods (1). Venus 17: 179-185.
McLean, J.H. 1996. Prosobranehia. In: McLean, J.H. and T.M.
Gosliner. The Mollusea Part 2. The Gastropoda. In: Scott,
P.H., J.A. Blake, and A.L. Lissner (eds.) Taxonomic Atlas
ot the Benthic Fauna of the Santa Maria Basin and West-
ern Santa Barbara Channel. Santa Barbara Museum of
Natural History, Santa Barbara, pp. 1-160.
Moffitt, R. 2008. Little stranger. Internet Hawaiian Shell News.
February: 6-7. http://sl90418054.onlinehome.us/index.
html (access Feb. 2008).
Tiba, R. and S. Kosuge. 1985. North Pacific shells (15) Genus
Trophon Montfort (s.l.). Occasional publication of the
Institute of Malacology, Tokyo 15: 1-36.
Tsuehiya, K. 2000. Muricidae. In: T. Okutani (ed.) Marine Mol-
lusks in Japan, Tokai University Press, Tokyo, pp. 364-421.
Sponsored in part by the State of Florida, Department
of State, Division of Cultural Affairs, the Florida Arts
Council and the National Endowment for the Arts.
NATIONAL
ENDOWMENT
FOR THE ARTS
INSTRUCTIONS TO AUTHORS
THE NAUTILUS publishes articles on all aspects of the
biology, paleontology, and systematic^ of mollusks.
Manuscripts describing original, unpublished research
and review articles will be considered. Brief articles, not
exceeding 1000 words, will be published as notes and do
not require an abstract. Notices of interest to the mala-
cological community will appear in a notices section.
Manuscripts: Each original manuscript and accompa-
nying illustrations should be submitted to the editor pref-
erably via e-mail or as hardcopy in triplicate.
Text must conform to the dimensions of 8 14 x 1 1-inch
paper, double-spaced, and single-column throughout (in-
cluding literature cited, tables, and figure captions). Au-
thors should follow the general recommendations of Sci-
entific Style and Format — The CSE Manual for Authors,
Editors, and Publishers, available from the Council of
Science Editors at www.councilscienceeditors.org. The
first mention of a scientific name in the text should be
accompanied by the taxonomic authority, including year.
Latinized names and other words to be printed in italics
must be underlined; leave other formatting indications to
the editor. Metric, not English, units are to be used. Geo-
chronologic modifiers should be capitalized only when
units are formally recognized: for instance, use Late Cre-
taceous but early Miocene. Likewise, only modifiers of
formally recognized chronostratigraphic units are capi-
talized: use Lower Jurassic but upper Oligocene.
The sequence of sections should be title page, ab-
stract, introduction, materials and methods, results, dis-
cussion, acknowledgments, literature cited, tables, figure
captions, figures. The title page should include the title,
authors name(s) and address(es). If corresponding au-
thor is not the senior author, please indicate. The ab-
stract should summarize in 250 words or less the scope,
main results, and conclusions of the article. Abstracts
should be followed by a list of additional key words. All
references cited in the text must appear in the Literature
Cited section and vice-versa. Please follow a recent issue
of THE NAUTILUS for bibliographic style, noting that
journal titles must be unabbreviated. Information on
plates and figures should be cited only if not included
within the pagination of cited work. Tables must be num-
bered and each placed on a separate page. If in doubt,
please follow a recent issue of the journal for sequence of
sections and other style requirements.
Illustrations: Illustrations are rendered either at full-
page width (maximum width 17 cm) or column width
(maximum width 8.2 cm). Please take these dimensions
into consideration when preparing illustrations. Page-
width illustrations ideally should span the entire width of
printed page (17 cm). “Tall” page-width illustrations
should be avoided, square or “landscape” formats work
better. Please design plates accordingly, such that there
will be enough space left at the bottom of printed page
for plate caption. (Digital technology has made this task
much easier.)
All line drawings must be in black, clearly detailed,
and completely labeled. Abbreviation definitions must be
included in the caption. Line drawings must be high
resolution files at at least 600 dpi (dots per inch) resolution
at actual size. Standard digital formats for line drawings
include .tif, .bmp, .psd, .eps, and .pdi.
Photographs may be submitted in black-and-white or
color, preferably in RGB mode if in color. Standard digi-
tal formats for photographs include .tif, .psd, .jpg, or .pdf.
Photographs must be high resolution files at least 300 dpi
resolution at actual size.
If more than one figure is included in an illustration,
all figures are to be consecutively numbered (Figures 1,
2, 3,' ... , NOT Figures 1A, 1B.1C, . . . , NOR "Plate 1,
Figure 1, . . .). In illustrations with more than one figure,
make sure that blank areas between figures is kept to a
minimum, thereby allowing for more area for each indi-
vidual figure.
Compressed files (e.g., .jpg) may be used to facilitate
transmission of files during original submission, but may
not be acceptable at final submission (see below).
Voucher Specimens: Deposition of the holotype in a
recognized institutional, public collection is a require-
ment for publication of articles in which new species-
level taxa are described. Deposition of paratypes in in-
stitutional collections is strongly encouraged, as is the
deposition of representative voucher specimens for all
other types of research work.
The Editorial Process: Upon receipt, all manuscripts are
assigned a number and acknowledged. The editor reserves
the right to return manuscripts that are substandard or
not appropriate in scope for THE NAUTILUS. Manu-
scripts deemed appropriate for the journal will be sent
for critical review to at least two reviewers. The review-
ers’ recommendations will serve as basis for rejection or
continuation of the editorial process. Reviewed manu-
scripts will be sent back to authors for consideration of
the reviewers’ comments. The revised version of the
manuscript may at this point be considered accepted for
publication by the journal.
Final Submission: Authors of accepted manuscripts are
required to submit a final version via e-mail to the editor
[email protected]. Please do not send low-resolu-
tion or compressed illustration files at this stage. Send any
files larger than 20 Mb on a CD or DVD to the editor.
Proofs: After typesetting, proofs will be sent to the au-
thor. Author should read proofs carefully and send cor-
rections to the editor within 48 hours. Changes other than
typesetting errors will be charged to the author at cost.
Offprints: An order form for offprints will accompany
the proofs. Offprints will be ordered through the editor.
Authors with institutional, grant, or other research sup-
port will be asked to pay for page charges at the rate of
$60 per page.
0 This paper meets the requirements of ANSI/NISO Z39. 48-1 992 (Permanence of Paper)
<-..,Tucr.Mi»w INSTITUTION LIBRARIES
3 9088 01556 6011
THE NAUTILUS
QL
HO |
|K]V:2:
Volume 124, Number 3
October 11, 2010
ISSN 0028-1344
A qua rterlij devoted
to malacology.
EDITOR-IN-CHIEF
Dr. Jose H. Leal
The Bailey-Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
BUSINESS MANAGER
Mary Jo Bunnell
The Bailey-Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
EDITOR EMERITUS
Dr. M. G. Iiarasewyeh
Department of Invertebrate Zoology
National Museum of
Natural History
Smithsonian Institution
Washington, DC 20560
CONSULTING EDITORS
Dr. Rudiger Bieler
Department of Invertebrates
Field Museum of
Natural Histoiy
Chicago, IL 60605
Dr. Arthur E. Bogan
North Carolina State Museum of
Natural Sciences
Raleigh, NC 27626
Dr. Philippe Bouohet
Laboratoire de Biologie des
Invertebres Marins et Malacologie
Museum National d’Histoire Naturelle
55, rue Buffon
Paris, 75005 France
Dr. Robert PI. Cowie
Center for Conservation Research
and Training
University oi Hawaii
3050 Made Wav, Gilmore 409
Honolulu, HI 96822
Dr. Robert T. Dillon, Jr.
Department of Biology
College ol Charleston
Charleston, SC 29424
Dr. Eileen PI. Joldnen
8234 E. North Shore Road
Sault Ste. Marie, MI 49783
Dr. Douglas S. Jones
Florida Museum of Natural Histoiy
University of Florida
Gainesville, FL 32611-2035
Dr. Harry G. Lee
4132 Ortega Forest Drive
Jacksonville, FL 32210
Dr. Charles Lydeard
Biodiversity and Systematics
Department of Biological Sciences
University of Alabama
Tuscaloosa, AL 35487
Bruce A. Marshall
Museum of New Zealand
Te Papa Tongarewa
PO. Box 467
Wellington, NEW ZEALAND
Dr. James H. McLean
Department of Malacology
Natural History Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Paula M. Mikkelsen
Paleontological Research
Institution
1259 Trumansburg Road
Ithaca, NY 14850
Dr. Diarmaid O Foighil
Museum of Zoology and Department
of Biology
University of Michigan
Ann Arbor, MI 48109-1079
Dr. Gustav Paulay
Florida Museum of Natural History
University of Florida
Gainesville, FL 32611-2035
Mr. Richard E. Petit
P.O. Box 30
North Mvrtle Beach, SC 29582
Dr. Gary Rosenberg
Department of Mollusks
The Academy of Natural Sciences
1900 Benjamin Franklin Parkway
Philadelphia, PA 19103
Dr. Angel Valdes
Department of Malacology
Natural Plistory Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Geerat J. Vermeij
Department of Geology
University of California at Davis
Davis, CA 95616
Dr. G. Thomas Watters
Aquatic Ecology Laboratory
1314 Kinnear Road
Columbus, OH 43212-1194
SUBSCRIPTION INFORMATION
The subscription rate for volume
124 (2010) is US $54.00 for
individuals, US $88.00 for
institutions. Postage outside the
United States is an additional US
$10.00 for regular mail and US
$28.00 for air delivery. All orders
should be accompanied by payment
and sent to: THE NAUTILUS, P.O.
Box 1580, Sanibel, FL 33957, USA,
(239) 395-2233.
Change of address: Please inform
the publisher of your new address at
least 6 weeks in advance. All
communications should include both
old and new addresses (with zip
codes) and state the effective date.
THE NAUTILUS (ISSN 0028-1344)
is published quarterly by The Bailey-
Matthews Shell Museum, 3075
Sanibel-Captiva Road, Sanibel, FL
33975.
Periodicals postage paid at Sanibel,
FL, and additional mailing offices.
POSTMASTER: Send address
changes to: THE NAUTILUS
P.O. Box 1580
Sanibel, FL 33957
THE
CONTENTS
Francesco Criseione
Francesco Paolo Patti
Maren Watkins
Patrice Showers Corneli
David Hillyard
Baldomero M. Olivera
Subhronil Mondal
Suhhendu Bardan
Deepjay Sarkar
Research Note
N A U T
{ OCT 2 0 2010 1 )
I L U S
Volume 124, Number 3
October 11, 2010
ISSN 0028-1344
Similar shells are not necessarily a reliable guide to phylogeny:
Rissoa guerinii Reeluz, 1843, and Rissoa lia (Monterosato, 1884)
(Caenogastropoda: Rissoidae): a case study 117
Molecular phylogeny of Conus chiangi (Azuma, 1972)
(Gastropoda: Conidae) 129
Testability of the Energy Maximization Model (Kitchell et ah, 1981) of
naticid predation on two bivalve prey from the eastern coast of India 137
Gisele Orlandi Introini
Claudia Alves de Magalhaes
Shirlei Maria Reeeo-Pimentel
Chromosomal number of two species ol bivalves: Brachidontes danvinianus
(d’Orbigny, 1842) (Mytilidae) and Isognomon tricolor (C.B. Adams, 1845)
(Isognomonidae)
151
THE NAUTILUS 124(3): 1 17-128, 2010
Page 1 17
Similar shells are not necessarily a reliable guide to phylogeny:
Rissoa guerinii Reeluz, 1843, and Rissoa lia (Monterosato,
1884) (Caenogastropoda: Rissoidae): a case study
Francesco Criscione1
Francesco Paolo Patti-
Functional and Evolutionary Ecology Laboratory
Stazione Zoologica “Anton Dohrn”
P.ta S. Pietro, 1, 80077
Ischia (NA), ITALY
ABSTRACT
According to the recent theory of speeiation through loss of
planktotrophy, the pairs of northeastern Atlantic species ol
caenogastropods would be the result ol a cladogenetic event in
which a planktotrophic ancestor gave rise to two geographically
separated species with different modes ol larval development,
but retained virtually identical teleoeonch characters. This idea
was proposed as the working hypothesis for the origin ol the
pair of supposed sibling species Rissoa guerinii Reeluz, 1843
and R. lia (Monterosato, 1884). The present study shows that
claims of a close morphological resemblance between the two
species are unjustified as a considerable divergence emerged in
shell geometric morphometric analysis and in 16S rRNA mito-
chondrial gene. We conclude that R. guerinii and II lia cannot
be regarded as sister or cryptic species and should no longer be
considered a planktotrophie/non-planktotrophie pair.
Additional keywords: Gastropoda, sibling species, larval devel-
opment strategy, mitochondrial DNA, geometric morphometry
INTRODUCTION
Many authors (e.g. Jablonski and Lutz, 1983) identified
two main categories ol developmental strategies in
marine invertebrates: planktrotrophy (P), with larvae
feeding on plankton, and non-planktotrophy (NP), with
planktonic larvae feeding only on their yolk supply
(leeithotrophy), or with direct development.
According to the so-called “shell-apex rule” (Thorson,
1950), larval development in marine gastropods can
be inferred from observations of the protoconch. A
multispiral protoconch and a smaller dimension of the
initial whorl accounts for a planktotrophic developmen-
1 Current address: Malacology Section, Australian Museum, 6
College Street, 2010 Sydney, NSW Australia, franceseo.
[email protected]
[email protected]; both authors are corresponding authors
tal mode, whereas a larger paucispiral protoconch is
directly linked to non-planktotrophy.
There are several examples of nortehastern Atlantic
caenogastropod pairs of related tax a that possess identi-
cal teleoconchs and differ exclusively in protoconch
characters. Oliverio (1996) provided a list of 28 ol these
P/NP pairs and indicated that their specific status is still
a matter of debate.
Verduin (1986) maintained that in species of Rissoa
(Rissoidae) the occurrence of this phenomenon is of
remarkable extent and nine pairs of Oliverios list were
species of this genus. In his revision of the genus, Verduin
(1976, 1982, 1985, 1986) considered differences in devel-
opmental mode to definitively separate species, thus
regarding each member of a P/NP pair as a distinct spe-
cies. His opinion was commonly accepted (e.g. Bouchet,
1989), although some authors have more recently
suggested the possibility of intraspecific variability in lar-
val development (Waren, 1996; Cadee, 1998) or that this
variation indicated incipient speeiation (Rehfeldt, 1968;
Panico and Patti, 2005).
Oliverio (1996) suggested a mechanism of speeiation
explaining the origin of P/NP pairs in the NE Atlantic
region. This involved the modification of larval devel-
opment, with one species abandoning planktotro-
phic feeding, thus giving rise to another species. From
the observation that in the Mediterranean the non-
planktotrophic mode is more dominant in the East-
ern basin, Oliverio (1996) suggested a paleogeographic
model to explain the reasons of speeiation through the
loss of planktotrophy. During glacial periods sea level
lows caused isolation between the Mediterranean and
the Atlantic, and between the Eastern and Western
Mediterranean basins. The resulting conditions gave rise
to factors thought to select against planktotrophic larvae
(fluctuations in the energy input, restricted areas, and
higher predation pressure; Strathmann, 1978a, b). These
factors may have caused the shift from planktotrophy to
lecitotrophy resulting in speeiation and origin of a P/NP
pair.
Page 118
THE NAUTILUS, Vol. 124, No. 3
Within this scenario, species forming a P/NP pair can
be considered sibling species (sensu Knowlton, 1986),
being both cryptic (i.e., difficult to distinguish using the
traditional morphological characters) and sister (i.e.,
sharing the same ancestor).
After the examination of a large amount of museum
material of Rissoa guerinii Recluz, 1843, and R issoa lia
(Monterosato), 1884 (Rissoidae), Verduin (1985)
highlighted a strong resemblance in shell characters
between these species and concluded that they “may
often only be identified reliably by their type of apex”
(Verduin 1986: 14). Their distribution (Verduin, 1985)
overlaps in the Western Mediterranean, but only
R. guerinii , occurs in the Atlantic and is absent from the
Adriatic and Aegean, where R. lia is present.
In this work we provide, based on both dry and live-
eolleeted material, a critical reinterpretation of the two
taxa and investigate their phylogenetic relationships.
MATERIALS AND METHODS
The source of the biological material examined in this
study is twofold. Snails from field sampling and empty
shells belonging to the historical collection of Philippe
Dautzenberg (housed in the Royal Belgian Institute of
Natural History (RBINS), Brussels) have been used in
this research.
Live-collected Material
Sampling of living material was performed in the
infralittoral of Santa Tecla, Sicily ( Mediterranean, Ionian
Sea), where both species commonly occur (Scuderi, pers.
comm.), at 1—5 m depth in Dec. 2005, Apr., Jun., and
Nov. 2006. About 0.03 m3 of the red alga Pterocladiella
capillacea (S. G. Gmelin) Santeliees and Hommersand
was collected by SCUBA diving for each sample. Mate-
rial was immersed in seawater and transferred to the
laboratory. Each sample was divided into 20 subsamples
that were individually washed in a tank containing 5 1 of
50% seawater for not more than five minutes. Osmotic
shock provided caused the vagile fauna to detach from
the algal thallus and fall in the bottom of the tank, from
where the specimens were quickly collected and placed
in seawater. Living material was sorted and taxonomi-
eally determined under a Wild Makroskop M420 stereo-
scopic microscope. Specimens belonging to Rissoa
guerinii and R. lia were isolated; their sex was deter-
mined by checking the presence of a penis in the right
side of pallial cavity. Some were placed separately in
running seawater at 18°C and provided with fresh
P. capillacea thalli, others were immediately preserved
in 80% ethanol. Reared specimens did not survive more
than 6 weeks; empty shells of dead specimens were
retained and used for observation.
Shells and Head-foot: Adult living specimens of both
Pi. guerinii and R. lia were placed in a Petri dish with
seawater. Shells were held with forceps and the snails
attempted to crawl extending their foot completely,
enabling the head-foot to be observed in detail. Images
were taken and digitized using a Leica DFC 300 FX
video camera and Leica Application Suite version 2.4.0
software. Color drawings were also made to better rep-
resent the color pattern of the head-foot.
Traditional Shell Morphometry: Standard teleo-
conch (L, M, W^.i, Dn-i) and protoconch parameters
(d and D0) (Verduin, 1982a) were measured on a sample
of 100 randomly selected shells (from 53 males and
47 females) from live-collected material of each species.
The total number of shell whorls (N) was also counted.
The following standard teleoconch ratios were calcu-
lated: relative height (L/N), slenderness (L/Dn_i), rela-
tive aperture height (M /L) and last-whorl height over
width ratio (WN.]/ Dn_;l).
A principal component analysis (PC A) and a discrimi-
nant analysis (DA) were performed on the dataset
obtained combining protoconch parameters and
teleoconch ratios. Tests and plots were implemented by
SPSS v.15 statistical software (© SPSS Inc., 2006) and
by SYSTAT statistic software v. 12 (Wilkinson et ah,
1992).
Geometric Shell Morphometry: Fifteen shells
(8 females and 7 males) at terminal growth were ran-
domly selected from live-collected material of each spe-
cies. Shells were observed using a Leica Z16 APO
stereoscopic microscope, and colour images were taken
and digitized using a Leica DFC 300 FX video camera
and Leica Application Suite version 2.4.0 software. The
shells were always placed in the same position, with
the coiling axis in vertical position and the aperture on
the same plane as the objective (Carvajal- Rodriguez et al.,
2005). Using the software tpsDIG2 v. 2.10 (Rolilf, 2007a),
19 landmarks (LM) were established (Figure 1). LM1 is
the apex of the shell; LM2, LM4 and LM6 are placed on
the right border of the profile at the beginning of the
three last complete whorls. LM15, LM17, and LM19 are
the corresponding landmarks on the left border of the
profile. LM3, LM5, LAI 16, and LAI 18 mark the interme-
diate position respectively between LM2 and LM4, LM4
and LAI6, LM15 and LAI 17, LM17, and LM19 along the
curvature of the whorl; LM8 is at the lower suture of the
last complete whorl and LM7 marks the intermediate
position between LM6 and LM8 along the curvature of
the whorl. LM9 is the most external position in the upper
part of the outer lip; LM 10 and LAI 12 are the most exter-
nal positions respectively in the external right and left
part of the outer lip; LM11 is the lowest point at the base;
LM14 is the most external point in the last whorl at the
left profile of the shell; LM 13 is the profile point between
LM12 and LM14 (closest to LM7). As described in
Carvajal-Rodriguez et al. (2005) the matrix of raw coordi-
nates generated by tpsDIG2 was used in tpsRelw v.1.45
(Rolilf, 2007b) to compute shell size (CS), uniform
(U1 and U2) and non-uniform (several relative warps,
RWs) shape components for each specimen. Standard
F. Criscione and F.P. Patti, 2010
Page 119
Figure 1. Shell of a live-collected R. lia from S. Teela show-
ing the placement of the 19 landmarks used for geometric
morphometric analysis. Scale bar = 1 mm.
parametric tests were performed on the obtained vari-
ables using the SPSS/PC package v. 15.0.
Radular Analysis: The shell of 10 live-collected spec-
imens of each species was removed and the bodies incu-
bated for 3—4 hours at 50°C in 70% KOH solution. After
complete tissue dissolution, radulae were isolated, rinsed
in distilled water, and mounted on SEM stubs. Observa-
tion and pictures were made using a Jeol JSM-6700F
scanning electron microscope. The cusps of rachidian
and lateral teeth were counted and frequency histograms
were drawn to show differences in cusps arrangement
between the two species.
Molecular Systematics: Forty-five ethanol preserved
specimens of R. guerinii and 34 of R. lia were randomly
selected from live-collected material. The shell of each
specimen was broken in a mortar and removed. DNA
extraction plus amplification, purification and sequencing
of a 337 bp segment of mitochondrial 16S rRNA gene
were performed as described in Criscione et ah, 2009.
Sequences obtained were aligned with CodonCode
Aligner v. 1.6.3 (CodonCode Corporation, Dedham,
MA) and the alignment refined by eye. For all samples.
Table 1. List of studied material in Dautzenberg collection
(RBINS).
Table 2. GenBank accession numbers for the sequences
used in the analysis. Accession numbers with the prefix GU
were collected for this study.
both forward and reverse strands were analysed.
Genbank accession numbers for sequences used in the
analysis are given in Table 2.
For the sequences generated, Parsimony and Maxi-
mum likelihood trees were obtained using PAUP* v.
4.04 (Swofford, 2003). The program Modeltest version
3.06 (Posada and Crandall, 1998) was employed to select
HKY+I model in Maximum Likelihood. In computing
trees, the option of 1000 bootstrap replicates was
selected. A reduced median joining network (MJ)
(Bandelt et ah, 1999) was obtained with the software
Network v. 4.5 (http:/Avww.fluxus-teehnology.com/
NETW4500.exe).
Dautzenberg Collection Material
The relevant material in the Dautzenberg collection was
examined using an Olympus® SZX10 stereoscopic
microscope. After this survey, 15 lots were selected as
on their historical value as vouchers (Verduin, 1985)
and the specific determination of the shells contained
Page 120
THE NAUTILUS, Vol. 124, No. 3
was verified according to current taxonomy. Clearly
misclassified specimens in the lots were temporarily
removed and not further considered. Several specimens
of each lot were observed using the stereomicroscope
and digital pictures were taken with an Olympus®
CAMEDIA C-7070 WZ digital camera. Table 1 contains
the list of the lots studied, accompanied by the data on
the original label, the number of specimens present and
photographed, and their revised species determination.
An acronym is given to enable identification oi the lot in
the following text.
RESULTS
Live-collected Material
Rissoa guerinii Shell: Shell spindle-shaped; apex
solid, sharp and glossy; whorls 7, apical 2-3 nearly llat-
sided, 3-4 youngest ribbed and more convex, with pen-
ultimate whorl generally bulging out and giving shell
characteristic fusiform shape. Shells of females always
bigger than those of males with same number of whorls.
Shell ornamentation composed by axial ribs and inter-
vening furrows, spiral ridges and intervening grooves,
and growth lines. Shells devoid of spiral ornamentation
rarely found. Axial ribs limited to youngest 3-4 whorls,
11-14 per whorl, robust and prominent, swelling in mid-
dle of whorl and fading toward shell base; normally
slightly opisthocline, tending to prosocline on body
whorl near aperture and close to suture being slightly
flexuous; each rib equal in breadth to interspaces.
Extremely weak labial rib, often having appearance of
whitish smudge as broad as two axial ribs, starting from
end of last axial rib and ending before outer lip. Spiral
ridges with grooves delicately and closely cancellated as
a result of intersection with growth lines. Growth lines
prosocline and running obliquely over ribs and furrows.
Aperture as described by Fretter and Graham (1978).
Two distinct shell colour varieties detected: typical and
“var. conspersa” (Dautzenberg and Durouchoux, 1914).
Typical R. guerinii (Figure 2) with ribless white-brown-
ish or lilac whorls, youngest showing sinuous brown spi-
ral lines corresponding to furrows of ribbed whorls.
Ribless whorls with fawn or brown background colour
on furrows among ribs and on shell base (sometimes
tinged pale lilac up to base of ribs). A checkerboard
pattern (or a series of zigzag lines) created by back-
ground color and a whitish color occasionally present.
Ribs always whitish or pale lilac. Peristome pale violet,
throat with brown-lilac band extending on to columella.
Rissoa guerinii “var. conspersa” (Figure 3) with entire
shell covered by a uniform chess board pattern or a
series of zigzag lines (as described for some typical
shells), with predominance of a dark brown colour over
whitish colour. Ribs often encircled by a white line, nor-
mally interrupted in correspondence of intervening fur-
rows. Apex, peristome, and inner part of aperture as
described for typical pattern.
Rissoa guerinii Head-foot: As for shells, two colour
types detected (Figure 6, 7), viz. typical R. guerinii
and R. guerinii “var. conspersa” (Dautzenberg and
Figures 2-9. Pictures of shells and drawings of soft body parts of R. guerinii typical (2, 6), R. guerinii “var. conspersa” (3, 7), R. lia
“var. castanea” (4, 8) and R. lia “va r.ftlva" (5, 9). Scale bar = 1 mm. Drawings by D. Scuderi.
F. Criscione and F.P. Patti, 2010
Page 121
Durouchoux, 1914). Foot always whitish and median
part of sole stained brown, lighter in typical R. guerinii
than in “var. conspersa.” Snout light brown in R. guerinii
typical and darker brown in “var. conspersa." Margins
of distal portion of snout and remaining part of head
yellowish in R. guerinii and light brown in “var.
conspersa.'’ Cephalic tentacles whitish, but sometimes
dark brown in “var. conspersa.” A whitish spot behind
base of cephalic tentacles always present.
Rissoa lia Shell: Shell conical, apex solid, obtuse and
opaque; whorls 6, all equal-sided and tumid, apical 2
whorls ribless, others ribbed or ribless (though last whorl
often ribless), penultimate generally not bulging out rest.
Sexual dimorphism as for R. guerinii. Shell ornamenta-
tion of axial ribs and intervening furrows, spiral ridges
and intervening grooves, and growth lines. No shells
devoid of spiral ornamentation found. Axial ribs (when
present) always 14 per whorl, strong and prominent, with
same thickness across whorl but fading towards base on
body whorl; normally slightly opisthocline, tending to be
prosocline; each rib slightly narrower than intervening
furrow. No labral rib or whitish smudge before peristome
present. Spiral ornamentation as for R. guerinii. Aper-
ture oval or D-shaped, peristome not showing sinuses or
slight projection of inner lip; edge very thin, beveled
internally turning out to form a though thin flange. Outer
lip arising below periphery of body whorl, (somewhat
below level at which ribs end), its curvature initially
slight or sometimes nearly straight. Columella short,
peristome everted over a groove, no umbilicus present.
Two distinct color varieties detected, here named
castanea and fulva (after Monterosato, 1884). Intermedi-
ate specimens rarely found. R lia “var. castanea”
(Figure 4) violet-brownish to dark brown with ribs always
lighter. First two whorls white but sometimes brown to
dark brown. Peristome violet-brownish. R. lia “var. fulva "
(Figure 5) uniformly fawn with ribs always lighter or
even whitish. First two whorls fawn or white. Peristome
as in “var. castanea ”, but neck with a brown-lilac band
running from lower border of labral rib to columella.
Rissoa lia Head-foot: As for R. guerinii , two different
color tvpes detected remarkably distinct in colour pat-
tern and corresponding to shell colour variety and thus
named castanea and fulva (Figures 8, 9). Foot always
entirely whitish and cephalic tentacles always yellowish
with a whitish spot behind their base. In R. lia “var.
castanea” snout dark and its distal part yellowish, in
“var .fulva” snout yellowish, often with a short brownish
stripe running along median part.
Traditional Morphometry: Among the 6 principal
components extracted, PCI (55%) and PC2 (26%)
explained most oi the variance observed (Table 3). Com-
ponent matrix (Table 4) and loading plot (Figure 10)
illustrate the correlation between principal components
and shell variables. PCI is a strongly positively correlated
with L/N, L/Dn_] and WN_i/ DN.l5 strongly negatively
correlated with M/L and weakly negatively correlated
with d and D0. PC2 is not significantly correlated with
teleoconch ratios but it is strongly positively correlated
with d and D0.
No clear clusters resulted from plotting PCI value of
each shell against its respective PC2 value (Figure 11).
The 95% confidence ellipse of R. guerinii contains
almost only positive values of PCI, but both positive and
negative values of PC2 whereas that of R. lia encircles
mostly negative values oi both PCI and PC2.
The eigenvalue of discriminant function between the
two species was 1.307, the canonical correlation 0.753
and the Wilks' lambda (0.433) was highly significant
(p<0.001). The structure matrix (Table 5) shows the
cumulative within-groups correlations between discrimi-
nating shell variables and the standardized canonical dis-
criminant function obtained. Table 6 shows the results of
the classification statistics obtained using the values ol
the discriminant function of each individual to predict its
a posteriori species membership.
Geometric Morphometry: Table 8 shows the per-
centages and a descriptive statistical summary of the
Table 4. Component matrix for the first two principal
components.
Page 122 THE NAUTILUS, Vol. 124, No. 3
PCI (55%)
Figure 10. Loading plot of the shell variables relative to the
first two principal components.
PCI
Figure 11. Scatteqrlot of the first two principal components.
95% confidence ellipses are drawn for each species. Dashed
ellipse represents R. g uerinii.
Table 5. Stn letnre matrix showing the loadings of each shell
variable on the discriminant function. The variables are
ordered by absolute size of correlation within discriminant
function.
Discriminant Function
Table 6. Classification summary for the discriminant analysis.
**P < 0.05, ***P < 0.001.
relative score for CS, the two uniform components and
the first 10 RWs, explaining more than the 91% of
the overall variation. Table 7 shows the results of the
allometrie analysis for shell shape measurements
conducted by step-wise multiple regression analysis for
centroid size (as dependent variable) and two uniform
and 29 non-uniform measurements, as independent vari-
ables. The F test of the regression analysis was highly
significant (p<0.001) and two of the relative waqas,
RW2 and RW9, contributed significantly to the regres-
sion model on the centroid size. Centroid size, uniform
components and only the first ten relative warps were
considered in the analysis of variance (ANOVA), per-
formed to evaluate the significance of differences in size
and shape variables. Shells of R. guerinii and R. lia dif-
fered significantly in CS (p<0.001), RW1 (p<0.05) and
RW2 (p<0.05). The cumulative results of the analysis are
shown in Table 8. The significance level obtained for the
corrected analysis (ANCOVA) with centroid size as
covariate was not maintained for the difference in RW1,
but was not affected for RW2. The eigenvalue of the
stepwise discriminant function between the two species,
calculated for the 29 RWs, was 3.199, the canonical cor-
relation 0.873 and Wilks’ lambda (0.238) was highly sig-
nificant (p<0.001), indicating a good separation between
groups. Twelve shape variables contributed to the
discriminant function (RW1, RVV2, RW4, RW5, RW6,
RW7, RW9, RW10, RW18, RW23, and RW27).
The standardized coefficient matrix (Table 9) shows
the relative importance of the independent variables in
determining the standardized canonical discriminant
function. Using the individual values of the discriminant
functions to predict a posteriori species memberships,
26 (86.7%) individuals out of 30, were assigned to the
correct species, leaving only 4 (13.3%) that were errone-
ously classified. Looking at species statistics (Table 10),
13 (86.7%) specimens of R. guerinii were correctly
assigned to this species and only two (13.3%) were
assigned to R. lia. The same percentages of correctly/
Table 9. Standardized coefficient matrix showing the relative
importance of the shape variables.
erroneously classified specimens of R. lia were observed.
In Figure 12 the thin plate spline representation allows
interpretation in geometric terms the positive (character-
istic of R. lia) and negative deviations (characteristic of
R. g uerinii) values for the most significant non uniform
shape variable, RVV2, between the two species.
Radular Analysis: No relevant differences emerged
between the radulae of R. guerinii (Figure 13) and
R. lia (Figure 14) in relation to the shape of teeth and
cusps. Rachidian with one median cusp, two pairs of
lateral cusps and two pairs of basal cusps. Lateral tooth
with a median primary bigger cusp with respectively
2-3 inner cusps and 4-5 outer cusps in R. guerinii or
2 inner cusps and 3-5 outer cusps in Pi. lia. Figure 15
represents the frequency distribution of tire number
of cusps of the lateral tooth observed in the sample
studied and shows higher variability in R. guerinii for
this character.
Figure 12. Thin plate spline representations for RW2, show-
ing the deformation of the grid for the average values of
R. guerinii (left) and R. lia (right).
Molecular Systematic^: The topologies of the P and
ML trees (Figure 16 and 17) were comparable: two main
clades, corresponding to R. guerinii and R. lia , clearly
separated from each other and from the outgroups by
high bootstrap values.
Two individual sequences of R. guerinii formed a
weakly supported clade closely related to the main one
of R. guerinii. The M [ network (Figure 18) showed two
consistently distinct (IS differences) clusters of haplo-
types (corresponding to R. guerinii and to R. lia). R.
guerinii displayed higher genetic structure than R. lia ,
witli one haplotype occurring in 29 specimens, 2 occur-
ring in 2 specimens and 11 unique haplotypes. No single
haplotype of R. lia appeared to be dominant: the most
common ones occurred in 11,8, 5, 5 and 2 specimens; 3
were unique. Both clusters were consistently distant
from 5 out of 6 outgroups, with R. lia closer than
R. guerinii. Unexpectedly R. auriscalpium revealed veiy
little difference (1-2) from some R. guerinii haplotypes.
Page 124
THE NAUTILUS, Vol. 124, No. 3
Figures 13-14. SEM photographs or the radular ribbon of
R. guerinii (13) and R. lia (14). Scale bar = 10 pm.
Dautzenberg Collection Material
Shell Visual Observations: Rissoci guerinii: The shells
of the lot Rga were considerably worn, younger whorls in
most uniformly whitish, in some uniformly yellowish;
older 2—4 whorls always pale violet. Most of the shells of
Rgb showed worn whitish/yellowish lowermost whorls
and remaining whorls with the pigmentation described
for R. guerinii typical. Shells of Rgc were better pre-
served and showed the chessboard (or zigzag) pattern
described above for R. guerinii “var. conspersa” .
Rissoa lia: Shells of Rlma and Rlmb were topotypes,
the former being also from Monterosato collection.
Although these shells were rather worn, the two colour
varieties, described above for R. lia, were still detectable
on the younger whorls but had completely disappeared
from the whitish oldest whorls.
Shells of Rip and Rlt were worn but a different pat-
tern, with a whitish spiral band running in the middle ol
the youngest whorls on a dark brown background.
2 3 3 4 5
Figure 15. Frequency histograms of distribution of inner
and outer cusps in the lateral tooth of R. guerinii and R. lia.
DISCUSSION
Shell and Head-foot: While in the early malacologi-
cal literature satisfactory descriptions ol the shell of
R. guerinii are available (Jeffreys, 1869; Fretter and
Graham, 1978), descriptive data on R. lia are limited to
its essential original description (Monterosato, 1884;
page 139).
Verduin (1985) provided a reinterpretation of the two
taxa, stressing an extremely close morphological resem-
blance between them. However he based his diagnosis
only on museum chy material, often in a poor state
of preservation. As an example, the character “punctate
spiral striae” (Verduin, 1985, pages 112 and 114),
reported for the shells of both species, should be consid-
ered the result of the deterioration of the subtle reticu-
late pattern, formed by growth lines and spiral ridges and
easily visible in fresh shells.
The redescriptions provided here are based on fresh
shells at terminal growth, which maintain the peculiar
characters ol ornamentation and pigmentation ol each
species, but at the same time are readily matched with
original museum material.
Dautzenberg and Durouchoux (1914), on the base of
the material of the lots here named Rga, Rgb, and Rgc,
described four colour varieties for R. guerinii : typical
(white with the intervals among ribs brown), conspersa
(brown background with a chessboard pattern formed by
very small spots), albina (totally white) and bipartita
(with the first five or four whorls dark violet and the
remaining entirely white). Based on the same material,
Verduin (1985) even suggested the presence of a north-
ern R. guerinii subspecies (showing the latter two color
F. Criscione and F.P. Patti, 2010
Page 125
R. guerinii
10
R. guerinii
100
Figures 16-17. Parsimony (16) and Maximum Likelihood (17) Trees drawn after the analysis of IBS sequences of R. guerinii and
R. lia. Circle radius is proportional to sequences frequency. Bootstrap values are given at the left side of each branch.
O
R. guerinii (45)
R. lia (34)
outgroups
median vector
• • • •
R. viohicea
8
16
- ©
R. variabilis
Figure IS. Median Joining Network drawn on the basis of 16S sequences. Number of sequences employed in brackets. Circles
radius proportional to haplotype frequency. Dashed lines represent mutational distance higher than 4 (values reported nearby).
varieties) and a southern one (showing the former ones).
We cannot see any justification for these claims as the
varieties albina and bipartita are the result of the deteri-
oration of the typical pigmentation, as shown by the
worn shells forming the lots Rga and Rgb.
Although his interpretation of R. lia (based on die obser-
vation of Rlma and Rlmb lots) is generally correct, Verduin
(1985: 114) added to its species diagnosis the observation
diat “in a sample from Trapani, Sicily (fig. 25) many colours
and colour patterns can be discerned, among which die
colour pattern conspersa known in II guerinii. "
This observation apparently suggested to Verduin
(1985) the idea to move R. lia from the subgenus
Apicularia Monterosato, 1884, to Goniostcmm Villa, 1884
(the same subgenus of R. guerinii). We regard his obser-
vation as incorrect and in disagreement with the original
description of Monterosato (1884) and with our observa-
tions on the material in this study. We found no evidence
Page 126
THE NAUTILUS, Vol. 124, No. 3
that the color pattern conspersa belongs to R. lia.
Although we could not examine the sample mentioned by
Verduin (1985), an examination of the figures he provided
(25a-h), allowed us to assess that these figures are com-
posed by a mixture of shells of R. lia and R. guerinii shells,
associated because of their similar apex dimensions.
However, the statement that some R. lia show “the
presence of broken brownish colour lines which encircle
the shells” (Verduin, 1985: 114), is in agreement with
observations made on lots Rip and Rlt and with some
recent peculiar records of Rissoa sp. from Sardinia
(Tyrrhenian Sea), showing this same peculiar coloration
(Fasulo, pers. comm.). Although this coloration is not
typical of the type material of R. lia , further observation
on live-collected material from these localities is needed
to properly address the issue.
Rissoa species tend to maintain the head-foot colour
pattern (i.e., position and dimensions of elements as spots
or blotches), although they may show intraspecific varia-
tion in colour intensity (Fretter and Graham, 1978). This
phenomenon has been employed to support species iden-
tity (R. pawn and R. interrupta , Waren, 1996; R. guerinii
and R. panhormensis , Criscione et al., 2009) or to hypoth-
esize recent speciation (71 membranaeea type A and B,
Rehfeldt, 1968; R. auriscalpium type a and b, Colognola
et al., 1986). Tins rule is in agreement with the slight
variation in color intensity observed in this study lor the
two varieties of R. guerinii , but it does not apply to R. lia ,
whose color varieties showed two distinct patterns.
Traditional Morphometry: Although the present
morphometric analysis is restricted to populations from
a single locality, its results are not only helpful in under-
standing intrapopulation variability in shell morphology,
but also in drawing more general conclusions in terms
of specific differentiation. The differences observed can
be expressed in terms of teleoconch and protoconch
variation, with the first element being by far the most
important. Populations of both species show a wide
variability in protoconch dimensions, which is larger for
R. guerinii. Rissoa lia shows twice the intrapopulation
variation in teleoconch characters than that observed
for R. guerinii.
The values of shell parameters obtained for the two
species showed a considerable overlap, which is mainly
dependent on the strong similarity in protoconch dimen-
sions and not, surprisingly, by the resemblance of the
teleoconehs. Most shells of R. guerinii appear to have a
larger relative size, a more elongated aperture and to be
more slender than most R. lia shells.
Discriminant analysis showed that R. guerinii and
R. lia populations can he distinguished mainly for the
more elongated aperture of R. guerinii shells, for their
larger relative size, and the higher slenderness. The
importance of protoconch is only marginal.
In summary, our results show that teleoconch mor-
phometry can be efficiently used to discriminate between
R. guerinii and R. lia , whereas protoconch dimensions are
less representative of the overall interspecific variation
and less reliable, due to the large overlap shown. This idea
is in contrast with the view of the discriminating power of
protoconch dimensions (Verduin, 1986).
Some Methodological Considerations: Cadee
(1998: 91) critically revised the methodology used by
Verduin (1976, 1982b, 1985, 1986) highlighting that the
measurements of d and D0 “depend on the accurate
vertical position of the shell and the somewhat arbitrary
location of the line along which d and D0 are measured.”
Cadee (1998) dealt with the former issue by performing
repeated measurements of d and D() on specimens of R.
membranaeea, whose vertical placement was reiterated
ten times, and obtained a standard deviation of about
0.01 mm for both the variables. This value is roughly the
same as that which separates the mean values of d and
D0 of R. lia and R. guerinii in this study (not shown).
This means that some of the differences in protoconch
dimensions might be indeed the consequence of the
inaccurate measurements, rather than representing real
variation. The alternative solution of performing mea-
surements on digital photographs has been also recently
employed (Criscione et al., 2009). The second issue is
that real Rissoa protoconchs often do not correspond to
the ideal shell apex figured by Verduin (1977; Figure 1),
but most of them are rather irregular. In protoconchs
like these there is a large range of possibilities to locate
the line along which d and D0 should be measured and
the choice is largely arbitrary.
Geometric Morphometry: The ANOVA revealed a
significant larger size (CS) of the shells of R. guerinii
compared to those of R. lia, confirming the results
of visual observations and traditional morpliometiy.
ANOVA showed a significant difference (p<0.05)
between the two groups in the first (RVV1) and the sec-
ond (RW2) non-uniform shape variables. The signifi-
cance for RW2 remained unaltered when correcting the
analysis for CS (ANCOVA), while that of RW1 was not
significant, indicating that the shape difference ex-
plained by that variable was dependent on size. This
means that the two groups differ exclusively on the sec-
ond non-uniform shape variable (RW2), independently
from the correlation between shape and size.
Tl le discriminant function calculated from all the
non-uniform shape variables, was successful in morpho-
metrically discriminating the two groups. RW2 was the
most important variable in determining the distinction
between R. guerinii and R. lia. The mean values of this
variable for each of the two groups (positive for R. lia
and negative for R. guerinii) were plotted in a tps repre-
sentation (Figure 12). The plot showed that that variable
RW2 is a reflection of the most obvious discernable
shell shape difference. This comprised the more fusi-
form shape of R. guerinii, contributed by consistently
narrower whorls than those of R. lia (represented by the
contraction of the corresponding zone of the grid) and a
substantially equal penultimate whorl.
F. Criscione and F.P. Patti, 2010
Page 127
The grid deformation in the plot of R. lia increase
progressively from the top to the middle-lower as
expected for a more conical shape. In the same plot,
larger deformations of the upper part and the lower ol
the grid for R. lia , account respectively lor the more
obtuse apex and the larger aperture of R. lia.
Radular Analyses: Although the taxonomical value of
radular morphology in rissoids is exclusively limited to
generic level (Ponder, 1985), comparative analysis ol pat-
terns of similarity may be helpful in resolving the com-
plexity of a highly diverse genus such as Rissoa. Along
with other characters, differences in the size of the cusps
of marginal tooth have been employed to show ditier-
ences between two morphs of R. aiiriscalpium (Colognola
et al., 1986) and radular identity has been used to support
findings of recent speciation in R. membranacea morphs
(Rehfeldt, 1968).
However, detailed reports on the taxonomic value ol
cusps in rissoids are lacking and this makes it difficult to
give the appropriate weight to the difference between
R. guerinii and R. lia in the relative number of cusps ol
the lateral tooth. But the pattern emerged appears to be
rather constant and its eventual value as distinctive char-
acter of phylogenetic significance cannot be excluded.
Molecular Systematics: Analysis of mitochondrial
sequences of gastropod taxa, involved in a recent specia-
tion event (or an ongoing speciation process), often show
traces of introgression (e.g., Kirby et ah, 1997; Kojima
et ah, 2001). Introgression shown by 16S sequences has
been used to support ongoing speciation in the P/NP
pair of sympatrie siblings Rissoa auriscalpium/R.
italiensis (Panico and Patti, 2005). In this study, no evi-
dence of introgression was detected for sympatrie
populations of R. guerinii and R. lia , suggesting that
claims of recent speciation are not acceptable. However,
the evolutionary rate of 16S rRNA is not known in
rissoids and the hypothesis of an earlier cladogenetic
event, giving rise to R. guerinii and R. lia , cannot be
excluded. The results of our molecular analysis also chal-
lenge the likelihood of this scenario.
The ML analysis (Figure 17) failed in resolving the
polytonry resulted for sequences ol R. guerinii , R. lia
and one of the outgroups, R. similis , as expected il our
ingroups were sister species. Before Verduin (1985)
moved R. lia to the subgenus Goniostoma , a closer rela-
tionship between this species and R. similis was com-
monly accepted (as both members of the subgenus
Apicularia). Our results may be considered in agreement
with this idea.
The hypothesis of the shared origin of R. guerinii and
R. lia would require much lower mutational distance
between the two sister species than between each sister
species and the outgroups. Our MJ network (Figure 18)
shows that this is not the case. R. lia is separated from
the main haplotype of R. guerinii by a distance of the
same order of magnitude than the distance separating
this species from the other outgroups.
The significant difference in haplotype diversity of R.
guerinii and R. lia (shown by the same analysis) may be
the result of stochastic events in the evolutionary history
of these lineages or may be alternatively related to the
supposed alternative strategy ol larval dispersal (P/NP).
Rissoa guerinii displays a higher genetic structure which
may reflect a higher genetic flow, due to its higher
dispersal capability. Conversely, R. lia shows a lower
structure which would reflect a lower level of gene
flow. Despite records of R. guerinii planktotrophic
veligers have been long reported (Lebour, 1934; Thiriot-
Quievreux and Babio, 1975), no evidence for the
non-planktotrophic strategy of R. lia are known and suc-
cessful laboratory experiments on spawning are lacking.
The actual strategy of dispersal of the two species is thus
still to be confirmed.
Surprisingly, an outgroup sequence of R. aiiriscalpium
showed only two differences from the main R. guerinii
haplotype. This short distance fits in the normal intraspe-
cific (and even intrapopulational) variability of R. guerinii
and represent a clue ol previously unsuspected genetic
similarity between the two species. Further investigation
is required to properly address the issue.
CONCLUSIONS
The taxonomic revisions of Verduin (1976, 1977, 1982b,
1985, 1986), although based exclusively on empty shells,
have represented landmarks in the a-taxonomy ol
Rissoa. Despite some evidence of the taxonomic
unreliability of shell characters in Rissoa (e.g.Wigham,
1975; Waren, 1996), only a few attempts have been made
to dispute his conclusions. These include criticism of his
methods (Cadee, 1998) and the utilization of non shell-
based approaches (Colognola et al., 1986; Panico and
Patti, 2005; Criscione et ah, 2009). This trend lias been
followed in our work, which demonstrates the value of
a synergy between modern techniques applied to the
analysis of shell characters and molecular methods.
The present study has shown that the veiy similar shell
morphology of R. guerinii and R. lia hides a clear distinc-
tion in other characters, indicating that they should not
be considered as a cryptic pair of sister taxa.
ACKNOWLEDGMENTS
We are grateful to Dr. Danilo Scuderi (Universita di
Catania) for having provided the drawings shown in
Figures 6-9. We would also like to thank Prof. Jackie
Van Goethem and Prof. Thierry Backeljau (RBINS) for
the possibility to study Dautzenberg collection material.
We want to express gratitude to Prof. Domenico Caruso
and Prof. Grazia Cantone (Universita di Catania) for
financial support, the Molecular Biology Service and the
Scanning Electron Microscopy Service of Stazione
Zoologica “Anton Dohrn" (Naples). We are also thankful
to Dr. Winston F. Ponder and an anonymous referee for
their valuable comments.
Page 128
THE NAUTILUS, Vol. 124, No. 3
LITERATURE CITED
Bandelt, H.J., P. Forster, and A. Rohl. 1999. Median-joining
networks for inferring intraspecific phvlogenies. Molecu-
lar Biology and Evolution 16: 37^8.
Bouchet, P. 1989. A review of poecilogony in gastropods. Jour-
nal of Mollusean Studies 55: 67-78.
Cadee, G.C. 1998. Rissoa membranacea (J. Adams, 1800)
(Gastropoda, Prosobranchia) from the Dutch Wadden
Sea. Basteria 61: 89-98.
Colognola, R., P. Masturzo, G.F. Russo, M. Scardi, D. Vinci,
and E. Fresi. 1986. Biometric and genetic analysis of the
marine rissoid Rissoa auriscalpium and its ecological
implications. Marine Ecology, 7: 265-285.
Criscione, F., Scuderi, D., and F. P. Patti. 2009. Revising
a-taxonomy in shelled gastropods: the case of Rissoa
panhormensis Verduin, 1985. The Nautilus 123: 303-312.
Fretter, V. and A. Graham. 1978. The prosobranch molluscs of
Britain and Denmark. Part 4. Marine Rissoacea. Journal of
Mollusean Studies Supplement 6: 151-241.
Jablonski, D. and R.A. Lutz. 1983. Larval ecology of marine
benthic invertebrates - paleobiological implications. Bio-
logical Reviews of the Cambridge Philosophical Society'
58: 21-89.
Jeffreys, J.G. 1867. British Conchology. Volume IV. Van Voorst,
London. 486 pp.
= Knowlton, N. 1986. Cryptic and sibling species among the
decapod Crustacea. Journal of Crustacean Biology 6:
356-363.
Kojima, S., N. Ota, K. Mori, K., T. Kurozumi, and T. Furota.
2001. Molecular phylogeny of Japanese gastropods in the
genus Ratillaria. Journal of Mollusean Studies 67: 377-384.
Lebour, M. V. 1934. Rissoid larvae as food of the young herring.
The eggs and larvae of the Plymouth rissoides. Journal of
Marine Biological Association of United Kingdom 19:
523-539.
Monterosato, T.A. d. 1883-1885. Conehiglie littorali
mediterranee. Naturalista Sieiliano 3(3): 87-91 (1883);
3(4): 102-111; 3(5): 137-140; 3(6): 159-163; 3(8): 227-
231; 3(10): 277-281; 4(1-2): 21-25; 4(3): 60-63 (1884);
4(4): 80-84; 4(8): 200-204.
Oliverio, M. 1996. Contrasting developmental strategies and
speciation on north-east Atlantic prosobranehs: a prelimi-
nary analysis. In: Taylor, J.D. (ed.) Origin and evolutionary
radiation of the Mollusca. Oxford Science Publications,
Oxford, pp. 261—266.
Panico, M. and F. P. Patti. 2005. Poecilogenesis in Rissoa
auriscalpium complex (Coenogastropoda: Rissoidae).
Poecilogony engine of speciation. Congresso Internazionale
delle Societa Europee di Malacologia, Naples, October
2005. Poster presentation.
Ponder, W. 1985. A review of the genera of the Rissoidae
(Mollusca: Mesogastropoda: Rissoacea). Records of the
Australian Museum 4 (Suppl.): 1-221.
Posada, D. and K. A. Crandall. 1998. MODELTEST: testing the
model of DNA substitution. Bioinformatics 14: 817-818.
Recluz, C.A. 1843. Catalogue descriptif de plusieurs nouvelles
especes de coquilles de France suivi d'observations sur
quelques autres. Revue zoologique, par la Societe
Cuvierienne. 6: 5-12, 104-112, 228-238, 257-261.
Rehfeldt, N. 1968. Reproductive and morphological variations
in the prosobranch Rissoa membranacea. Ophelia 5:
157-173.
Rohlf, J.F. 2007a. TpsDig2 version 2.10. Available via http://life.
bio.sunysb.edu/moqili/soft-tj)s.htmI (Accessed July 2008).
Rohlf, J.F. 2007b. TpsRelw version 1.45. Available via httqo ://
life.bio.sunysb.edu/morpli/soft-tps.html [Accessed July
2008)].
Strathmann, R.R. 1978a. Evolution and loss of feeding larval
stages of marine invertebrates. Evolution 32: 894-906.
Strathmann, R.R. 1978b. Progressive vacating of adaptive types
during the Phanerozoic. Evolution 32: 907-914.
Swofford, D.L. 2003. PAUP*: Phylogenetic analysis using par-
simony (*and other methods), version 4.0b 10. Sinauer
Associates, Sunderland.
Thiriot-Quievreux, C. and C. R. Babio. 1975. Etude des
protoeonques de quelques prosobranches de la region de
Roscoff. Cahiers de Biologie Marine 16: 135-148.
Thorson, G. 1950. Reproductive and larval ecology of marine
bottom invertebrates. Biological Reviews 25: 1—45.
Verduin, A. 1976. On the systematic of recent Rissoa of the
subgenus Turboella Gray, 1847, from the Mediterranean
and European Atlantic coasts. Basteria 40: 21-73.
Verduin, A. 1977. On a remarkable dimorphism of the apices in
many groups of sympatric, closely related marine gastro-
pod species. Basteria 41: 91-95.
Verduin, A. 1982. How complete are diagnoses of coiled shell
of regular build? A matematical approach. Basteria 45:
127-142.
Verduin, A. 1982b. On the taxonomy and variability of Recent
European and North African marine species of the subge-
nus Rissostomia Sars, 1878, of the genus Rissoa
Desmarest, 1814 (Mollusca, Gastropoda, Prosobranchia).
Basteria 45: 143-166.
Verduin, A. 1985. On the taxonomy and variability of
Recent European and North African marine species of the
subgenera Apicularia and Goniostoma of the genus Rissoa
(Gastropoda, Prosobranchia). Basteria 49: 105-132.
Verduin, A. 1986. On the systematies of some Recent Rissoa
(Gastropoda, Prosobranchia). Basteria 50: 13-21.
Waren, A. 1996. Ecology and systematies of the north Euro-
pean species of Rissoa and Pusillina (Prosobranchia:
Rissoidae). Journal of the Marine Biological Association
of United Kingdom 76: 1013-1059.
Wigham, G.D. 1975. Environmental influences upon the
expression of shell form in Rissoa parva (da Costa)
[Gastropoda: Prosobranchia]. Journal of the Marine Bio-
logical Association of United Kingdom 55: 425-438.
THE NAUTILUS 124(3): 129-136, 2010
Page 129
Molecular phylogeny of Conus chiangi (Azuma, 1972)
(Gastropoda: Conidae)
Maren Watkins
Department of Pathology
University of Utah
Salt Lake City,
Utah, 84112 USA
Patrice Showers Corneli
Department of Biology
University of Utah
Salt Lake City,
UT 84112 USA
David Hillyard
Department of Pathology
University of Utah
Salt Lake City,
UT 84112 USA
Baldomero M. Olivera
Department of Biology
University of Utah
Salt Lake City,
UT 84112 USA
ABSTRACT
Conus chiangi (Azuma, 1972) has been regarded by several
workers as morphologically distinctive enough from other
Conus species to merit placement in its own genus (e.g.,
Taranteconus , Azuma, 1972). We demonstrate using standard
molecular markers that this species is related to such well-
known species as Conus imperialis Linne, 1758, and Conus
regius Gmelin, 1791, which are generally regarded as belong-
ing to the Stephanoconus (Morch, 1852), elade. Stephanoconus
has had impressive radiation of species in the new world, but
only two species were previously assigned to Stephanoconus
from the Indo-Pacific region ( Conus imperialis and Conus
zonatus Hwass, 1792).
We also present data using a toxin ological marker for Conus
chiangi consistent with its inclusion in Stephanoconus. In at least
three species of this clade, a virtually identical peptide toxin (first
called a-conotoxin Iml from Conus imperialis ) was identified.
Although the predicted mature peptide toxin sequences are
closely similar, significant divergence in the prepro region of the
precursors was observed. It is suggested that the conservation of
the mature peptide toxin sequence is a result of strong selection
related to prey choice in Stephanoconus.
The results described here suggest a revised picture of the
radiation of Stephanoconus in the Indo-Pacific. In addition to
the well-known species Conus imperialis and Conus zonatus ,
which comprise one group, a radiation of small Conus species
in deeper water may potentially comprise another distinctive
group of Stephanoconus.
Additional keywords: Conotoxins, peptides, DNA sequence,
molecular markers
INTRODUCTION
Conus chiangi (Azuma, 1972), is a morphologically
unusual Conus species that differs strikingly from other
Conus in its spire sculpture (see Figure 1). For many
years. Conus chiangi was extremely rare and, only very
occasionally collected. The type locality is in the South
China Sea; a junior synonym of Conus chiangi is Conus
lamellatus (Suzuki, 1972) — the type of Conus lamellatus
was collected off of Sumisu Island, near Hachijo Island,
Izu Peninsula, Japan. Probably because of the unique
scale-like spines that line the shoulder margins of the
spire, both Azuma and Suzuki proposed that this species
defined a new genus: Azuma designated Taranteconus as
a new genus for this species while Suzuki proposed
Cornutoconus, reflecting the perceived uniqueness
of Conus chiangi. The taxonomy of C. chiangi has
been discussed by Coomans et al. (19S3) and Roekel
et al. (1995).
More recently, a number of specimens of this unusual
cone snail have been collected in the Philippines. Ini-
tially, collectors using tangle nets obtained specimens
from Cebu and around Bohol Islands. Then, more
recently, use of small trawls allowed for collection of an
even larger number of specimens of! Aliguay Island.
Philippine specimens are shown in Figure 1, including
an inset illustrating the characteristic spire structure. In
this work, we describe a molecular analysis of Conus
chiangi , using a number of different genetic markers to
provide insights into the relationship of Conu.s chiangi to
other species of Conus. Additionally, we present some
unexpected results illustrating selection for conservation
of a toxin expressed in Conus chiangi venom ducts.
In combination, the data we present below demon-
strate that Conus chiangi is not phylogenetically distant
from other Conus species. Thus, there is no justification
for the erection of a new genus for this species, given
that Conus chiangi is shown to be closely related to well-
known species such as Conus imperialis Linne, 1758,
and Conus regius Gmelin, 1791, which belong in the
Stephanoconus clade. This conclusion is reached consis-
tently, no matter which genetic locus we used for the
phylogenetic analysis. The more general biological/evo-
lutionary implications of these results are discussed.
MATERIALS AND METHODS
Preparation of Genomic DNA: Genomic DNA was
prepared from 20 mg Conus chiangi hepatopancreas tis-
sue using the Gentra PUREGENE DNA Isolation Kit
Kit (Gentra Systems, Minneapolis, MN) according to the
manufacturer's standard protocol.
Page 130
THE NAUTILUS, Vol. 124, No. 3
Figure 1. Conus chiangi (Azuma, 1972). Left: A specimen of
Conus chiangi, collected off Aliguay Island, Philippines. Right:
The spire of a different specimen of Conus chiangi , showing a
close-up of the unusual scale-like spine morphology of the
spire shoulder margins. Scale bar = 1 cm.
Cloning and Sequencing of 12S and 16 mitochondrial
RNA segements and Cytochrome Oxidase subunit I
mitochondrial RNA gene segment (BarCOI)
Ten ng of Conus chiangi genomic DNA was used as a
template for polymerase chain reaction (PCR) with oli-
gonucleotides corresponding to L2S-I (5' TCG CAG
CAG YCG CGG TTA) and 12S-III (5' AGA GYG RCG
GGC GAT GTG T) mitochondrial rRNA segments and
16SH (5' CCG GTC TGA ACT CAG ATC ACG T) and
16LC (5' GTT TAC CAA AAA CAT GGC TTC) mito-
chondrial rRNA segments, and oligonucleotides corre-
sponding to COI dgl CO- 1490 (5' GGT CAA CAA ATC
ATA AAG AYA TGY G 3') and COI dgHCO-2198 gene
segments (5' TAA ACT TCA GGG TGA CCA AAR A AY
CA 3' ) . The per cycling profiles are as follows: Initial
denaturation (95°C, 60 s); followed by 40 cycles of dena-
turation (95°C, 20 s); annealing (55°C, 20 s) and exten-
sion (72°C, 30 s). The resulting PCR products were
purified by gel electropheresis, recovered from agarose
using High Pure PCR Product Purification Kit (Roche
Diagnostics, Indianapolis, IN). The eluted DNA frag-
ments were annealed to pNEB206A vector using the
USER Friendly Cloning kit (New England BioLabs,
Inc., Beverly, MA) following manufacturer’s suggested
protocol and the resulting product transformed into
DH5a competent cells. The nucleic acid sequences of
the resulting 12S, 16S and COI-encoding clones were
determined according to the standard protocol lor Auto-
mated sequencing.
Phylogenetic Analysis: Sequences which were first
aligned with Clustal X (Larkin et ah, 2007) and then
refined by eye align obviously homologous regions that
Clustal failed to recognize. Individual genes were
concatenated with MacClade 4.08 (Maddison and
Maddison, 2005).
Since MrBayes (Huelsenbeek et ah, 2001) has the
capability to completely stratify maximum likelihood
model parameters by gene and by codon position
(Ronquist and Huelsenbeek, 2003), we chose it as the
primary method of tree construction. Each analysis com-
prised two simultaneous runs with four chains each.
All runs were sufficiently long to minimize the average
standard deviation of the split frequencies (below
0.05 for COI and 0.007 for 12S rRNA and for the
concatenated sequence of 3 genes. Plots of the number
of generations against the maximum likelihood scores
indicated apparent equilibrium. Further diagnostics
included the potential scale reduction factor (PSRF) that
measures the fit of branch length and all parameters.
Trees and parameters from the first 25% of the genera-
tions were discarded (the burn in) after completion of
the MCMC (Monte Carlo Markov Chain) search. Bayes-
ian analyses comprised two runs with four chains each.
We also used maximum likelihood analysis using
models optimized in PHYML (Guindon and Gascuel,
2003). For each tree, we ran a heuristic maximum likeli-
hood search followed by analysis of 1000 bootstrap repli-
cates to place confidence limits on the trees.
Identification and Sequencing of clones encoding
Chl.l
Genomic DNA from Conus chiangi, prepared as
described above, was used as a template for polymerase
chain reaction (PCR) with oligonucleotides correspond-
ing to the conserved intron and 3' UTR sequences of
previously isolated a-eonotoxin geues:
Forward primer: 5' TGT GTG TGT GTG GTT GTG
GGT 3'
Reverse primer: 5' CTC GAG GTC GTG GTT CAG
AGG 3'
The PCR cycling profiles are as follows: Initial dena-
turation (95°C, 60 s); followed by 40 cycles of denatur-
ation (95°C, 20 s); annealing (62°C, 20 s) and extension
(72°C, 30 s). The resulting per products were purified
using the High Pure PCR Product Purification Kit
(Roche Diagnostics, Indianapolis, IN) following the
manufacturer’s suggested protocol. The eluted DNA
fragments were annealed to pNEB206A vector, and
sequenced as described above.
RESULTS
Molecular phylogeny of Conus chiangi: In order to
assess the phylogenetic relationships of Conus chiangi to
other Conus species, the sequences of three standard
molecular markers were obtained as described under
Materials and Methods above: COI, 12S, and 16S. A tree
based on the COI sequences is shown in Figure 2; a set
of COI sequences from a much larger number of Conus
species were initially analyzed. Only a small subset of
these results is shown, including the species found to
be most closely related to Conus chiangi. The data
M. Watkins et al., 2010
Page 131
70/64
92/84
65/37
78/100
99/88
- C.parius
- C.radiatus
C.laterculatus
- C.tessulatus
C.bandanus
100/100 C.marmoreus
72/-
99/82
76/81
C.imperialis
— C.zonatus
C.chiangi^_
77/77
- C.brunneus
C.regius
C.archon
100/55
79/-
98/72
C.ammiralis
C.gloriamaris
- C.dalli
— — C. textile
1 OOp^J C.furvus
C.aulicus
— i 00/98* CePisc°Patus
C.crocatus
C.aurisiacus
— C.consors
100/78
C.omaria
C.jaspedius
Lophiotoma
C.orbignyi
C.vimineus
Thatcheria
0.2
Figure 2. A Bayesian phylogenetic tree based on COI sequences. Numbers to the left of the slash are Bayesian posterior
probabilities expressed as percentages. Numbers to the right are maximum likelihood bootstrap percentages. Dashes or blanks mark
support values less than 50%. These data suggest that Conus chiangi is related to Conus imperialis and Conus zonatus. Sequences ot
the COI marker of a much larger number of Conus species have been obtained, but only a few clades are shown.
presented in Figure 2 suggest that Conus chiangi is
related to two sli allow- water Indo-Pacific species. Conus
imperialis and Conus zonatus. These two species belong
to a elade known as Stephanoconus , which comprises
cone snails known to specialize on devouring
amphinomid polychaetes (“fireworms”). There is a
greater biodiversity of this group in the new world; in
the Indo-Pacific, the only species that are generally
assigned to the Stephanoconus elade are Conus
imperialis and Conus zonatus (Duda Jr et ah, 2001;
Espiritu et ah, 2001).
The position of Conus chiangi was independently
assessed using 12SrRNA sequences (Figure 3). These
data strongly indicate that Conus chiangi is a member of
the Stephanoconus elade.
We found that an alignment of I6S1RNA, by itself, had
too little phylogenetic signal to yield a meaningful tree.
However, combining the gene with 12S and COI in a
stratified analysis increased the phylogenetic signal to
the extent that the relationship of C. chiangi with the
other Stephanoconus species became clear (Figure 4).
In this case, there is a 100% posterior probability
that Conus chiangi belongs within the Stephanoconus
elade with Conus regius and Conus imperialis. Further-
more, the data suggests that there are three groups in the
elade, one that includes the large Indo-Pacific forms
(Conus imperialis and Conus zonatus ), one that includes
some of the new world forms (Conus regius Gmelin,
1791, and Conus brunneus Wood, 1828) and Conus
chiangi , which in this phylogeny somewhat surprisingly
groups together with the Panamic species Conus archon
Broderip, 1833.
Toxinology: The discoveiy that Conus chiangi venom
ducts expressed a certain type of venom peptide (i.e.,
a-conotoxins (Santos et al., 2004) belonging to the a4/3
subfamily) was an early indication that the species
might be a member of the Stephanoconus elade (Ellison
et al., 2008). Only species in the Stephanoconus elade
are known to express this unusual group ol Conus venom
peptides, which are targeted to nicotinic acetylcho-
line receptors. We report here an even more striking
Page 132
THE NAUTILUS, Vol. 124, No. 3
66/100
100/100
100/99
99/70
•furvus
ammiralis
textile
73/65 ~ 60/67
I episcopatus
Hi 00/98
1 auficus
63/93
97/
radiatus
— parius
laterculatus
74/66
— aurisiacus
consors
— chiangi <-
100/97
71/
64/
100/79
- imperialis
archon
brunneus
regius
• zonatus
■ jaspideus
orbignyi
■Thatcheria
Lophiotoma
0.2
Figure 3. 12SrRNA tree inferred from Bayesian analysis. A topologically identical tree was inferred using maximum likelihood
analysis. Branch labels are as described in Fig 2. Note that the clade defined by the bold line ( Steplwnoconus ) is well supported using
this molecular marker.
illustration of the close affinity of Conus chiangi to other
species in the Stephanoconus clade.
An analysis of peptides in the venom ducts
expressed in Conus chiangi has revealed a precur-
sor to a peptide previously extensively characterized,
a-eonotoxin Iml from Conus imperialis (McIntosh
et ah, 1994). In general, there is a striking sequence
divergence between Conus peptides from different
species. The discovery that a peptide identical to
a-conotoxin Iml is expressed in the venom duct of
Conus chiangi provides additional support that the
two species are related.
A comparison of precursor sequences predicted from
clones obtained from Conus chiangi. Conus imperialis
and Conus regius is shown in Figure 5. The sequences
are aligned to maximize sequence identity. Because the
predicted precursor sequences for Conus imperialis and
Conus regius were obtained from a genomic clone (see
Materials and Methods), these precursor sequences
were incomplete but the available sequences have been
aligned. The predicted mature peptides are shown in the
figure, with the predicted cleavage signals for proteolytic
processing underlined.
The sequences shown in the figure reveal that al-
though the mature peptides from Conus imperialis and
Conus chiangi are identical (and the mature peptide
from Conus regius almost identical); the inferred precur-
sor sequences indicate considerable divergence in the
propeptide region. Thus, this is an unprecedented exam-
ple of identical or almost identical mature peptide
sequences with significant differences in the propeptide
region of the precursor. The potential significance of
these data will be discussed below. However, these
results are strong evidence for the close relationship
between, and potentially similar biology of, Conus
chiangi , Conus imperalis and Conus regius.
DISCUSSION
The data presented above were obtained from two types
of experimental approaches. The phylogentic relation-
ship of Conus chiangi to other Conus species was first
evaluated using three standard marker genes. Conus
chiangi appears well embedded within the major clade
of cone snails (Bandyopadhyay et ah, 2008; Puillandre
M. Watkins et ah, 2010
Page 133
100/88
100/1
87/63
90/99
100/100
00
ammiralis
textile
furvus
100/100
C
93/1 OCf
episcopatus
aulicus
— radiatus
100/52
100/99
100/100
100/69
— parius
laterculatus
— aurisiacus
consors
archon
chiangi <-
100/100
imperialis
100/97
zonatus
- brunneus
regius
100/100
orbignyi
jaspideus
Lophiotoma
Thatcheria
0.2
Figure 4. A phylogenetic tree combining all three molecular markers obtained, COI, 12S and 16S) in a stratified Bayesian
analysis. An identical maximum likehood tree supports this topology. Labels are as in Figure 2. In this case, the assignment
of Conus chiangi to the Stephanoconus clade (type of the proposed subgenus Stephanoconus is Conus regius) is well
supported.
Sequences from genomic clones:
Chi 1 FDGRNAAADDKASDL1AQIVRRGCCSDPRCAWRC
ct-Iml LEERNAPADDKASDLIAQIVMGCCSDPRCAWRC
Rgl.9 . . . FNGRS A AADQNAPGLI AQWRGGCCSDPRCA WR(
Predicted mature ec-conotoxin sequence:
Figure 5. Similarity of mature a-conotoxin sequences
of Conus chiangi with those from Conus imperialis and
Conus regius. Shown are data obtained from genomic
clones from Conus chiangi , Conus imperialis and Conus
regius. The predicted proteolytic processing site following
which cleavage occurs to release the mature toxin is under-
lined. Note that the mature toxin sequences are virtually
identical in the three species despite considerable diver-
gence in the propeptide region. # - denotes an amidated
C-terminus
et ah, 2008) and is most closely related to Conus species
traditionally assigned to the Stephanoconus clade.
The second type of data described above were
toxinological markers; these are also consistent with
the assignment of Conus chiangi to the Stephanoconus
clade. The discovery of identical or almost identical
peptide sequences from the venom ducts of Conus
chiangi , Conus imperialis and Conus regius establishes
the close relationship between the three species
despite the strikingly divergent shell morphology of
Conus chiangi. In contrast to the other two shallow-
water species, it is only found in relatively deep water
(200-300 meters). This is the first documentation of
almost identical peptides from three different Conus
species — even peptides that seem to share the same
molecular targeting specificity can vary greatly in their
primary amino acid sequence if closely related Conus
species are compared. oc-Conotoxin Iml has been an
extensively characterized competitive antagonist of nic-
otinic acetylcholine receptors. In the mammalian ner-
vous system, this peptide competitively antagonizes a
Page 134
THE NAUTILUS, Vol. 124, No. 3
Figure 6. Shells of some species in the Stephanoconus clade. All species in the Stephanoconus clade that are included in the
analysis in Figure 4 are shown. Top, left to right: Conus chiangi, C. imperialis, C. zonatus; bottom, left to right: C. regius, C. archon,
C. brunneus. The specimen of Conus brunneus shown is a juvenile (when adult, it is approximately the same size as the specimen of
Conus regius). All of the other specimens, including C. chiangi a
the other species in this clade. Scale bar = 1 cm, applies to all ima;
variety of neuronal subtypes, including a 7 and a3(32
nicotinic receptors. Injection of the peptide into
the central nervous system of a mouse elicits partial
seizures.
? full-sized adults. Note how much smaller Conus chiangi is than
res.
Potentially more relevant to the biology of the cone
snails is the observation that this peptide also inhibits
one of the nicotinic acetylcholine receptors at the neuro-
muscular junction of the nematode Caenorhabditis
M. Watkins et ah, 2010
Page 135
elegans (J. Richmond and E. forgensen, unpublished
results). Thus, the peptide appears to be active over a
broad phylogenetic range, although it seems to be highly
selective for a specific subset of nicotinic acetylcholine
receptors in an individual nervous system. In inverte-
brates, it may well be targeted to nicotinic receptors that
are important for neuromuscular transmission, and thus
may be a major venom component that enables poly-
chaete-hunting cone snails to cause prey paralysis.
The unusual conservation of the mature toxin region
may be a consequence of the small size of this peptide.
There may be stringent selection on the sequence of the
peptide. There is some direct evidence to support this:
native peptides that are closely homologous in sequence,
such as a-conotoxin Imll and a-conotoxin RglA, have
different molecular targeting specificity (for a review,
see Olivera et ah, 2008). Thus, the mature a-conotoxin
Iml peptide, which is also found in Conus chiangi
venom, has presumably been optimized by strong selec-
tion, and given the small size, does not show the typical
hypervariability that can be demonstrated in larger
homologous peptides from different Conus. Neverthe-
less, that the genes involved are subject to hypervariation
is demonstrated by the lack of conservation in the
propeptide region between the three species compared
in Figure 5.
Thus, despite highly divergent morphological charac-
teristics of the shell of Conus chiangi, it is clearly related
to other Conus and there would appear to be no justifica-
tion for separating it into a separate genus. The assign-
ment of Conus chiangi to the genus Conus (and subgenus
Stephanoconus) would be consistent with the results
presented above. [It should be noted that some work-
ers (see for example da Motta, 1991) do not assign
C. imperialis to Stephanoconus, but to Litlioconus Morch,
1852. Since the type of Lithoconus is C. leopardus,
which is not closely related to C. imperialis by molecular
phylogeny, the assignment to Stephanoconus seems more
appropriate],
A curious feature of the Stephanoconus clade (see
Figure 6 for some examples) is that there were relatively
few species assigned to this clade in the Indo-Pacific,
with greater biodiversity in the Caribbean/Eastern
Pacific. Although not all candidates for assignment to
the Stephanoconus clade have been directly analyzed
using molecular markers, it seems likely that Conus
brunneus Wood, 1828, Conus bartschi Hanna and
Strong, 1949, and Conus archon Broderip, 1833, in the
Eastern Pacific, and Conus regius Gmelin, 1791, Conus
aurantius Hwass, 1792, and the complex of forms related
to Conus cedonulli Linne, 1767 in the Caribbean, are
members of the Stephanoconus clade. Although the
Indo-Pacific has much greater biodiversity of Conus spe-
cies in general, only two species have routinely been
assigned to this clade, the widely distributed Conus
imperialis Linne, 1758, and Conus zonatus Hwass,
1 792, found in the Indian Ocean from South India to
Western Thailand. The results of our study, which has
revealed that Conus chiangi is well embedded in the
Stephanoconus clade, raises the possibility that there is
a deep-water Indo-Pacific radiation of Stephanoconus. It
would seem useful to investigate whether other Conus
species with unusual spire structures belong to this
group, including two other small deep-water species,
Conus suidurati and Conus polongimarumai Kosuge,
1980 (see Figure 7). From similarities in shell moiphol-
ogy, the latter seems particularly likely to be a deep-
water Stephanoconus like Conus chiangi.
The discovery that Conus chiangi belongs to the
Stephanoconus clade has biological implications: all
Figure 7. Conus chiangi compared to other putative members of a deep-water Stephanoconus clade. The two left-most specimens
are Conus chiangi- the two middle specimens are Conus polongimarumai and the right-most specimen is Conus suidirati. The two
species Conus polongimarumai and Conus suidirati are rare, and no molecular data has been obtained. Based on morphological
criteria, these are candidates for inclusion in a deep-water Indo-Pacific clade of Stephanoconus, defined by Conus chiangi. Scale
bar = 1 cm, applies to all images.
Page 136
THE NAUTILUS, Vol. 124, No. 3
known members of the Stephanoconus elude whose prey
preference has been defined eat amphinomid poly-
chaetes (“fireworms”) (Kolm, 1959; Roekel et ah, 1995).
The molecular phylogeny of Conus chiangi, and the con-
servation of venom peptides documented above, suggest
that the prey preference of the species is related: likely
small, deep-water amphinomids. Whether or not this
prediction is true can be verified by a type of reverse
ecological approach that was recently used for identify-
ing the prey of some turrid species (M. Astilla and
G. Concepcion, unpublished) in which a PCR analysis
of the gut contents of several Turrid species (to identify
the barcode sequence of recently ingested prey) was
used. However, the tree in Figure 4 suggests that the
deep water Indo-Pacific Stephanoconus diverged from
the two shallow water species relatively early in the adap-
tive radiation of the clade, comparable in time to when
the new world and old world branches diverged.
The Stephanoconus clade, as redefined here, has sev-
eral intriguing features. It is one of the few world-
wide eludes within the genus Conus. In contrast to
Stephanoconus, the Conus species that prey on fish dis-
play an entirely different biogeographic pattern. The
available molecular data indicate that the new world
piscivorous species evolved fish-hunting completely inde-
pendently, and are not genetically more closely related to
fish-hunting than to non fish-hunting Conus eludes
(Duda Jr. and Palumbi, 2004; Espiritu et al., 2001; Impe-
rial et al., 2007) (Krause et. al., manuscript in prepara-
tion). The fact that Stephanoconus is both worldwide in
its distribution, and significantly more species- rich in the
new world, is different from most other characterized
branches of Conus, suggesting an unusual evolutionary
history of this group compared to other cone snail eludes.
ACKNOWLEDGMENTS
This work was supported by a program project grant
(GM48677) from the National Institute of General
Medical Sciences. We are grateful to Keriy Matz and
Tuong Huynh for preparing some of the figures.
LITERATURE CITED
Azuma, M., 1972. Descriptions of Four New Gastropods from
South China Sea. Venus 31: 56-61.
Bandyopadhyay, P.K., B.J. Stevenson, J.R Ownby, M.T. Cady,
M. Watkins, and B.M. Olivera. 2008. The mitochondrial
genome of Conus textile, coxl-eoxll intergenic sequences
and Conoidean evolution. Molecular and Phylogenetics
Evolution 46, 215—23.
Coomans, H.E., R.G. Moolenbeek, and E. Wils. 1983. Alpha-
betical revision of the (sub) species ub recent Conidae 7.
cingulatus to cylindraceus, including Conus shikamai
nomen novum. Basteria 48: 223-311.
da Motta, A. | 1991. A systematic classification of the gastropod
family Conidae at the generic level. La Conchiglia, Rome.
Duda Jr, T. E. and S.R. Palumbi. 2004. Gene expression and
feeding ecology: evolution of piscivory in the venomous
gastropod genus Conus. Proceedings of the Royal Society
London 271: 1165-1174.
Duda Jr, T.F., A.J. Kohn, and S.R. Palumbi. 2001. Origins of
diverse feeding ecologies within Conus, a genus of venom-
ous marine gastropods. Biological Journal of the Linnean
Society 73: 391^409.
Ellison, M., Z.P. Feng, A.J. Park, X. Zhang, B.M. Olivera,
J.M. McIntosh, and R.S. Norton. 2008. Alpha-RglA,
a novel conotoxin that blocks the alpha9alphal0
nAChR: structure and identification of key receptor-
binding residues. Journal of Molecular Biology 377:
1216-1227.
Espiritu, D.J.D., M. Watkins, V. Dia-Monje, G.E. Cartier,
L.J. Cruz, and B.M. Olivera. 2001. Venomous cone snails:
molecular phylogeny and the generation of toxin diversity.
Toxieon 39: 1899-1916.
Guindon, S. and O. Gascuel. 2003. A simple, fast, and accurate
algorithm to estimate large phylogenies by maximum like-
lihood. Systematic Biology 52: 696-704.
Huelsenbeck, J.P., F. Ronquist, R. Nielsen, J.P and Bollback.
2001. Bayesian inference of phylogeny and its impact on
evolutionary biology. Science 294: 2310-2314.
Imperial, J., N. Silverton, B.M. Olivera, P. Bandyopadhyay,
A. Sporning, M. Ferber, and H. Terlau. 2007. Using chem-
istry to reconstruct evolution : On the origins of fish-
hunting in venomous cone snails. Proceedings of the
American Philosophical Society 151: 185-200.
Kohn, A.J. 1959. The Ecology of Conus in Hawaii. Ecology
Monograph 29: 47-90.
Larkin, M.A., G. Blackshields, N.P. Brown, R. Chenna,
PA. McGettigan, H. McWilliam, F. Valentin, I.M. Wal-
lace, A. Wilm, R. Lopez, J.D. Thompson, T. J. Gibson, and
D.G. Higgins. 2007. Clustal W and Clustal X version 2.0.
Bioinformatics 23: 2947-2948.
Maddison, D.R., and W.P. Maddison. 2005. MacClade 4.08.
McIntosh, J.M., D. Yoshikami, E. Mahe, D.B. Nielsen,
J.E. Rivier, W.R. Gray, and B.M. Olivera. 1994. A nico-
tinic acetylcholine receptor ligand of unique specificity,
a-conotoxin Iml. Journal of Biological Chemistry 269:
16733-16739.
Olivera, B.M., M. Quik, M. Vincler, and J.M. McIntosh. 2008.
Sul) type-selective conopeptides targeted to nicotinic
receptors: Concerted discoveiy and biomedical applica-
tions. Channels 2: 143—152.
Puillandre, N., S. Samadi, M.C. Boisselier, A.V. Sysoev, Yu. I.
Kantor, C. Cruaud, A. Couloux, and P. Bouchet. 2008.
Starting to unravel the toxoglossan knot: molecular phy-
logeny of the “turrids” (Neogastropoda, Conoidea).
Molecular Phylogenetics and Evolution 47: 1122—1134.
Roekel, D., W. Korn, and A.J. Kohn. 1995. Manual of the
Living Conidae. Verlag Christa Hemmen, Wiesbaden,
358 pp.
Ronquist, F. and J.P. Huelsenbeck. 2003. MrBayes 3: Bayesian
phylogenetic inference under mixed models. Bioinformat-
ics 19: 1572-1574.
Santos, A.D., J.M. McIntosh, D.R. Ilillyard, L.J. Cruz, and
B. M. Olivera. 2004. The A-superfamily of conotoxins:
structural and functional divergence. Journal of Biological
Chemistry 279: 17596-17606.
Suzuki, M., 1972. Descriptions of two new species of gastro-
pods. Pacific Shell News 5: 4 pp. [unnumbered]
THE NAUTILUS 124(3): 137-150, 2010
Page 137
Testability of the Energy Maximization Model (Kitchell et al, 1981)
of naticid predation on two bivalve prey from the eastern
coast of India
Subhronil Mondal1
Subhendu Bardhan
Deepjay Sarkar
Department of Geological Sciences
Jadavpur University
Kolkata-700032, INDIA
[email protected]
ABSTRACT
In 1981, Kitchell et al. envisaged a net energy maximization
model that can rank different prey according to their prefer-
ences. Several workers tested the model both in experimental
studies and in fossil records. In the present endeavor we have
tried to analyze the nature, from a cost-benefit perspective, of
naticid predation on two Recent prey bivalve species Mactra
luzonica Reeve, 1854, and Donax scortum Linnaeus, 1758,
collected from eastern coast of India. The results have broadly
supported the theoretical cost-benefit curve of Kitchell et al.
(1981). While Mactra luzonica was thoroughly preyed upon
regardless of body size, predation on Donax scortum signifi-
cantly decreased after prey body size exceeds 3 cm. This is
explained on the basis of a change in mode of living of the prey
during late ontogeny. Other factors like prey availability, prey
ornamentation, consumption rate, and presence of secondary
predators that may constrain the model, have been discussed.
Additional Keywords: Naticid predator, Indian coast
INTRODUCTION
Dynamics of predator-prey interaction have been a
major subject of interest in current research (Reyment,
1966; Carriker, 1969; Kitchell et al., 1981; Vermeij, 1983;
Anderson et al., 1991; Anderson, 1992; Tull and
Bohning-Gaese, 1993; Kelley and Hansen, 1996; 2003;
Dietl and Herbert, 2005, and references therein). Preda-
tion is the main driving force for change in community
structure and coevolution of species (Vermeij, 1983;
Boucher, 1988; Endler, 1991) within an environment.
Bivalves are mostly preyed upon by carnivore gastro-
pods. Many of them make a characteristic borehole on
the shell ol prey either by mechanical rasping (Fischer,
1922; Pelseneer, 1925) or by chemical secretion (Ankel,
1 Author for correspondence
1937) or by both (Carriker, 1951, 1959; Ziegelmeier,
1961). Naticid gastropods make a characteristic cone-
shaped or parabolic borehole (Carriker and Yochelson,
1968; Carriker, 1981). When its diameter is taken into
account, the borehole is a potential source of information
on, among other factors, predator size (Palmer, 1990;
Kitchell et al., 1981). Stereotypy of the borehole location
on prey shell over geological time in varying environments
indicates a stable behavior of naticids (Sold, 1969; Berg,
1976, 1978; Boggs et al., 1984; Kitchell, 1986, but see Arua
and Hoque, 1989).
Unsuccessful attempts are preserved as incomplete
and nonfunctional boreholes on the prey shell (see
Anderson et al., 1991). Lack of perfection or failure in
recognition can result in deviation from stereotypy and
multiple boreholes (Kelley and Hansen, 2003). Devia-
tions from stereotypy can also result from a number of
other biotic factors like predator gregariousness (see
Kitchell et al., 1981; Taylor et al., 1983; Anderson et al.,
1991; Chattopadhyay and Baumiller, 2007 and S. Paul,
pers. comm.) or non-biotic factors, like taphonomy
(Chattopadhyay et ah, 2006) and catastrophic physical
changes leading to mass extinction (Kelley and Hansen,
1996). Mass extinction may influence drilling frequen-
cies and predator stereotypy. For example, drilling fre-
quencies in recovery faunas after mass extinction are
greatly increased, possibly due to preferential extinction
of highly escalated prey. Mass extinction also reorganizes
predator-prey system and affect predator behavioral ste-
reotypy (Kelley and Hansen, 1996).
Geographical and environmental variability also play a
major role on prey-predator interaction (Kelley and
Hansen, 1993). But studies are limited on the role of
environmental factors on it (Allmon et al., 1990; Ander-
son et ah, 1991; Kelley and Hansen, 1993). Significant
works have been done on drilling predation through
experimental studies (Paine, 1963; Moran, 1985; Yama-
moto, 2004; Dietl and Herbert, 2005; Casey and
Page 138
THE NAUTILUS, Vol. 124, No. 3
Chattopadhyay, 2008). But behavior of predation under
captivity may vary significantly; especially when its own
predator is present (see Chattopadhyay and Baumiller,
2007). Presence of secondary predators also influences
the feeding strategy ol predatory gastropods (Kelley and
Hansen, 2003). In the present study area diverse and
abundant secondary predators of naticids are present.
Their role in influencing in naticid-bivalve interaction
has also been explored.
Kitchell et al. (1981) postulated a model based on net
energy maximization gain for naticid predator that ex-
plains the preferences for prey and tested its feasibility
on fossil record. Many later workers showed limitations
of the model. For instance, strong surface sculptures of
the prey may decrease the probability of success (Kelley,
1982). But Anderson et al. (1991) and Arua and Hoque
(1989) believed that surface ornamentation may not
influence the predation success. Our personal observa-
tions of naticid predation on radially costate species
Timoclea imbricata (Sowerby, 1853) (Rao et al., 1991)
also support this. There is no relation between degree of
intensity of predation and surface sculpture for this spe-
cies (pers. observ.). Abe (1989) found that muricid Thais
drills prey smaller than the most profitable size, perhaps
due to tidal cycles limiting which prey can be consumed
during a single foraging period rather than which prey
the predator is capable of manipulating. The cost-benefit
could also change if the consumption time is included
(Chattopadhyay and Baumiller, 2009). Kitchell et al.s
(1981) model implies that boring and consumption rates
were constant. But Chattopadhyay and Baumiller (2009)
showed that consumption rate vary directly with preda-
tor size. Dietl and Herbert (2005) argued that the time
cost of drilling is not a simple function of prey shell
thickness. They showed that edge drilling is much faster
than wall drilling and its even faster than that would be
predicted if drilling time was simply a function of shell
thickness. Predators probably take breaks when drilling
thicker prey shells, so the relationship should not be
linear (G. Herbert, pers. comm., 2010). But in the pre-
sent case study we have shown that drilling takes place
only on the wall and shell thickness of most frequently
attacked prey size range of the two taxa are similar. We,
therefore, have considered that there exists a relation
between handling time and shell thickness, at least in
the present study.
It appears from the above discussion that Kitchell
et al. (1981) model is debatable and is constrained by
many factors. This prompts us to undertake another run
for testing the model in a different biogeographic area,
where naticid predation on bivalve prey (one orna-
mented and another is non-descript) has not been
studied. Given that the area is infested with naticid can-
nibalism and calappid crabs, it provided us opportunities
to test the model in the face of steep competition and
secondary predation.
The advantage of choosing intertidal samples is that
they simultaneously satisfy geographical and ecological,
as well as temporal (for example time averaging; Kidwell
and Flessa, 1995; Roy et al., 1994; Kidwell, 2001; Yama-
moto, 2004) factors of predator-prey system. The study
area acts as a natural aquarium and therefore is free from
any abnormal behavior of prey-predator interaction
which may be shown under captivity. However, taphon-
omy may influence the relative abundance of drilled
shells in the allochthonous assemblage. This issue has
been discussed later.
Here, we have tried to see: (1) whether stability of
stereotypy of borehole location is disrupted under a very
stressed and complex food web, (2) predator-prey size
relationship, (3) relationship between ontogenetic
changes and predation intensity, (4) reliability of prey
ranking with the help of predation frequency. In the
present study area naticid predators are dominated by
two genera, Polinices Montfort, 1810, and Natica
Scopoli, 1777. Two major bivalve prey items are Mactra
luzonica Reeve, 1854, and Dona: x scortum Linnaeus.
1758. Both prey are infaunal in shallow depth. Mactra
luzonica is smaller (9.81 mm to 29.37 mm), while
D. scortum is relatively larger (16.33 mm to 84.98 mm).
Mactra luzonica is smooth-shelled, where adult
D. scortum has co-marginal ridges with posterior spines
and anterior blades. Shell thickness is larger for
D. scortum and thickness varies with ontogeny. Since
both prey live sympatrically, we assume that they are
encountered simultaneously by naticid predators (see
also Kitchell et al., 1981; Leighton, 2002).
It has been found that Mactra luzonica is more exten-
sively predated than D. scortum for all size ranges. When
smaller Donax scortum (length not exceeding the maxi-
mum length of M. luzonica) is studied, the predation
frequency is found to be more than the subset of larger
size for Donax. The cause has been attributed to some
morphological modifications adapted by the prey during
later ontogeny. It appears that the cost-benefit model is
constrained by many factors including nature of ontoge-
netic development of the prey.
MATERIALS AND METHODS
We collected samples from intertidal areas at Chandipur,
eastern coast of India (Figure 1), during January to
March in 2008 and 2009. The studied area is around
5 km long, with shoreline trending NNE— SSW. The
coast near the confluence of the river Burhabalang with
Bay of Bengal is characterized by a wide (almost 4 km)
intertidal flat with a very narrow beach (around 40 m)
and bar-interbar system. The coast has mesotidal setting
with semidiurnal tides (Mukherjee et ah, 1987). The
beach-barrier bar-estuary-tidal flat system, dominated
by tide, has a prolific bio-diversity. Among mollusks
around 42 genera and 56 species of gastropods and
bivalves have been described (Rao et al., 1991; personal
observation). We have systematically collected spec-
imens (sample size was about 2407 for M. luzonica
(1580) and D. scortum (827)). The samples are well-
preserved and consisted of both articulated and dis-
articulated valves collected from numerous 5x5 m grids
S. Mondal et al., 2010
Page 139
2 1 o27’48. 1 9”N:87o03'33.5S'’E
[ELEVATION-21 Fi. I
Figure 1. Chandipur beach-barrier bar-tidal llat system along the eastern coast of India.
and also randomly (for larger D. scortum in an unbiased
way, see also Hari et al., 2009). We have only collected
dead specimens. Most likely the specimens are time-
averaged. Time-averaged dead assemblages are almost
equivalent to fossil counterparts (Yamamoto, 2004) and
could be more faithful representatives of the regional
populations than living individuals (Roy et al., 1994;
Kidwell and Flessa, 1995; Kidwell, 2001).
The following seven characters have been chosen for
analysis and the quantifiable data thus obtained used
to run cost-benefit analysis: (1) valve length of prey
bivalve, (2) valve height, (3) nature of valve (left or right),
(4) borehole position, (5) number of drilled samples,
(6) thickness of valve at the location most frequently
drilled, and (7) borehole diameter (inner and outer)
made by the predators.
Other bivalve shell morphological characters includ-
ing anterior and posterior length, depth of pallial sinus at
different ontogenies, surface sculpture and ontogenetic
changes of mode of living of D. scortum have also been
studied to correlate them with predation frequency.
Taphonomic Bias: Taphonomy may selectively re-
move a particular size class from an assemblage. It
shows preferences of valves in transportation especially
when valves are asymmetrical (Martin-Kaye, 1951). In
Chandipur, right valves of Ostrea spp. are rarely found.
Bored valves may be differentially transported. This
could either be a result of different hydrodynamic prop-
erty of shells with and without boreholes (Chattopadhyay
et al., 2006) or because of the fact that drilled shells
are more likely to be broken during transportation
(thereby lowering drilling frequency of the population)
(Roy etak, 1994).
Size Selectivity: To evaluate size selectivity we have
calculated Spearman rank correlation coefficient (Spear-
man, 1904) between prey and predator size. This has
been done using the software PAST. Valve length (ante-
rior-posterior) is used as a measure of prey size and
outer borehole diameter, i.e., OBD is used as a measure
of predator size (see for example, Anderson et ah, 1991).
Outer diameter of a series of boreholes drilled by the
same predator remains relatively fixed, regardless of prey
size throughout drilling phase (Kitchell et ah, 1981,
1986). Tire data have been synthesized for the samples
only having functional boreholes. For all of our statistical
tests a = 0.001 .
The correlation coefficient has been calculated for
(1) Mactra luzonica, (2) Donax scortum and (3) sub-set
Page 140
THE NAUTILUS, Vol. 124, No. 3
of D. scortum having length not exceeding that of
M. luzonica (see below).
Site Selectivity: Kelley and Hansen (1993) stated that
if the escalation theory is true then naticid predation
“may have been less stereotyped” earlier (see Arua and
Hoque, 1989). Stereotypy is a predator’s improved abil-
ity, which may be achieved by trial and error (Vermeij,
1983). Normally site selectivity shows a tendency of
predator to choose a thin-shelled prey (Carriker, 1959;
Paine, 1962) or the thinnest area of the prey shells
(Kitchell, 1986). To record position of borehole, we have
divided the prey valve surface into 9 sectors, for both
species, following Anderson et al. (1991) (Figure 2).
Site selectivity' has been tested by chi-square test using
PAST. We have considered that boreholes have a random
distribution throughout the valve surface (null hypothesis).
The test has been performed for: (1) Mactra luzonica ,
(2) all size ranges of Donax scortum , (3) D. scortum
having length not greater than M. luzonica to compare
the two prey when size is constant (considering predator-
prey relationship holds good) and (4) all samples of
both prey.
Drilling Frequency: Total number of functional
boreholes is the measure of predation success. Func-
tional boreholes are those in which IBD: OBD is >0.5
(Kitchell et al., 1986, Kelley, 1988; Anderson et al. 1991).
We have used the equation (D/N)/2 to calculate drill-
ing or predation frequency following Bambach and
Kowalewski (2000) and Kowalewski (2002), where D is
number of valves with complete boreholes and N is the
number of valves collected.
We have measured the following: (1) valve preference
for drilling, (2) size preference for both prey, (3) fre-
quency of drilling for M. luzonica , (4) frequency of
drilling for D. scortum having equivalent length of
M. luzonica. Drilling frequency has been calculated to
see whether it supported the prey ranking according to
Kitchell et al. (1981) model.
Cost-Benefit Analysis: Many workers have suggested
that predator-prey interaction is based on optimal forag-
ing by the predator (Schoener, 1971, Werner and Hall,
1974; Charnov, 1976; Py'ke et al., 1977; Cowie, 1977;
Krebs, 1977, 1978). The most satisfactory and well-stud-
ied model for naticid predation was proposed by Kitchell
et al. (1981). They suggested that predators select their
prey to maximize net-energy return. Their model has
been tested in fossil record (Anderson et ah, 1991;
Anderson, 1992). This “energy maximization model”
helped us in understanding naticid behavioral pattern,
as naticids rank their prey on maximum net energy
return on total foraging time. These features have been
incorporated in the model based on the equation:
Et/Tt = Ej . Si/ (H; + Rj)
where Et is total energy gained by the predator, Tt is total
cost units of time to the predator, E, is the energetic
value, Hj is the handling (drilling) time cost, Sj is proba-
bility of success and R, is the recognition time of prey “i”.
We have considered prey availability has no effect on
prey ranking (see also Kitchell et al., 1981; Kelley and
Hansen, 2006).
Ej is the approximation of energy benefit to predator
resulting from prey consumption. It is estimated by the
internal volume of the prey shell, i.e., equivalent to prey
biomass (Kitchell et al., 1981; Powell and Stanton, 1985).
Since both M. luzonica and D. scortum are equivalved,
we have used single valve measurements to calculate
internal volume. We have calculated internal volume of
one valve by filling up with fine silver sand (conversion
factor 1 .626 gm/ml) and then doubled it to get the total
internal volume i.e. the total biomass following Anderson
et al. (1991). But 100% consumption of the prey might
not occur (Edwards and Huebner, 1977; Hughes and
Dunkin, 1984; Guerrero and Reyment, 1988). In our
limited aquarium studies, soft parts of Mactra sp. includ-
ing siphon, mantle etc were completely devoured by
N. tigrina; but we did not have experimental data on
Donax scortum. However, in the field we observed larger
articulated drilled Donax scortum valves to possess
adductor muscles and relics of mantle.
Kitchell et al (1981) considered H; as measure of dril-
ling time. The time cost of drilling may not always be
simple function of prey shell thickness. Died and Her-
bert (2005) showed that edge drilling is faster than wall
Figure 2. Nine sectors on the prey valve, drawn for analyzing site selectivity. Left Mactra luzonica ; right Donax scortum.
S. Mondal et ah, 2010
Page 141
drilling. Anderson et al. (1991) also suggested that use of
thickness as a proxy for handling time may not be reli-
able, given that drilling rate varies across taxa. In the
present case, naticids drill only on the wall and there
is a strong stereotypy of drilling for both prey. The size
range of the population that represents maximum
predation intensity in both prey items has comparable
thickness (0.18 mm for M. luzonica and 0.22 mm for
D. scortam). For this we have followed Kitchell et al.
(1981) and considered Hj as the proxy for drilling time
in this specific case study. To measure the thickness for
each prey we have taken an unbiased sample of 100
valves in which the ratio left valve: right valve is 1: 1 and
all size classes are represented. The number of bored
samples represents the same drilling frequency of the
whole population. Given that samples are easily renew-
able, we have broken the samples and measured the
thickness at the location most frequently drilled (near
umbo) using a digital calipers with measurements
nearest to 0.01. We have also measured the anterior-
posterior length of the valves (measure of prey size) to
have an idea of change of thickness with ontogeny.
Kitchell et al. (1981) considered recognition time (R,)
of naticid predator is negligible. Anderson et al., (1991)
also followed them and considered R, as insignificant.
Naticid gastropods are not visual predators. They per-
haps use tactile and chemical cues (see Kitchell et al.,
1981). They may not be able to differentiate between
prey of same size, but of different valve thicknesses. In
that case, there wall be a high incidence of incomplete
boreholes in thick-shelled phenotypes of the prey spe-
cies. There are reports of aquarium studies where
naticids grab their prey, drag it with its foot for a day,
and then abandon it (G. Herbert, pers. comm.). Thus,
recognition time may be substantial for drillers (see
Hughes and Elner, 1979). Our direct observation on the
intertidal area at low tide reveals that after initial contact,
individuals of Natica tigiina quickly extends their feet to
grab its prey, Mactra sp. Savazzi and Reyment (1989)
reported instantaneous recognition of prey by Natica
gualteriana , a predator also found in the present study
area. Moreover, unsuccessful or incomplete boring in
the studied species is extremely rare and there is
no relationship between degree of shell thickness and
incomplete borehole. Therefore, we have also consid-
ered the recognition time as negligible in the present
case study. T, is approximately related to If as the cost-
benefit analysis is done within predator manipulation
limit i.e. Si>0.
We have measured all these parameters used in cost-
benefit analysis for: (1) Mactra luzonica , (2) Donax
scortum, and (3) D. scortum with length not greater than
M. luzonica.
We have plotted log (thickness/ internal volume)
against prey length for both prey types. According to
Kitchell et al. (1981) the plotting of species-specific
cost-benefit analysis provides a graphical representation
of relative energetic profitability of prey species and its
size classes to the predator. They noted that “Maximum
Et/Tt values represent the most vulnerable or highly
ranked prey”. We, therefore, have compared the result
of cost-benefit analysis with the drilling frequency, which
also suggests prey preference. I lighest frequency of pre-
dation over a prey will have maximum Et/Tt value over
other prey.
RESULTS AND DISCUSSION
Taphonomic Control: Our samples had almost same
number of left and right valves for Mactra luzonica
(Table 1). But there was a higher incidence of occur-
rence of right valve in case ol Donax scortum (p>0.01.
Table 1). This was, perhaps, due to the fact that
D. scortum could not be collected always through grid
samples since they are relatively fewer and not evenly
distributed throughout the studied area. We, therefore,
have assumed (see detailed discussion in the previous
section) that taphonomy has no significant role in our
study (see also Boucot et al., 1958). Many articulated D.
scortum representing different sizes (Figure 3) were also
found. This clearly indicated little or no posthumous
transport.
It is interesting to see that a particular size range was
dominant for both prey taxa (66.5% within size range of
2.0— 2.4 cm for M. luzonica and 56.2% for size range of
3.0— 4.0 cm for D. scortum). But all size ranges on either
side was evenly skewed (Figure 3). This spoke for normal
distribution.
Site Selectivity: We have considered our observation
based on the null hypothesis that prey-predator correla-
tion exists when p<0.0001. In eveiy case the correlation
was significant for all size (Table 2). The area most
preferred for boreholes, for both prey, was location 2.
Although larger Donax scortum is thoroughly orna-
mented, location 2 is the thinnest part and carries
weakest ornamentation. It is the site just below the
umbo, both anterior and posterior (Table 3). Almost
95% for Mactra luzonica and almost 98% for D. scortum
valves were drilled at location 2. This suggested that
stereotypy is in favor of predator fitness.
Thickness Variation: When thickness of the prey at
the location most frequently drilled (herein location 2,
i.e., below umbo; see Figure 2) had been plotted with
respect to log of body length we verified that, for Mactra
luzonica, thickness increased with ontogeny. In later
ontogeny, however, intraspecific variation of thickness
Page 142
THE NAUTILUS, Vol. 124, No. 3
Valve length (mm)
D. scortum
Valve length (mm)
M. luzonica
Figure 3. Available size class for two prey species at the study area. Numbers of size classes plotted against body length. Prey size
show strong unimodal distribution.
Table 2. Result of borehole site selectivity test using chi-square test with eight degree of freedom.
S. Mondal et al., 2010
Page 143
Table 3. Site dependence of predators when a prey is
targeted. Here location 2 is most frequently targeted for all
type, all size range.
became slightly higher (Figure 4). A relatively poor cor-
relation between shell length and shell thickness poses
another problem in applying Kitehell et al. (1981) model,
lithe correlation is poor, then there is no way a predator
can know what it is getting into when it selects a particu-
lar sized prey. A small shell could be as thick as a large
shell. It is expected that selectivity for such prey should
be lower when the size-thickness relationship is tight.
This is also true when predator size shows poor correla-
tion with respect to prey shell length. We have shown
(see below) that as the variation of thickness during late
ontogeny is not great in M. luzonica , the selectivity of
prey has not been perturbed. But for D. scortum unrbo-
nal thickness remain more or less same up to 3 cm, after
that thickness increase rapidly relative to length. This
might have caused decrease in predation frequency lor
D. scortum.
Size Selectivity: A positive correlation indicated prey
size selectivity of predators. D. scortum had veiy good
correlation between OBD and prey length (r = 0.497,
p < 0.001) and for M. luzonica it is relatively poor (r =
0.315, p < 0.001) (Table 4, see also Figure 5) since thick-
ness shows great intraspecific variation in later ontogeny,
as discussed above. Phenotypes with greater thickness
may enhance resistance against wall drilling. Therefore,
correlation between predator and prey size will likewise
be poor, as shown in the Figure 5 (M. luzonica ), as well as
lower r value (p < 0.001). Since die adult size class (length:
17 mm to 25 mm) showed thickness variation less than
0.1 mm (which also represents the most abundant size
class, see Figure 3), the predators mostly targeted the
specimens of this size class and remain indifferent with
respect to prey selection.
Drilling Frequency: Considering total mortality ol
studied bivalves by naticid drilling, we analyzed our sam-
ples for predation frequency. It was evident that, for
Mactra luzonica, mortality rate was quite high (drilling
frequency 24.2%, Table 5). But for Donax scortum mor-
tality rate was relatively low (drilling frequency 8.79%).
Against both prey, predation success was very high (i.e.,
predator effectiveness is almost 100%), which indicated
predator perfection and adaptation in a stressed environ-
ment with a chance of semi-diurnal drying up. Moreover,
predation pressure on predator was also veiy high, given
that naticids are also victims of cannibalism and calappid
crab predation at Chandipur (pers. observ.). Despite
the presence of higher order predators, naticid gastro-
pods show stereotypy in borehole location. Predation
frequency here is expected to be less and there should
be higher incidence of incomplete and multiple borehole
(Chattopadhyay and Baumiller, 2007) and shift in posi-
tion of boreholes from stereotypy (Thomas, 1976).
Kitehell et al. (1981) did not mention the role of higher
order predators.
But the presence of stereotypy at Chandipur may rep-
resent a local, spatial behavioral pattern of naticids. We
have encountered many naticid species performing
activities such as subaerial foraging and grabbing bivalve
prey on a tidal flat. During low tide, these predators are
free from any danger due to secondary predators such
as portunid crabs. These crabs of Bay of Bengal live
in deeper water and die immediately after capture
(FAO, 2010a [http://www.fao.org/fisheiy/species/2629/
en]; FAO, 2010b [http://www.fao.org/fishery/species/
2630/en]). They only reach the intertidal area at
Chandipur during high tide. Savazzi and Reyment
(1989) also noticed similar subaerial naticid hunting in
the absence of secondary predators in the Philippines.
This may be the reason of maintaining stereotypy in
Chandipur prey. This may also be considered in
interpreting stereotypy in fossil records.
In the present study, predators of naticid gastropods
are diverse and abundant. However, we found veiy high
frequency of predation and scarcity of incomplete bor-
ings. The reason is evident from direct observation in the
vast intertidal areas at low tide, as well as from the exper-
imental study. Naticids conceal their prey within the
sediment immediately after a successful encounter. This
behavior perhaps enhances the rate of predation success.
We believe that attainment of perfection in drilling by
achieving stereotypy involves faster drilling. Although
Kitehell et al. (1981) did not consider influence of
higher-ranked predators on their cost-benefit model, we
here have shown that the model stands even under this
complex condition.
From the results (Table 5) it can be easily understood
that Mactra luzonica was preferred over Donax scortum.
The subset of D. scortum (size not exceeding that of
M. luzonica) was studied separately. It was clear that the
degree of predation was higher for this smaller size class.
Number of nonfunctional and multiple boreholes (pred-
ator inefficiency) also decreased.
Neither of the prey valves was preferred for predation
(Table 6). This was attributed to valve symmetry, similar-
ity of size, shape, thickness, ornamentation, and orienta-
tion in life.
From the strongly unimodal size distribution (Fig-
ure 3) for Mactra luzonica , it appears that naticids would
have veiy little to choose from total size class. When
predation frequency against the available size class has
been compared it is found that maximum drilling (almost
70%) is restricted within 18—24 mm size class. This class
interval is also the most available class (almost 85% of all
sizes). It appears that every potential food item is effec-
tive for cost-benefit within this size range.
Page 144
TPIE NAUTILUS, Vol. 124, No. 3
Figure 4. Change of shell thickness with ontogeny for both prey species. Length is antero-posterior shell length. For Mactra
luzonica, the correlation between length and thickness is relatively poor.
Table 4. Values of Spearman correlation coefficient. Here, r is the correlation coefficient.
S. Mondal et al., 2010
Page 145
M. luzonica
Length (mm)
D. scortum
Figure 5. Predator-prey correlation where outer borehole diameter proxies for predator size and length as a proxy for prey size.
OBD is outer borehole diameter.
The size range of bored valves in the two species had a
size overlap between 22—28 mm (Table 6). But, the most
striking aspect was that the majority of the functional
boreholes in the prey were restricted in the size range
that coincides with the maximum size range of Mactra
luzonica. The number of drilled Donax scortum exceed-
ing 3 cm length was rare.
Cost-benefit Analysis: Cost-benefit analysis has been
done for both prey and it was interesting to see that there
Page 146
THE NAUTILUS, Vol. 124, No. 3
Table 5. Predation frequency and valve preference for prey species, for all prey size and length not exceeding 3 cm.
Valve preference Unsuccessful / Nonfunctional attempt
exceeding 3 cm)
Table 6. Valve preference of prey species for all size class.
functional boreholes
> 0.5
Total samples R L
> 0.35
Boreholes
Total number of —
bored samples Non functional multiple sample (functional) (mm)
Size range of predated
existed a difference in energy values between these two
species (Figure 6). Selection depends on the prey type
for which energy value (Et) is minimum, so that benefit
was maximum.
According to energy maximization model of Kitchell
et al. (1981), Et/Tt will he maximum for the most favored
prey. Therefore any increase in thickness at the site of
stereotypy (i.e. handling time, H;) will decrease this
value (Figure 6). The trends were almost the same when
we studied two prey within a size range, with maximum
length 3 cm. Generally, Donax scortum is more costly
(high thickness/internal volume) than Mactra luzonica
(Figure 6). As a result, D. scortum was less frequently
preyed upon. This observation corresponded well with
the predation frequency data (M. luzonica =20. 95% and
D. scortum= 6.23%).
Another factor that may be responsible for less preda-
tion on D. scortum is the umbonal thickness (the area
most frequently drilled), which is thicker for D. scortum
within the same size range. Average thickness was
0.35 mm for D. scortum and 0.16 mm for M. luzonica.
Handling time was doubled for D. scortum , which would
in turn increase T,, with the result that D. scortum was
not favored.
-10
u
E
3
§
m
c
<U
c
~c
no
o
Figure 6. Comparative cost-benefit curve between two prey species within size range of 3 cm (for M. luzonica, y = — 0.020.X-0.966,
r2 = 0.472, and for Donax scortum, y = — 0.017x-0.922, r2 = 0.302).
S. Mondal et al., 2010
Page 147
POSTERIOR DORSO-VENTRAL VIEW
Figure 7. Donax scortum shell showing anterior blades and posterior spines. The posterior part is swollen.
The surface ornamentation might be another attribute
which made D. scortum as less favored prey. During late
ontogeny, Donax sp. develop strong blades on the ante-
rior region and spines on the posterior region (Figure 7),
which perhaps hindered predation and easy exhumation
(Stanley, 1970: Savazzi, 19S7). It was interesting to note
that ornamentation appears only after the shell achieves
3—4 cm length. Posterior spines in many other bivalves
help protect protruding siphons; overall coarsely ornate,
the shell of larger Donax scortum might discourage
naticids to engulf it using the mesopodium.
Percentage of consumption of prey biomass might be
another cause (Edwards and Huebner, 1977; Guerrero
and Reyment, 1988; Hughes and Dunkin, 1984). It had
already been mentioned that Mactra luzonica was con-
sumed totally and for Donax scortum this may not be so
(pers. observ.). If the consumption of D. scortum takes
longer, then it will be even costlier (for detailed discus-
sions on consumption rate see Chattopadhyay and
Baumiller, 2009). This might have given rise to more
selective predation for M. luzonica.
Bivariate analyses for Donax scortum involving ante-
rior length against posterior length and depth of pallial
sinus against valve length provided interesting results.
Anterior became significantly larger especially at middle
growth stage (3—4 cm) (Figure 8). A larger anterior
region helped accommodate a large and consequently
more powerful foot, which aided in efficient burrowing
(Stanley, 1970). Depth of pallial sinus also increased
during ontogeny, suggesting deeper burrowing in the
adult stage (Figure 8). In this condition, they are not easily
available to naticid predators. These morphological
changes might possibly have reduced predation pressure.
Mactra luzonica , on the other hand, is a shallow bur-
rower and its burrowing depth falls within the foraging
depth of naticids. Besides, smaller body size and smooth
external surface ornamentation make it vulnerable to
predation. Because of this M. luzonica is more favored
prey species by the naticids in Chandipur intertidal areas.
CONCLUSION
In the present study we have tested Kitehell et al., (1981)
energy maximization model on two bivalve prey of naticid
predators. Our results broadly support the prediction of
the model. Mactra luzonica (iess costly prey) is found to
be favored against Donax scortum (more costly prey).
But we feel that several other aspects should be incor-
porated within their model. Effect of prey availability on
predation frequency has not been considered. If an
infaunal prey becomes a deeper burrower with age, it
will be less available to predators and thus will increase
foraging time and as well as its cost. In the present study,
Donax scortum showed a fall in predation frequency
after 3 cm length, as it burrows deeper in late ontogeny.
It is shown that prey ranking is not valid after this size
class, and cost-benefit analysis is supposed to be
constrained by it. Therefore, in applying the model in
the fossil record, we consider that caution is to be
exercised and depth of pallial sinus should be taken into
account as another important variable.
Prey shell ornamentation also influence prey ranking,
but this is not well tested (see Anderson et al., 1991).
Although in our study we have found no significant role
of shell ornamentation on predation frequency (since
stereotypy occurs in the area that bears weakest ornamen-
tation), it still may significantly influence that. In case of a
thicker prey, handling time may increase significantly
if the predator takes break in the process of drilling.
Consumption rate is also a function of predator size,
which might have important implications in cost-benefit
analyses applied to varied-sized predators (Chattopadhyay
and Baumiller, 2009).
Predation frequency in presence of higher order pre-
dation may be affected (Chattopadhyay and Baumiller,
2007), but this has not been considered in this model. In
our present study, stereotypy ol sites along with rarity of
incomplete and multiple borings on prey shell indicate
that intertidal naticids are indifferent because predators
arrive only with tide. We, therefore, suggest that the
cost-benefit model holds even when there exists hierar-
chy of predators. We also conclude that secondary
predation is very important to control predator effective-
ness, which is evident by the presence of stereotypy of
prey size and site. Drilling the thinnest part of the shell
(site selectivity) quickens the handling time and results
in more effective manipulation. Finally, the model of
Kitehell et al (1981) has been found to be very robust
Page 148
THE NAUTILUS, Vol. 124, No. 3
Valve length (mm)
Valve length (mm)
Figure S. Relative size of anterior region increases in larger Donax, with a deeper pallial sinus during late ontogeny.
and well established, but when applied to lossil assem-
blages, the above-cited factors should be considered with
equal importance.
ACKNOWLEDGMENTS
We express our sincere thanks to Greg Herbert,
University of South Florida and one anonymous
reviewer for their thorough and insightful comments,
which substantially improved the manuscript. We also
acknowledge Devapriya Chattopadhyay, University <4
West Georgia, Shubhabrata Paul, University of South
Florida and Alokananda Mukherjee, Kolkata for criti-
cally reading the manuscript and providing valuable
suggestions. Authors are grateful to Dipak Pal, Jadavpur
University for his help for valuable discussions. We are
indebted to our friends for their co-operation in
fieldwork. S. B. acknowledges the partial funds provided
by DST-PURSE and C.A.S., Department of Geological
Sciences, Jadavpur University. The help rendered by the
local people of Chandipur is also acknowledged.
S. Mondal et al., 2010
Page 149
LITERATURE CITED
Abe, N. 1989. Prey value to the carnivorous gastropods Morula
musiva (Kiener) and the two forms of Thais clavigera
(Kuster): effect of foraging duration and abandonment of
prey. Malacologia 30: 373-395.
Allmon, W.D., J.C. Nieh, and R.D. Norris. 1990. Drilling and
peeling of Turritelline gastropods since the late Creta-
ceous. Palaeontology 33: 595-611.
Anderson, L.C., D.H. Geary, R.H. Nehrn, and W.D. Allmon.
1991. A comparative study of naticid gastropod preda-
tion on Varicorbula caloosae and Chione cancellata,
Plio-Pleistocene of Florida, U.S.A. Palaeobiogeography,
Palaeoelimatology, Palaeoeeology 85: 29^46.
Anderson, L.C. 1992. Naticid gastropod predation on corbulid
bivalves: effect ol physical factors, morphological features,
and statistical artifacts. Palaios 7: 602-620.
Ankel, W. E. 1937. Wie bohrt Natica? Biologisches Zentralblatt
57: 75-82.
Arua, I. and M. Hoque. 1989. Predatory gastropod boreholes in
an Eocene molluscan assemblage from Nigeria. Lethaia
22: 49-59.
Bambach, R.K. and M. Kowalewski. 2000. How to count fos-
sils. Geological Society of America. Abstracts with Pro-
grams 32 (7): A95.
Berg, C.J Jr. 1976. Ontogeny of predatoiy behavior in
marine snails (Prosobranehia: Naticidae). The Nautilus
90: 1-4.
Berg, C.|., Jr. 1978. Development and evolution of behavior in
mollusks, with emphasis on changes in stereotypy. In:
Burghardt, G.M. and M. Bekoff (eds.) The development
of behavior: comparative and evolutionary aspects. Garland
ATPM Press, New York, pp. 3-17.
Boggs, C.H., J.A. Rice, |.A. Kitehell, and J.F. Kitchell. 1984.
Predation at a snail’s pace: what’s time to a gastropod?
Oeeologia 62: 13-17.
Boucher, D.H. (ed.) 1988. The biology of Mutualism: Ecology
and Evolution. Crook Helm, London, 400 pp.
Boucot, A.J., W. F. Brace, and R.E. DeMar. 1958. Distribution
of brachiopod and pelecypod shells by currents. Journal of
Sedimentary Petrology 28: 321-332.
Cowie, R. | 1977. Optimal foraging in great tits ( Pams major).
Nature 268: 137-139.
Carriker, M.R. 1951. Observation on the penetration of tightly
closing bivalves by Busycon and other predators. Ecology
32: 73-83.
Carriker, M.R. 1959. Comparative functional morphology of
the drilling mechanism in Urosalpinx and Eupleura
(muricid gastropods). Proceedings of the XVth Interna-
tional Congress of Zoology 15: 373-376.
Carriker, M.R. 1969. Excavation of boreholes by the gastropod
Urosalpinx: an analysis by light and scanning electron
microscopy. American Zoologist 9: 917-933.
Carriker, M.R. and E.L. Yochelson 1968. Recent gastropod
boreholes and Ordovician cylindrical borings. Contribu-
tions in Palaeontology, Geological Survey Professional
Paper 593: B1-B26.
Carriker, M.R. 1981. Shell penetration and feeding by
naticacean and murieacean predatory gastropods: a syn-
thesis. Malacologia 20: 403-422.
Casey, M.M. and D. Chattopadhyay. 2008. Clumping behavior
as a strategy against drilling predation: implications for the
fossil record. Journal of Experimental Marine Biology and
Ecology 367: 174-179.
Chamov, E. L. 1976. Optimal foraging attack strategy of a mantid.
American Naturalist 110: 141-151.
Chattopadhyay, D., D.J. Miller, and T. K. Baumiller. 2006.
Hydrodynamic effects of drillholes on post-mortem trans-
port of Bivalve shells. Geological Society of America,
Abstracts with Programs, volume 38, number 7, p. 442.
Chattopadhyay, D. and T. K. Baumiller. 2007. Drilling under
threat: An experimental assessment of the drilling behavior
of Nucella lamellosa in the presence of a predator. Journal
of Experimental Marine Biology and Ecology 352: 257-266.
Chattopadhyay, D. and T. K. Baumiller. 2009. An experimental
assessment of feeding rates of the muricid gastropod
Nucella lamellosa and its effect on a cost— benefit analysis.
Journal of Shellfish Research 28: 883-889.
Dietl, G.P. and G.S. Herbert. 2005. Influence of alternative
shell-drilling behaviours on attack duration of the preda-
tory snail Chicoreus dilectus. Journal of the Zoological
Society of London 265: 201-206.
Edwards, D.C. and J.D. Iluebner. 1977. Feeding and growth
rates of Polinices duplicatus preying on Mya arenaria at
Barnstable Harbor, Massachusetts. Ecology 58: 1218-1236.
Endler, J.A. 1991. Interaction between predators and prey. In:
J. R. Krebs and N. B. Davies (eds.) Behavioral Ecology, 3rd
edition. Blackwell, Oxford, 169-201 pp.
FAO (Food and Agriculture Organization of the United
Nations). 2010a. Portunus pelagicus (Linnaeus, 1758).
Species Fact Sheets. Fisheries and Aquaculture Depart-
ment. http://www.fao.org/fishery/species/2629/en. Last
consulted on September 3, 2010.
FAO (Food and Agriculture Organization of the United
Nations). 2010b. Portunus trituberculatus (Miers, 1876).
Species Fact Sheets. Fisheries and Aquaculture Department.
htqr://www.fao.org/fishery/speeies/2630/en. Last consulted
on September 3, 2010.
Fischer, PH. 1922. Sur les gastropods perceurs. Journal de
Conehyliologie 67: 3-56.
Guerrero, S. and R.A. Reyment. 1988. Predation and feeding
in the naticid gastropod Naticarius intricatoides (Hidalgo).
Palaeogeography, Palaeoelimatology, Palaeoeeology 68:
49-52.
Hari, T., S. Bardhan, and D. Mukherjee, 2009. Sympatrie char-
acter convergence between two species of closely related
genera of Pholadinae (bivalvia: Plioladidae) from the
Eastern coast of India. Malacologia 51: 291-306.
Hughes, R.N. and S. de B. Dunkin. 1984. Behavioural compo-
nents of prey selection by dofwhelks Nucella lapillus (L.)
feeding on mussels Mijtilus edulis L. in the laboratory.
Journal of Experimental Marine Biology and Ecology 77:
45-68.
Hughes, R.N. and R.W. Elner. 1979. Tactics of a predator,
Carcinus rnaenas, and morphological responses ot the prey,
Nucella lapillus. Journal of Animal Ecology 48: 65-78.
Kelley, P.II. 1982. The effect of predation on Miocene mollusc
populations of the Chesapeake Group Fla. Bur. geol.
Spec. Publ. 25: 35-48.
Kelley, PH. 1988. Predation by Miocene gastropods of the
Chesapeake Group: stereotyped and predictable. Palaios
3: 436-448.
Kelley, PH. and T.A. Hansen. 1993. Evolution of the Naticid
gastropod predator-prey system: an evaluation of the
Hypothesis of Escalation. Palaios 8: 358-375.
Kelley, PH. and T.A. Hansen. 1996. Recovery of the naticid
gastropod predator— prey system from the Cretaceous-
Tertiary and Eocene- Oligocene extinctions. In: Biotic
Page 150
THE NAUTILUS, Vol. 124, No. 3
Recovery from Mass Extinction Events, M. B. Hart (ed.),
Geological Society of London, Special Publication 102:
373- 386.
Kelley, P. H. and T.A. Hansen. 2003. The fossil record of dril-
ling predation on bivalves and gastropods. In: Kelley, P. H.,
M. Kowalewski, and T.A. Hansen (eds.), Predator-Prey
Interactions in the Fossil Record, Kluwer Aeademic/Ple-
num Press, New York, pp. 113- 139.
Kelley, PH. and T.A. Hansen. 2006. Comparisons of class- and
iower taxon-level patterns in natieid gastropod predation,
Cretaceous to Pleistocene ol the U.S. Coastal Plain.
Palaeogeography, Palaeoelimatology, Palaeoeeology 236:
302-320.
Kidwell, S.M. 2001. Preservation of species abundance in
marine death assemblage. Science 294: 1091-1094.
Kidwell, S.M. and K.W. Flessa. 1995. The quality of the fossil
record. Population, species and communities. In: Annual
Review of Ecology & Systematics, Fantin, D.G. (ed.)
Annual Review Inc., Palo Alto, pp 269-299.
Kitchell, J.A., C.II. Boggs, J.F. Kitchell, and J.A. Rice. 1981.
Prey selection by natieid gastropods: experimental tests
and application to the fossil record. Palaeobiology 7:
533-552.
Kitchell, J.A. 1986. The evolution of predator- prey behavior:
natieid gastropods and their molluscan prey. In: Nitec-ki,
M. and J. A. Kitchell (eds.) Evolution of animal behavior:
palaeontological and field approaches. Oxford University
Press, Oxford, pp. 88-110.
Kitchell, J.A., C.II. Boggs, [.A. Rice, J.F. Kitchell, A. Hoffman,
and J. Martinell. 1986. Anomalies in natieid predatory
behavior: a critique and experimental observations.
Malaeologia 27: 291-298.
Krebs, |.R. 1977. Optimal foraging: theory and experiment.
Nature 268: 583-584.
Krebs, | R. 1978. Optimal foraging: decision riles for predators.
In: Krebs, J.R. and Davies, N.B. (eds.) Behavioral Ecol-
ogy Sinauer Assoc. Inc., Sunderland, pp. 23-63.
Kowalewski, M. 2002. The fossil record of predation: an over-
view of analytical methods. In: The Fossil Record of
Predation. Kowalewski, M. and P. H. Kelley (eds.) The
Paleontological Society Papers 8: 3—42.
Leighton, L. R. 2002. Inferring predation intensity in the
marine fossil record. Paleobiology 28 : 328-342.
Martin-Kaye, P. 1951. Sorting of lamellibranch valves on beaches
in Trinidad, B.W.I. Geological Magazine. 88: 432—434.
Moran, M.J. 1985. Effects on prey diversity, prey size and
predator size on rates of feeding by an intertidal predatory
gastropod Manila marginalba Blainville (Muricidae) on
several species of prey. Journal of Experimental Marine
Biology and Ecology 90: 97-105.
Muklierjee, K.K., S. Das, and A. Chakraborty. 1987. Common
physical sedimentary structures in a beach related open-
sea silieiclastic tropical tidal field at Chandipur, Orissa, India
and evaluation of the weather conditions through discrimi-
nate analysis. Senckenbergiana Maritima 19: 261-293.
Paine, R.T. 1962. Ecological diversification in sympatric gastro-
pods of the genus Busycon. Evolution 16: 515-523.
Paine, R.T. 1963. Trophic relationship of 8 sympatric predatory
gastropods. Ecology 44: 63-73.
Palmer, A. R. 1990. Predator size, prey size and the scaling of
vulnerability; hatching gastropod vs. barnacles. Ecology
71: 759-775.
Pelseneer, P. 1925. Gastropodes marine carnivores Natica
et Puqnira. Annales de la Societe Royale Zoologique de
Belgique 55: 37-39.
Powell, E.N. and R.J. Stanton Jr. 1985. Estimating biomass
and energy flow of mollusks in palaeocommunities.
Palaeontology 28: 1-34.
Pyke, G.H., H.R. Pulliam, and E.L. Charnov. 1977. Optimal
foraging: a selection review with the Mytilus - Pisaster
interaction. Ecology 57: 858-873.
Rao, S.N.V, S.K.V Rao, and S. Mitra. 1991. Marine Molluscs
pp. 1-262. In: State Fauna Series 1, Fauna of Orissa
(Part 3). Zoological Survey of India, Kolkata, pp. 129-268.
Reyment, R. 1966. Preliminary observations on gastropod pre-
dation in the western Niger Delta. Palaeobiogeography,
Palaeoelimatology, Palaeoeeology 2: 81-102.
Roy, K., D. J. Miller and M. LaBarbera. 1994. Taphonomic bias
in analysis of drilling predation: effects of gastropod drill
holes on bivalve shell strengths. Palaios 9: 413-421.
Savazzi, E. 1987. Geometric and functional constraints on
bivalve shell morphology. Lethaia 20: 293-306.
Savazzi, E. and R.A. Reyment. 1989. Subaerial hunting be-
havior in Natica gualteriana (Natieid Gastropod).
Palaeogeography, Palaeoelimatology, Palaeoeeology. 74:
355-364.
Schooner, T.W. 1971. Theory of feeding strategies. Annual
Review', Ecology and Systematics 2: 369—404.
Sohl, N.F. 1969. The fossil record of shell boring by snails.
American Zoologist 9: 725-734.
Spearman, C. 1904. The proof and measurement of association
between two things. American Journal of Psychology 15:
72-101.
Stanley, S.M. 1970. Relation of shell form to life habits of the
Bivalvia (Mollusea). Inc. Memoir. The Geological Society
of America 125, 296.
Taylor, J.D., Cleevely, R.J., and Morris, N.J. 1983. predatory
gastropods and their activities in the Blackdown Green-
sand (Albian) of England. Palaeontology. 26: 521-553.
Tull, D.S. and K. Bohning-Gaese. 1993. Patterns of drilling
predation on gastropods of the family Turritellidae in the
gulf of California. Paleobiology 19: 476^186.
Vermeij, G.J. 1983. Intimate associations and coevolution in
the sea, in: Coevolution ; Futuyma, D. J. and M. Slatldn
(eds.) Sinauer Associates, Inc., Sunderland, pp. 311-327.
Warner, E.E. and D. J. Hall. 1974. Optimal foraging and the
size selection of prey by the bluegill sunfish ( Lepomis
macrochirus) . Ecology 55: 1042-1052.
Yamamoto, T. 2004. Prey composition and prey selectivity of an
intertidal generalist predator, Muricodrupa fusca (Kiister)
(Muricidae). Marine Ecology 25: 35—49.
Ziegelmeier, E. 1961. Fortpflanzungsbiologie der Naticiden
(Gastropoda: Prosobranchia). Helgolander Wissenschaftliche
Meeresunter-suchungen 8: 94-118.
THE NAUTILUS 124(3): 151-154, 2010
Page 151
Research Note
Chromosomal number of two species of
bivalves: Brachidontes darwinianus
(d’Orbigny, 1842) (Mytilidae) and
Isognomon bicolor (C.B. Adams, 1845)
(Isognomonidae)
INTRODUCTION
Brachidontes darwinianus is a common species in estuar-
ies and occurs attached to rocks in the intertidal zone
of rocky shores from the state of Rio de Janeiro in Brazil
to Patagonia in Argentina (Rios, 1995), although Blanco
(1966) stated that this species was found from the
state of Bahia (Todos os Santos Bay), Brazil, to the
mouth of the Rio de La Plata, Argentina. Brachidontes
darwinianus shows marked phenotypic plasticity, with
considerable variation in shell shape, depending on
where the specimens are collected. This plasticity makes
shell morphology a questionable criterion for taxonomic
studies (Nalesso et al., 1992; Tanaka and Magalhaes,
1999).
Isognomon bicolor, a bivalve with a wide geographic
distribution throughout many countries in the Americas
(Domaneschi and Martins, 2002), is commonly found
attached by its byssus to jetty pilings or growing in crev-
ices on rocky shores, often in areas with strong water
currents. Although most isognomonids found in Brazil
have been classified as I. alatus and I. radiatus,
Domaneschi and Martins (2002) stated that all of these
samples effectively belong to I. bicolor. Indeed, the
occurrence of I. alatus and I. radiatus has not been
confirmed in that country.
The analysis of chromosomal numbers has been used
to complement other methods of identifying species
(Gosling, 1992). The aim of this work was to examine
and describe the Giemsa-stained karyotype of the inter-
tidal bivalves B. darwinianus and I bicolor, and to com-
pare the findings with corresponding data for other
bivalve species.
MATERIALS AND METHODS
Specimens were collected from populations in Ubatuba
Bay, on the coast of Sao Paulo state in southeastern
Brazil, as follows: Brachidontes darwinianus from Praia
Dura (23°29'36.9" S, 45°09'54.1" W) and Isognomon
bicolor from Praia da Fortaleza (23°31,51.5,/ S,
45o09'34.4" W.)
These animals were maintained in the laboratory in
aerated seawater at 20°C for two weeks and were fed a
suspension of algal cells ( Isochrysis galbana and
Tetraselmis suecica) to increase the number of mitotic
divisions. The voucher specimens were deposited at the
Museu de Zoologia “Prof. Adao Jose Cardoso” (ZUEC)
at the State University of Campinas (UNICAMP), Sao
Paulo, Brazil, under the accession numbers 1444
( Isognomon ) and 1473 ( Brachidontes ).
Chromosomal Preparation and Staining: Follow-
ing treatment with colchicine (0.005%) lor 10 h, the
bivalves were briefly rinsed in clean seawater and the
mils were removed. The tissue was immersed in 0.8%
O
sodium citrate solution for 50 min and fixed in Carnoys
solution for 1 h at 4°C. The chromosomes were prepared
by dissociating the gill tissue in 30% acetic acid on
heated (43°C) slides followed by staining with 10%
Giemsa solution (pH 6.8) for 10 min.
RESULTS
All Brachidontes darwinianus specimens had a diploid
number of 2n=30 chromosomes. The karyotype con-
sisted of two pairs of metacentric chromosomes, two
pairs of subtelocentrie chromosomes and 11 pairs of
telocentric chromosomes (Figure 1). A diploid number
of 2n=28 was observed for five individuals of Isognomon
bicolor (Figure 2).
DISCUSSION
Brachidontes darwinianus: Extensive cytogenetic
studies of the Mytilidae have allowed accurate cytotaxo-
nomic comparisons among the species in this family
(Thiriot-Quievreux, 2002). The diploid chromosome
number of 2n=30 found in Brachidontes darwinianus
has been reported in only six other mytilid species
so far, namely, Musculista senhousia (by Ieyama,
1977) , Brachidontes recurvus (by Diupotex-Chong,
1978) , Honnomtja mutabilis (by Ieyama et al., 1994),
Limnopema fortunei (by Ieyama, 1996), Perna canalicu-
lus (by Libertini et al., 1996), and Choromytilus chorus
(by Palma-Rojas et al., 1997). Only four species of
the genus Brachidontes have been studied to date:
B. recurvus (2n=30; mentioned above), B. pharaonis
(2n=28; Vitturi et al., 2000), B. minimus (2n=28;
Thiriot-Quievreux, 2002) and Brachidontes rodriguezi
(2n=32; Torreiro et al., 1999). The karyotype of B. dar-
winianus is unusual for bivalves because it contains only
two pairs of metacentric chromosomes, with the other
13 pairs being subteloeentrics or telocentries. The occur-
rence of species with subtelocentrie and telocentric
chromosomes is uncommon in the Mytilidae (Torreiro
et al., 1999, Thiriot-Quievreux, 2002). Overall, Brachi-
dontes darwinianus showed the same chromosomal
Page 152
THE NAUTILUS, Vol. 124, No. 3
Figure 1. Mitotic metaphase of Brachidontes darwinianus.
Scale bar = 5 pm.
number as B. recurvus and had a chromosomal mor-
phology similar to that ol B. rodriguezi, i.e. only two
metacentric pairs and a predominance of subtelocentric
and telocentric chromosomes.
Isognomon bicolon Squashed and air-dried prepara-
tions have been used to study chromosomes in species of
the genera Isognomon and Pinctada , although the chro-
mosomal number has been determined for only a few
species of the Pterioidea (Wada, 1978; Rodriguez et al.,
1983). The chromosomal number of 2n=28 here
observed for this species coincided with those of the
pterioidean species I. alatus, Pinctada fucata , and
Figure 2. Mitotic metaphase of Isognomon bicolor , Giemsa
staining. Scale bar = 5 pm.
P. imbricata. These results provide an additional example
of a tendency towards a stable chromosomal number in
the Isognomonidae and Pteridae, and in the superfamily
Pterioidea.
ACKNOWLEDGMENTS
The authors thank the Laboratorio de Cultura de
Microorganismos Marinhos (USP) for providing the
suspension of algal cells (. Isochrysis galbana and
Tetraselmis suecica). This work was supported by
CAPES and CNPq.
LITERATURE CITED
Blanco, V.C.K. 1966. A revision of Brachidontes (Mollusca:
Bivalvia), Doctoral thesis. Harvard University, Cambridge,
MA.
Diupotex-Chong, M.E., F. Rodriguez-Romero, M. Uribe-
Aleocer, and A. Laguarda-Figueras. 1978. Karyotypic
characters of Brachidontes recurvus Rafinesque, 1820
(Pelecypoda: Mytilidae). Annales del Centro de Cieneias
del Mar y Limnologia 5; 55—58.
Domaneschi, O. and C.M. Martins. 2002. Isognomon bicolor
(C.B. Adams) (Bivalvia, Isognomonidae): primeiro registro
para o Brasil, redescriyao da especie e eonsiderayoes sobre
a ocorrencia e distribuigao de Isognomon na costa
brasileira. Revista Brasileira de Zoologia. 19: 611—627.
Gosling, E. 1992. The Mussel Mytilus : Ecology, Physiology,
Genetics and Culture. 1st ed. Elsevier, Amsterdam.
Ieyama, H. 1977. Studies on the chromosomes of two species
in Mytilidae (Pteriomorphia, Bivalvia). Venus: The Japa-
nese Journal of Malacology. 36: 25-28.
Ieyama, IF, O. Kameoka, T. Tan, and J. Yamasaki. 1994. Chro-
mosomes and nuclear DNA contents of some species in
Mytilidae. Venus 53: 327-331.
Ieyama, H. 1996. Chromosomes and nuclear DNA contents
of Limnoperna in Japan (Bivalvia: Mytilidae). Venus 55:
65-68.
Libertini, A., A. Boata, M. Panozzo, and V. Fogato. 1996.
Karyotype and genome size in some species of Mytilidae
(Bivalvia, Mollusca). La Kromosomo II 82: 2819-2827.
Nalesso, R.C., L.F. Duarte, and E.G. Mendes. 1992. Pheno-
typic plasticity in Brachidontes darwinianus (Bivalvia:
Mytilidae). Revista Brasileira de Biologia 52: 245-249.
Palma-Rojas, C., R. Guerra, D. Brown, and E. Von Brand.
1997. Quantitative karyotype of Choromytilus chorus
(Mollusca: Bivalvia: Mytilidae). The Veliger 40: 259-262.
Rios, E.C. 1995. Seashells of Brazil. 2nd edition. Museu
Oceanografico da FURG, Rio Grande, 328 pp.
Rodriguez, F, Laguarda, A. and Garcia-Cubas, A. 1983. The
karyotype of Isognomon alatus. Canadian Journal of
Genetics and Cytology. 25: 85-87.
Tanaka, M.O. and Magalhaes, C.A. 1999. Morphometric spe-
cies recognition in Brachidontes darwinianus (Orbigny,
1842) and Brachidontes solisianus (Orbigny, 1842)
(Bivalvia: Mytilidae). The Veliger. 42: 267-274.
Thiriot-Quievreux, C. 2002. Review of the literature on bivalve
cytogenetics in the last ten years. Cahiers de Biologie
Marine. 43: 17-26.
Torreiro, A., M.J. Martinez-Exposito, M.I. Trucco, and J.J.
Pasantes. 1999. Cytogenetics in Brachidontes rodriguezi
d’Orb. (Bivalvia, Mytilidae). Chromosome Research 7: 49-55.
G.O. Introfni et ah, 2010
Page 153
Vitturi, R., P. Gianguzza, M.S. Colomba, and S. Riggio.
2000. Cytogenetic characterization of Brachidontes phar-
aonis (Fischer R, 1870): karyotype, banding and fluores-
cent in situ hybridization (FISH). Ophelia 52: 213-220.
Wada, K. 1978. Chromosome karyotypes of three bivalves: the
oysters. Isognomon alatiis and Pinctada imbrincada , and
the bay scallop, Argopecten irradians irradians. Biological
Bulletin 155: 235-245.
Gisele Orlandi Intromi
Departamento de Biologia Celular, Instituto de Biologia
Universidade Estadual de Campinas (UNICAMP)
CP 6109, 13083-863
Campinas, SP, BRAZIL
Claudia Alves de Magalhaes
Gerencia de Qualidade Costeira e Marinha
Secretaria de Mudanyas Climaticas e Qualidade Ambiental
Ministerio do Meio Ambiente, Esplanada dos Ministerios
Brasilia, BRAZIL
Shirlei M. Recco-Pimentel 1
Departamento de Biologia Celular, Instituto de Biologia
Universidade Estadual de Campinas (UNICAMP)
CP 6109, 13083-863
Campinas, SP, BRAZIL
[email protected]
1 Corresponding author
Sponsored in part by the State of Florida, Department
of State, Division of Cultural Affairs, the Florida Arts
Council and the National Endowment for the Arts.
NATIONAL
ENDOWMENT
FOR THE ARTS
INSTRUCTIONS TO AUTHORS
THE NAUTILUS publishes articles on till aspects of the
biology, paleontology, and systematic^ of mollusks.
Manuscripts describing original, unpublished research
and review articles will be considered. Brief articles, not
exceeding 1000 words, wall be published as notes and do
not require an abstract. Notices of interest to the mala-
cological community will appear in a notices section.
Manuscripts: Each original manuscript and accompa-
nying illustrations should be submitted to the editor pref-
erably via e-mail or as hardcopy in triplicate.
Text must conform to the dimensions of 8V2 x 11-inch
paper, double-spaced, and single-column throughout (in-
cluding literature cited, tables, and figure captions). Au-
thors should follow the general recommendations of Sci-
entific Style and Format — The CSE Manual for Authors,
Editors, and Publishers, available from the Council of
Science Editors at www.councilscienceeditors.org. The
first mention of a scientific name in the text should be
accompanied by the taxonomic authority, including year.
Latinized names and other words to be printed in italics
must be underlined; leave other formatting indications to
the editor. Metric, not English, units are to be used. Geo-
chronologic modifiers should be capitalized only when
units are formally recognized: for instance, use Late Cre-
taceous but early Miocene. Likewise, only modifiers of
formally recognized chronostratigraphic units are capi-
talized: use Lower Jurassic but upper Oligocene.
The sequence of sections should be title page, ab-
stract, introduction, materials and methods, results, dis-
cussion, acknowledgments, literature cited, tables, figure
captions, figures. The title page should include the title,
authors name(s) and address(es). If corresponding au-
thor is not the senior author, please indicate. The ab-
stract should. summarize in 250 words or less the scope,
main results, and conclusions of the article. Abstracts
should be followed by a list of additional key words. All
references cited in the text must appear in the Literature
Cited section and vice-versa. Please follow a recent issue
of THE NAUTILUS for bibliographic style, noting that
journal titles must be unabbreviated. Information on
plates and figures should be cited only if not included
within the pagination of cited work. Tables must be num-
bered and each placed on a separate page. If in doubt,
please follow a recent issue of the journal for sequence of
sections and other style requirements.
Illustrations: Illustrations are rendered either at full-
page width (maximum width 17 cm) or column width
(maximum width 8.2 cm). Please take these dimensions
into consideration when preparing illustrations. Page-
width illustrations ideally should span the entire width of
printed page (17 cm). “Tall” page-width illustrations
should be avoided, square or “landscape” formats work
better. Please design plates accordingly, such that there
will be enough space left at the bottom of printed page
for plate caption. (Digital technology has made this task
much easier.)
All line drawings must be in black, clearly detailed,
and completely labeled. Abbreviation definitions must be
included in the caption. Line drawings must be high
resolution files at at least 600 dpi (dots per inch) resolution
at actual size. Standard digital formats for line drawings
include .tif, .bmp, .psd, .eps, and .pdf.
Photographs may be submitted in black-and-white or
color, preferably in RGB mode if in color. Standard digi-
tal formats for photographs include .tif, .psd, .jpg, or .pdf.
Photographs must be high resolution files at least 300 dpi
resolution at actual size.
If more than one figure is included in an illustration,
all figures are to be consecutively numbered (Figures. 1,
2, 3, . . . , NOT Figures 1A, IB, 1C, . . . , NOR Plate 1,
Figure 1, ■ • In illustrations with more than one figure,
make sure that blank areas between figures is kept to a
minimum, thereby allowing for more area for each indi-
vidual figure.
Compressed files (e.g., .jpg) may be used to facilitate
transmission of files during original submission, but may
not be acceptable at final submission (see below).
Voucher Specimens: Deposition of the holotype in a
recognized institutional, public collection is a require-
ment for publication of articles in which new species-
level taxa are described. Deposition of paratypes in in-
stitutional collections is strongly encouraged, as is the
deposition of representative voucher specimens for all
other types of research work.
The Editorial Process: Upon receipt, all manuscripts are
assigned a number and acknowledged. The editor reserves
the right to return manuscripts that are substandard or
not appropriate in scope for THE NAUTILUS. Manu-
scripts deemed appropriate for the journal will be sent
for critical review to at least two reviewers. The review-
ers’ recommendations will serve as basis for rejection or
continuation of the editorial process. Reviewed manu-
scripts will be sent back to authors for consideration of
the reviewers’ comments. The revised version ol the
manuscript may at this point be considered accepted for
publication by the journal.
Final Submission: Authors of accepted manuscripts are
required to submit a final version via e-mail to the editor
[email protected]. Please do not send low-resolu-
tion or compressed illustration files at this stage. Send any
files larger than 20 Mb on a CD cr DVD to the editor.
Proofs: After typesetting, proofs will be sent to the au-
thor. Author should read proofs carefully and send cor-
rections to the editor within 48 hours. Changes other than
typesetting errors will be charged to the author at cost.
Offprints: An order form for offprints will accompany
the proofs. Offprints will be ordered through the editor.
Authors with institutional, grant, or other research sup-
port will be asked to pay for page charges at the rate of
$60 per page.
® This paper meets the requirements of ANSI/NISO Z39. 48-1 992 (Permanence of Paper)
THE NAUTILUS
sn-
4c I
,K)3ii
\L'V2:
Volume 124, Number 4
December 14, 2010
ISSN 0028-1344
A quarterly devoted
to malacology.
EDITOR-IN-CHIEF
Dr. Jose H. Leal
The Bailey-Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
BUSINESS MANAGER
Maiy Jo Bunnell
The Bailey-Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
EDITOR EMERITUS
Dr. M. G. Harasewych
Department of Invertebrate Zoology
National Museum of
Natural Histoiy
Smithsonian Institution
Washington, DC 20560
CONSULTING EDITORS
Dr. Rudiger Bieler
Department of Invertebrates
Field Museum of
Natural History
Chicago, IL 60605
Dr. Arthur E. Bogan
North Carolina State Museum of
Natural Sciences
Raleigh, NC 27626
Dr. Philippe Bouehet
Laboratoire de Biologie des
Invertebres Marins et Malaeologie
Museum National d'Histoire Naturelle
55, rue Buffon
Paris, 75005 France
Dr. Robert H. Cowie
Center for Conservation Research
and Training
University of Hawaii
3050 Made Way, Gilmore 409
Honolulu, HI 96822
Dr. Robert T. Dillon, Jr.
Department of Biology
College of Charleston
Charleston, SC 29424
Dr. Eileen IT Jokinen
8234 E. North Shore Road
Sault Ste. Marie, AH 49783
Dr. Douglas S. Jones
Florida Museum of Natural History
University of Florida
Gainesville, FL 32611-2035
Dr. Hany G. Lee
4132 Ortega Forest Drive
Jacksonville, FL 32210
Dr. Charles Lydeard
Biodiversity and Systematics
Department of Biological Sciences
University of Alabama
Tuscaloosa, AL 35487
Bruce A. Marshall
Museum of New Zealand
Te Papa Tongarewa
PO. Box 467
Wellington, NEW ZEALAND
Dr. James H. McLean
Department of Malacology
Natural Histoiy Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Paula M. Mikkelsen
Paleontological Research
Institution
1259 Trumansburg Road
Ithaca, NY 14850
Dr. Diarmaid O Foighil
Museum of Zoology and Department
of Biology
University of Michigan
Ann Arbor, MI 48109-1079
Dr. Gustav Paulay
Florida Museum of Natural Histoiy
University of Florida
Gainesville, FL 3261 1 -2035
Mr. Richard E. Petit
PO. Box 30
North Myrtle Beach, SC 29582
Dr. Gaiy Rosenberg
Department of Mollusks
The Academy of Natural Sciences
1900 Benjamin Franklin Parkway
Philadelphia, PA 19103
Dr. Angel Valdes
Department of Malacology
Natural Histoiy Museum
of Los Angeies County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Geerat |. Vermeij
Department of Geology
University of California at Davis
Davis, CA 95616
Dr. G. Thomas Watters
Aquatic Ecology Laboratory
1314 Kinnear Road
Columbus, OH 43212-1194
SUBSCRIPTION INFORMATION
The subscription rate for volume
125 (2011) is US $54.00 for
individuals, US $88.00 for
institutions. Postage outside the
United States is an additional US
$10.00 for regular mail and US
$28.00 for air delivery. All orders
should be accompanied by payment
and sent to: THE NAUTILUS, PO.
Box 1580, Sanibel, FL 33957, USA,
(239) 395-2233.
Change of address: Please inform
the publisher of your new address at
least 6 weeks in advance. All
communications should include both
old and new addresses (with zip
codes) and state the effective date.
THE NAUTILUS (ISSN 0028-1344)
is published quarterly by The Bailey-
Matthews Shell Museum, 3075
Sanibel-Captiva Road, Sanibel, FL
33975.
Periodicals postage paid at Sanibel,
FL, and additional mailing offices.
POSTMASTER: Send address
changes to: THE NAUTILUS
PO. Box 1580
Sanibel, FL 33957
THE
CONTENTS
Kazutaka Amano
Steffen Kiel
Phillip J. Fallon, Jr.
Vinieius Padula
Marlon Delgado
Lance H. Gilbertson
Edna Naranjo-Garcia
G. Thomas Walters
Glenn Duffy
Hans Bertsch
Research Note
Martin Avery Snyder
William G. Lyons
Gary Rosenberg
L U S
Volume 124, Number 4
December 14, 2010
ISSN 0028-1344
Taxonomy and distribution of fossil Archivesica (Bivalvia: Vesicomyidae)
in Japan 155
Descriptions and illustrations of some new and poorly known turrids of
the tropical northwestern Atlantic. Part 1 . Genera Buchema Corea,
1934 and Miraclathurella Woodring, 1928 (Gastropoda: Turridae:
Crassispirinae) 166
A new species of Cerberilla (Gastropoda: Nudibranchia: Aeolidiidae) from
northeastern Brazil 175
A new species of Holospira (Gastropoda: Pulmonata: Urocoptidae) from
Coahuila, Mexico 181
Rolleia oberi new species — first record of the genus from the Dominican
Republic, with a lectotype designation of Cyclotus martensi Maltzan, 1888
(Gastropoda: Annulariidae) 185
Las Conchas Azules (The Blue Shells): Father Kino, abalones, and
the Island of California 188
The date of publication of section 16, corrigenda quaedam et addenda , of
Dunker’s Novitates Conchologicae, Series II, Marina Mollusca 192
Author Index
195
STATEMENT OF OWNERSHIP, MANAGEMENT, AND CIRCULATION
1. Publication Title, THE NAUTILUS.
2. Publication No., 0028-1344.
3. Filing Date, October 31, 2010.
4. Issue Frequency, Quarterly.
5. No. of Issues Published Annually, Four.
6. Annual Subscription Price, US $88.00.
7. Complete Mailing Address ot Known Office of Publication, 3075 Sanibel-Captiva Road, Sanibel, FL 33957 USA
8. Complete Mailing Address of Headquarters, same as 7.
9. Full Names and Complete Mailing Addresses of Publisher, The Bailey-Matthews Shell Museum, 3075 Sanibel-Captiva Road,
Sanibel, FL 33957 USA
Editor, Dr. Jose H. Leal, address as above.
Managing Editor, Mary Jo Bunnell, address as above.
10. Owner, Shell Museum and Educational Foundation, Inc., address as above.
11. Known Bondholders, Mortgagees, and Other Security Holders Owning or Holding 1 Percent or More of Total Amount of
Bonds, Mortgages, or Other Securities, None.
12. The purpose, function, and nonprofit status of this organization and the tax exempt status for federal income tax purposes has
not changed during the preceding 12 months.
13. Publication Name, THE NAUTILUS.
14. Issue Date for Circulation Data Below, October 11, 2010
Average Single
15. Extent and Nature of Circulation 12 months Issue
THE NAUTILUS 124(4): 155-165, 2010
Page 155
Taxonomy and distribution of fossil Archivesica
(Bivalvia: Vesicomyidae) in Japan
Kazutaka Amano
Department of Geoscience
| nets 1 1 University of Education
Joetsu 943-8512, JAPAN
[email protected]
Steffen Kiel
Geoscience Center
Georg-August University Gottingen
Geobiology Group
Goldschmidtstr. 3
37077 Gottingen, GERMANY
ABSTRACT
Six species of vesicomyid bivalves of the genus Archivesica occur
in the Neogene of Japan, one further species is assigned here to
this genus, but with some hesitation. Among these six species,
two are herein described as new: A. shikamai from the Pliocene
Ikego Formation on the Pacific side of Honshu and A. kannoi
from the lower Pliocene Kurokura Formation on the Japan Sea
side of Honshu; one species, the late Miocene A. shiretokensis ,
has recently been described; two species, the late Miocene to
early Pliocene A. nipponica and the Pliocene Archivesica sp.
were previously regarded as belonging to Cahjptogena but are
herein transferred to Archivesica. The extremely large Pliocene
“ Calyptogena ” hosoensis closely resembles modem species of
Archivesica from the western Pacific rather than species of
Cahjptogena and is herein hesitantly assigned to Archivesica.
Compared to Paleogene species of Archivesica from the northern
and eastern side of the North Pacific, the Neogene Japanese
species differ by being larger and by lacking a lunular incision.
We suggest that this group of large Archivesica species originated
in the western Pacific during the Miocene and spread to the coast
of western North America by the Pliocene. The impressive diver-
sification of these "large Archivesica” species since the late
Miocene might be related to the coeval decline in diversity of
the elongate vesicomyid genus Adulomya in Japan.
Additional keywords: Neogene, new species, bivalves,
Cahjptogena
INTRODUCTION
The Vesicomyidae is a species-rich deep-water bivalve
family frequently found at hydrothermal vents, cold
seeps, and decaying whale carcasses. Its fossil history
can be traced back to the middle Eocene (Amano and
Kiel, 2007). In Japan, which has a rich record of exposed
Cenozoic deep-water sediments, fossil vesicomyids
are known from cold-seeps, whale-falls, and organic-rich
shales. In previous studies we treated members of the
genera Adulomya Kuroda, 1931, Cahjptogena Dali,
1891, and Huhertschenckia Takeda, 1953 (Kanno et ah,
1989; Amano and Kiel, 2007; Amano and Kiel, in press).
Members of the genus Archivesica have the largest
shells among all the vesicomyids, three radiating cardinal
teeth, a subumbonal pit and a shallow pallial sinus. Shells
with such characteristics have been reported mainly from
the Pliocene deposits in the Japan Sea side of central
Honshu and the Pacific side of southwestern Honshu,
and include Akebiconcha kawamurai Kuroda, 1943 and
Cahjptogena nipponica Oinomikado and Kanehara, 1938
and various species in open nomenclature (Majima et ah,
2005). These names, however, are often used in a confus-
ing and inconsistent manner, partly because the type
material of Cah/ptogena nipponica was poorly preserved
and is now lost. The purpose of the present study is to
summarize the taxonomy and the distribution of the fossil
Japanese species of Archivesica Dali, 1908 and discuss the
evolutionary history of this genus.
MATERIALS AND METHODS
The new species described herein are from two Pliocene
formations in Honshu, Japan (Figure 1). The specimens
were collected from turbidite deposits of the Pliocene
Ikego Formation at Ikego, Zushi City in Kanagawa Pre-
fecture (Figure 1, Loe. 1). Some of these specimens had
previously been described as Cah/ptogena cf. nipponica
or Cah/ptogena sp. 1, and C. sp. 2 (Kanno, 1991, 1993).
Further specimens were extracted from large calcareous
concretion in the Pliocene part of the Kurokura Forma-
tion at Matsudai, Tokamachi City in Niigata Prefecture
(Figure 1, Loe. 3). Some of these specimens had previ-
ously been described as Cah/ptogena cl. nipponica by
Amano and Kanno (2005). All new material is housed
in the Joetsu University of Education. In addition, we
examined specimens identified as A. kawamurai elongata
Ozaki, 1958 from the Pliocene Na-arai Formation at
Choshi (Figure 1, Loc. 2) in Chiba Prefecture, which
are housed at National Science Museum (Ozaki, 1958).
Institutional Abbreviations: ESN: Furukawa Museum
of Nagoya University; IGSU: Institute ol Geoscience,
Shizouka University; JUE: Joetsu University of Education;
Page 156
THE NAUTILUS, Vol. 124, No. 4
NSMT-Mo: National Science Museum, Tokyo, Mollus-
can collection; NSM: National Science Museum (Pale-
ontology); YCM-GP: Yokosuka City Museum, Yokosuka,
Geology and Paleontology.
SYSTEMATICS
Family Vesicomyidae Dali and Simpson, 1901
Genus Archivesica Dali, 1908
Type species: Callocardia gigas Dali, 1896 from the
Gulf of California.
Archivesica kawamurai (Kuroda, 1943)
(Figures 2-13, 19, 23)
Akebiconcha kawamurai Kuroda, 1943: 14-18, pi. 13, text-figs.
1-3; Habe, 1951: 117-1 18, figs. 246, 249; Ozaki, 1958: 124,
pi. 3, figs. 1-3, pi. 5, figs.l, 2; Habe, 1961: pi. 55, fig. 16;
Shikama, 1962: 53, pi. 3, figs. 6a-b, 7a-e; Okutani, 1966:
300, pi. 28, fig. 3; Habe, 1977: 237, pi. 50, figs. 3, 4; Noda,
1980: 89-90, pi. I, fig. 21, pi. 4, fig. 21; Tsuchida, 1986:
29-30, fig. 2; llorikoshi, 1989: 64-66, figs. 4-6; Kanno,
1993: pi. 9, figs. 1-3; Nobuhara and Tanaka, 1993: 30, 32,
pi. 1 , figs. 8-12; Nobuhara and Takatori, 1999: pi. 1, fig. 11.
Akebiconcha kawamurai elongate Ozaki, 1958: 123, pi. 5,
figs. 3, 4, pi. 6, figs. 3-5. ( non pi. 6, figs. 1, 2).
Akebiconcha nipponica (Oinomikado and Kanehara). — Shikama
and Masnjima, 1969: pi. 7, figs. 16-19.
Archivesica ( Akebiconcha ) kawamurai (Kuroda). — Keen, 1969:
N664, figs. E138— 7a-c.
Calyptogena sp. Majimaet al., 1990: figs. 3A-D. ( non figs. 3Ea,b).
Calyptogena cf. nipponica Oinomikado and Kanehara. Kanno,
1990: 93-95, pi. 5, figs. 1-3. ( non pi. 6, figs. 1, 2); Kanno,
1991: pi. 2, figs. 2a-c, pi. 3, figs. 1-4.
Calijptogena solidissima Okutani, Ilashimoto and Fujikura,
1992: 226-230, fig. 2-8; Okutani, 2000: 999, pi. 497, fig. 15.
Calyptogena sp. 2. Kanno, 1993: 133-135, pi. 3, fig. 1-10.
Calyptogena ( Archivesica ) kawamurai (Kuroda). Sasaki et al.,
2005: fig. 10; Okutani, 2000: 999, pi. 497, fig. 15; Okutani,
2008: fig. 8.90.
Vesicomya ( Calyptogena ) kawamurai (Kuroda). — Nobuhara,
2003: fig. 3-7-12.
Type Material: Holotype NSMT-Mo 60915, off
Odawara City, Sagami Bay.
Material Examined: Thirteen specimens from Loc. 1
were examined.
Remarks: The examined specimens were treated
as Cah/ptogena cf. nipponica or C. sp. 2 by Kanno
(1990, 1991, 1993). They are characterized by having
an elongate ovate shell, a shallow pallial sinus, a wide
subumbonal pit and a steeply sloping and bifurcated
posterior cardinal tooth in the right valve. These fea-
tures clearly identify these specimens as Archivesica
kawamurai (Kuroda, 1943). Their hinge structure (Figures
2, 3) resembles that of the holotype of Calyptogena
solidissima Okutani, Hashimoto and Fujikura, 1992, a
species now considered synonym with A. kawamurai
(Kojima et al. 2006).
As Shikama (1962) pointed out, the syntypes of
Akebiconcha kawamurai elongata Ozaki, 1958 from the
Pliocene Na-arai Formation in Chiba Prefecture are
variation of this species. However, the paratype of this
subspecies is from the Pliocene Ikego Formation in
Kanagawa Prefecture and has a more elongate shell than
the syntypes. It may belong to a new species, Archivesica
shikamai new species, described below.
Specimens reported as Akebiconcha nipponica from the
Pliocene Imaizumi Bed in Kanagawa Prefecture (Shikama
and Masujima, 1969: pi. 7, figs. 16-19) are considered here
as belonging to Archivesica kawamurai because the illus-
trated specimens are indistinguishable from A. kawamurai
by shell form and hinge structure. Moreover, Shikama
and Masujima (1969) also illustrated Recent specimens
of Archivesica kawamurai as Akebiconcha nipponica.
The original Akebiconcha nipponica was described from
the upper Miocene to lower Pliocene deposits in Niigata
Prefecture (Oinomikado and Kanehara, 1938) and is
discussed below.
Majima et al. (1990) illustrated Calyptogena sp. from
the Pliocene Hijikata Formation in Shizuoka Prefecture,
fudging from their illustration, shell outline and hinge
structure resemble that of A. kawamurai .
Matsushima et al. (2003) identified two spec-
imens from the lower Pliocene Ochiai Formation in
Kanagawa Prefecture as Calyptogena cf. kawamurai.
One of the specimens (their figs. 8a, b) resembles
A. kawamurai in its outline and hinge structure, but
the lack ol information on its pallial sinus and the
hinge structure of its right valve prevents us from
K. Amano and S. Kiel, 2010
Page 157
Figures 2-13. Archivesica kawamurai (Kuroda) ( =Calijptogena solidissima Okutani, Hashimoto and Fujikura). 2, 3, 8. All
specimens are from Loe. 1. 2. Left-valve hinge, hinge length 58.6 mm, |UE no. 15877-1. 3. Right valve hinge, hinge length
40.1 mm, JUE no. 15877-2. 8. Internal mold, view on right valve, length 106.0 mm, JUE no. 15877-3. 4, 5, 12. Holotype ol
Archivesica kawamurai , length 76.4 mm, NSMT-Mo no. 60915. 4. Left valve. 5, 12. Right valve. 6, 7. Hinge of holotype
of Calyptogena solidissima Okutani, Hashimoto and Fujikura, length 128.5 mm, NSMT Mo-69675; 6. Left valve. 7. Right valve of
which outline is shown in Figure 23. 9, 11, 13. Syntypes of Akebiconcha kawamurai elongata Ozaki. All specimens are from
Loe. 2. 9. Internal mold, view on left valve, length 92.1 mm, NSM no. 4409. 11, 13. Specimen NSM no. 4408, seen in dorsal view
and view on left valve, length 85.8 mm. 10. Calyptogena sp. illustrated by Majima et al. (1990, Fig. 3A). Left valve, length 63.8 mm,
IGSU-M-001, Hijikata Formation.
Page 158
THE NAUTILUS, Vol. 124, No. 4
definitely identifying it as A. kawamurai. The other
specimen, however, (their figs. 9a, b) has many fine
and regular concentric lines on its surface and a stout
and posteriorly oblique middle cardinal tooth which
are never seen in A. kawamurai.
Distribution: Pliocene: Na-arai and Kurotaki Forma-
tions in Chiba Prefecture, Ikego Formation and Imaizumi
Bed in Kanagawa Prefecture, Hijikata Formation and
Taman Siltstone in Shizuoka Prefecture, Shinzato For-
mation in Okinawa Prefecture. Recent: Off Choshi, off
Odawara, off Jogashima, Seno-Umi, Daini-Tenryu Noll,
Ensei Noll, Kuroshima Noll.
Archivesica shikamai new species
(Figures 14-18, 20-22)
Akebiconcha kawamurai elongata Ozaki, 1958: pi. 6, figs. 1, 2.
( non pi. 5, figs. 3, 4, pi. 6, tigs. 3-5).
Cahjptogena cf. nipponica Oinomikado and Kanehara. — Majima
et al., 1990, fig. 3 Ea, Eb; Kanno, 1991: pi. 1, figs, la-c, pi. 2,
fig. 1. ( non pi. 2, figs. 2a-c, pi. 3, figs. 1-4).
Cahjptogena sp. 1. Kanno, 1993: 126-132, pi. 1, figs. 1-15, pi. 2,
figs. 1-12.
Diagnosis: A medium-sized Archivesica with elongate
shell, slightly concave ventral margin, shallow pallial
sinus; blunt ridge running from umbo to posterior cor-
ner; subumbonal pit wide; three radiating cardinal teeth
in both valves, steeply sloping posterior tooth in right
valve.
Description: Shell of medium size for genus, up to
152.4 mm long, thick-walled, elongate throughout ontog-
eny (height/length-ratio = 0.39-0.53), equivalve and
inequilateral, weakly inflated, sculptured by growth lines
only. Blunt ridge running from beak to posteroventral
corner. Beak prosogyrate, situated anterior at about one-
third of shell length. Anterodorsal margin broadly
arched, graduating into narrowly rounded anterior mar-
gin; ventral margin slightly concave; posterodorsal mar-
gin nearly straight, gently sloping, continuing into
rounded posterior margin. Escutcheon and lunule
absent. Hinge plate moderately wide, with three cardinal
teeth in both valves. Right valve hinge: anterior cardinal
tooth (3a) thin; posterior cardinal tooth (3b) steeply
oblique; central tooth (1) rather thick, vertical to hinge
base; subumbonal pit wide. Left valve hinge: anterior
tooth (2a) thin, oblique anteriorly, connected to stout
middle tooth (2b); posterior tooth (4b) thin, oblique pos-
teriorly; subumbonal pit wide. Nymph distinct and long,
occupying two-thirds of the posterodorsal margin. Ante-
rior adductor muscle scar subcircular; posterior one
ovate; onset of pallial line near base of anterior adductor
scar, obliquely crossing anteroventral shell area, pallial
sinus shallow and wide; radial interior striae indistinct.
Holotype: Length I 12. 1 nun, height 56.1 mm, JUE
no. 15878, left valve.
Paratypes: Length 106.0 mm, height 50.1 mm, |UE
no. 15879- 1 right valve; length 99.9 mm, height 48.3 mm.
JUE no. 15879-2, right valve; length 152.4 mm, height 68.0
mm, JUE no. 15879-3, left valve; length 76.5 mm, height
35.4 mm, JUE no. 15879-4, left valve; length 110.0 mm,
height 52. i mm, JUE no. 15879-5, left valve; all from the
type locality.
Type Locality: Area currently occupied by the US
Army at Ikego, Zushi City, Kanagawa Prefecture.
Material Examined: Twenty-six specimens from the
type locality (Loe. 1).
Remarks: When Ozaki (1958) proposed Akebiconcha
kawamurai elongata as a new subspecies from the Plio-
cene Na-arai Formation, he assigned the specimens from
the Pliocene Ikego Formation (Figure 16) as a paratype
of the subspecies. As noted above, the syn types of this
“subspecies” can be identified as the Recent A. kawamurai.
The paratype of Akebiconcha kawamurai elongata has a
more elongate shell than tire syntypes of A. kawamurai
elongata and the Recent specimens of A. kawamurai.
Moreover, this specimen was collected from the same
Ikego Formation as the present new species. Thus, the
paratype can be included into the present new species.
Comparison: Archivesica shikamai closely resembles
A. kawamu rai in the arrangement of cardinal teeth in the
right valve, but differs from it by having a more elongate
shell (see Figure 24) and a wider subumbonal pit. The type
material of A. shikamai was previously described and illus-
trated by Kanno ( 1991, 1993) as Cahjptogena cf. nipponica
and Cahjptogena sp. 1. from the type locality where it co-
occurs with Archivesica kawamurai . Such a co-occurrence
of two large Archivesica species at a single locality re-
sembles the co-occurrence of A. soijoae (Okutani) and
A. okutanii (Kojima and Ohta) in Sagami Bay today.
Distribution: Pliocene Ikego Formation in Kanagawa
Prefecture.
Etymology: Named after the late Emeritus Prof.
Tokio Shikama (Yokohama National University), a mol-
luscan paleontologist, who also studied the mollusean
fauna from the Ikego Formation.
Archivesica kannoi new species
(Figures 25-31)
Cah/ptogena nipponica Oinomikado and Kanehara. — Kanno,
1993: pi. 7, figs. 4-9; Amano, 1994, pi. 2, figs. 1, 3, 8, 11.
Cahjptogena cf. nipponica Oinomikado and Kanehara. —
Amano and Kanno, 2005: 207-208, figs. 4, 5, 11-13.
Diagnosis: A medium-sized Archivesica with elongate
quadrate shell, very shallow pallial sinus; subumbonal pit
small but deep; three radiating cardinal teeth in both valves.
Description: Shell of moderate size for genus, up
to 124.6 mm long, thin-walled, elongate quadrate in
adults (height/length-ratio = 0.48-0.57; length>40 mm;
Figure 32), elongate ovate in juvenile (height/length-ratio =
0.49-0.76; length<40 mm), equivalve and inequilateral,
moderately inflated, sculptured only by fine growth lines.
K. Amano and S. Kiel, 2010
Page 159
Figures 14-2.3. Archivesica shikamai new species. All specimens are from Loe. 1. 14, 17, 22. Holotype, length 1 12.1 mm, JUE no.
15857. 14. Right-valve hinge, hinge length 59.4 mm. 17. Dorsal view. 22. Left valve. 15. Paratype, length 106.(1 mm, fUE no. 15879-1.
inner part of left valve, white arrows indicating the pallia! sinus. 18. Paratype, internal mold, length 76.5 mm, |UE no. 15879-4, left valve.
20. Paratype, internal mold, length 110.0 mm, |UE no. 15879-5, left valve, white arrows indicating pallial line and sinus. 21. Paratype,
length 99.9, JUE no. 15879-2, right valve. 16. Paratype of Akebiconclia kawamurai elongata , length 112.3 mm, NS11 4441.
19, 23. Archivesica kawamurai (Kuroda). 19. Holotype of Archivesica kawamurai , length 76.4 mm, NSMT-Mo no. 60915, left valve.
23. Holotype of Calijptogena solidissima Okutani, Hashimoto and Fujikura, length 128.5 mm, NSMT Mo-69675, right valve.
Page 160
THE NAUTILUS, Vol. 124, No. 4
Figures 24. Diagram showing height/length-ratios of
Archivesica kawamurai and A. shikamai new species
Beak prosogyrate, situated anteriorly at about one-fourth
of shell length. Antero-dorsal margin broadly arcuated,
graduating into narrowly rounded anterior margin; ventral
margin broadly arcuated; posterodorsal margin straight,
gently sloping, graduating into rounded posterior margin.
Escutcheon and lunule absent. Hinge plate with three
cardinal teeth in both valves. Right valve hinge: ante-
rior cardinal tooth (3a) very thin along dorsal margin;
posterior cardinal tooth (3b) oblique; central tooth
(1) rather thick, vertical to hinge base; subumbonal pit
narrow. Left valve hinge: anterior tooth (2a) thin, oblique
anteriorly, connected to stout middle tooth (2b); posterior
tooth (4b) thin, oblique posteriorly; subumbonal pit nar-
row and shallow behind posterior tooth. Nymph distinct,
occupying two-thirds of the posterodorsal margin. Ante-
rior adductor muscle scar pear-shaped; posterior one
ovate; deep groove observed just behind anterior adduc-
tor scar and just before posterior scar. Pallial line starts
near posteroventnil corner of anterior adductor scar, run-
ning mostly parallel to ventral shell margin, pallial sinus
varying from very shallow to shallow. Inner shell surface
finely and weekly crenulated.
Holotype: Length 124.6 mm, height 66.3 mm, JUE
no. 15880, left valve.
Paratype: Length 62.6 mm+, height 37.9 mm, JUE no.
15881-1, right valve; length 48.7 mm, height 28.1 mm,
JUE no. 15881-2, right valve; length 79.1 mm+, height
45.9 mm, |UE no. 15881-3, left valve; length 38.4 mm,
height 18.9 mm, fUE no. 15881-4, right valve; length
37.4 mm, height 20.9 mm, JUE no. 15881-5, right valve.
Type Locality: I km west to Matsudai, Tokamachi City,
Niigata Prefecture (Loc. E2 by Amano and Kanno, 2005).
Material Examined: Thirty-eight specimens from the
type locality (Loc. 3).
Remarks: Archivesica kannoi new species was
described or illustrated as Calyptogena nipponica or
C. cf. nipponica by Kanno (1993), Amano (1994) and
Amano and Kanno (2004). However, the hinge of
the type C. nipponica can partly be observed and
the condition of pallial line is unknown. Moreover, the
type material of Calyptogena nipponica was probably
destroyed during World War II. Thus, it is difficult to
compare this new species to C. nipponica.
Comparisons: Archivesica kannoi new species is most
similar to A. shiretokensis (Uozumi, 1967) from the
upper Miocene Rusha Formation in Hokkaido regarding
size and hinge structure. Archivesica kannoi differs from
A. shiretokensis by having a less concave ventral margin,
a vertical middle tooth in the right valve and a veiy
shallow pallial sinus. The Recent species, A. soyoae
(Okutani, 1957) can be distinguished from A. kannoi by
its slightly concave ventral margin, its slightly bifid pos-
terior tooth in the right valve, and its deeper pallial sinus.
Some specimens have a “broad” or secondary pallial line
running closer to the shell margin and roughly parallel to
the real pallial line except for the posterior area where it
does not form a pallial sinus but ends at the posterior
side of the posterior adductor scar (see Figure 31).
This “broad” or secondary pallial line can also be seen in
other large Archivesica species such as A. kawamurai
(see Figure 12 of the holotype of the latter species).
Distribution: Lower Pliocene part of the Kurokura
Formation in Niigata Prefecture.
Etymology: Named after the late Emeritus Prof.
Saburo Kanno (University of Tsukuba and Joetsu Uni-
versity of Education), a molluscan paleontologist, who
studied the vesicomyids from the Kurokura Formation.
Archivesica nipponica (Oinomikado and Kanehara, 1938)
Calyptogena nipponica Oinomikado and Kanehara, 1938: p.
677-678, pi. 21, figs. 1-5.
non Akebiconcha nipponica (Oinomikado and Kanehara);
Shikama and Masujima, 1969: pi. 7, figs. 16-19.
Type Material: The type material was deposited in
the Imperial Geological Survey of Japan, and was de-
stroyed according to Hatai and Nisiyanra (1952).
Remarks: Oinomikado and Kanehara (1938) described
Calyptogena nipponica from the lower Pliocene
“Ushigakubi bed” [= upper part of Araya Formation;
Kobayashi et ah, 1991] and from the cuttings of a well
dug into the upper Miocene? “Kubild Series”. Regarding
its size (holotype length 115.4 mm), outline, the three
strong, radiating cardinal teeth, and the narrow and shal-
low subumbonal pit in the right valve, this species is
similar to Archivesica soyoae and presumably belongs to
the genus Archivesica. The posterior cardinal tooth of
the right valve of Archivesica nipponica does not bend
towards the anterior, which precludes its placement
within Calyptogena . However, most inner features
K. Amano and S. Kiel, 2010
Page 161
Figures 25-31. Archivesica kannoi new species. All specimens are from Loe. 3. 25. Paratype, hinge length ol left valve 33.8 mm,
JUE no. 15881-3. 26, 27. Paratype, JUE no. 15881-1. 26. Right valve hinge, hinge length 24.0 mm. 27. Right valve, length 62.6
mm+. 28. Paratype, internal mold, length 38.4 mm, JUE no. 15881-4, left valve, white arrow indicating the very shallow pallial sinus.
29. Paratype, internal mold, length 48.7 mm, JUE no. 15881-2,
30. Holotype, internal mold, length 124.6 mm, JUE no. 15880, right
left valve, white arrow indicating the shallow pallial sinus.
except for the ill-preserved right valve hinge are
unknown. The type locality has been visited twice by the
senior author but new material ol Archivesica nipponica
was not found. Thus its characters and relationships to
other vesicomyids remain unclear.
Distribution: Upper Miocene? “Kubild Series” in Nii-
gata Prefecture; Lower Pliocene part of the Araya For-
mation in Niigata Prefecture.
Archivesica shiretokensis (Uozumi, 1967)
right valve, white arrow indicating the very shallow pallial sinus,
/alve. 31. Paratype, internal mold, length 37.4 mm, JUE no. 15881-5,
“Calyptogena” shiretokensis Uozumi in Uozumi and Ishikawa,
1967: p. 44, fig. 3
Archivesica shiretokensis (Uozumi). — Amano and Suzuki,
2010: 165-171, fig. 2 A-J.
Holotype: Type specimens were assigned and illus-
trated by Uozumi (1967) but their repository is
unknown.
Remarks: Recently Amano and Suzuki (2010) col-
lected topotype specimens and redescribed Archivesica
nipponica in detail.
Page 162
THE NAUTILUS, Vol. 124, No. 4
0.8 1 1 ' -L ■ ^ 1 1-‘ — 1 1 ‘
0. 75
o 0. 7 •
ca *•
sz 0. 65
s?
<1)
<0.6
"m •
• • O
CD •
=*= 0. 55
• •
0.5
0.45 — t I , , , , ,
0 20 40 60 80 100 120 140
Length (mm)
Figure 32. Relationship between shell length and the
height/length ratio of Archivesica kannoi new species.
Distribution: Upper Miocene Rusha Formation in
Hokkaido.
Archivesica sp.
Calijptogena sp. Nobuhara and Takatori, 1999: 145, Pi. 1,
figs. .5-10.
Specimens: ESN nos. 2695-2700.
Remarks: This species has a large shell exceeding
130 mm in length, a posteriorly oblique posterior tooth
(3b) in the right valve on which a distinct groove can be
recognized, and a deep subumbonal pit. As Nobuhara
and Takatori (1999) pointed out, these features are rec-
ognized in A. soijoae and A. okutanii (Kojima and Ohta,
1997). However, due to the poor preservation of the
sixteen specimens collected and illustrated by Nobuhara
and Takatori (1999), a species-level identification is cur-
rently not possible.
Distribution: Pliocene Horinouchi Formation in
Shizuoka Prefecture.
P Archivesica bosoensis (Kanie and Kuramochi, 2001)
Calijptogena sp. Majima et ah, 1992: p. 373-376, figs. 3.1-3. 3.
Calijptogena ( Ectenagena ) sp. Kanie et al., 1997: p. 794-795,
figs. 2.1a-e.
Calijptogena bosoensis Kanie and Kuramochi, 2001: p. 6-8,
figs. 3. 1-3.2, 4Cb.
Holotype: YCM-GP no. 1143.
Paratype: YCM-GP no. 1144.
Remarks: P Archivesica bosoensis reaches 235 mm in
length, which is close to the maximum size of
Archivesica. Kanie and Kuramochi (2001) pointed out
that PA. bosoensis is veiy similar in shape to the Recent
A. similaris Okutani, Kojima, and Ashi, 1997, except for
its much larger size. Another species that is similar in
shape and size is the Recent “ Calijptogena” garuda from
2064 to 2137 m depth off Java, Indonesia (Okutani
and Soh, 2005). Judging from its size and outline,
PArchivesica bosoensis probably belongs to the genus
Archivesica , but this assessment has to remain tentative
until better preserved material becomes available.
Distribution: Pliocene Shiramazu Formation in
Chiba Prefecture.
DISCUSSION
The genus Archivesica first appeared in Japan in the late
Miocene with two species; an additional four species
appear in the Pliocene (Table 1, Figure 33). Today, eight
species and one subspecies of Archivesica are living
around the Japanese Islands (Sasaki et al., 2005; Okutani
et al., 2009). On the northern and eastern side of the
Pacific Archivesica has a much longer fossil record, rang-
ing back to the middle Eocene of Washington State and
the Oligocene of Alaska (Amano and Kiel, 2007; Kiel and
Amano, 2010). But these Paleogene species are much
smaller (max. 48 mm) than those reported here from
the Japanese Neogene (112 to 235 mm) and most have a
lunular incision, a feature not seen in the large Neogene
species of Archivesica. The large vesicomyids known
Table 1. Age and characteristics of fossil Archivesica species in Japan. Position ot umbo is expressed as percentage along shell
length from anterior end.
K. Amano and S. Kiel, 2010
Page 163
Figure 33. Distribution of fossil Archivesica in Japan.
A. shiretokensis : late Miocene; A. nipponica : late Miocene to
early Pliocene; A. kannoi : early Pliocene; A. shikamai: Plio-
cene; A. sp.: Pliocene; PA. bosoensis: Pliocene; A. kawamurai :
Pliocene to Recent.
from Cenozoie seep deposits in the Caribbean region
(Gill et al., 2005; Kiel, 2007; Kiel and Peckmann, 2007)
are of the elongate type around the genus Adulomya.
The earliest record of a “large Archivesica ” from the
American Pacific coast is A. g ihbera from the early
Pliocene of California (Criekmay, 1929; Squires, 1991).
This pattern of occurrence suggests that the “large
Archivesica” originated in the western Pacific sometime
during the middle/late Miocene and subsequently
spread eastward to North America. However, because
no vesicomyids have been reported so far from the late
Miocene of western North America, this scenario
remains tentative. Interesting in the context of the
dispersal history of the “large Archivesica ” in the Pacific
are the “large vesicomyids” recently reported from lower
Pliocene cold seep deposits in the eastern central
Philippines (Majima et al. 2007), because of the simi-
larities between the Pliocene Japanese P Archivesica
bosoensis and the modern Indonesian A. g arucla.
The diversification history of the Neogene “large
Archivesica ” in Japan is in an interesting contrast to the
evolutionary history of the large, elongate vesieomyid
genus Adulomya. Adulomya first appeared in Japan in
the early Miocene, it was present with five species during
the early and middle Miocene, and experienced a steep
decline in diversity through the late Miocene and Plio-
cene (Amano and Kiel, in press). This decline in diversity
might relate to the rise of the “large Archivesica ” from
the late Miocene onward. Different again is the history
of Cahjptogena in Japan, which first appeared with one
species in the late Miocene (Kanno et ah, 1989) and
maintained a low diversity until today (Sasaki et al.,
2005; Okutani et al., 2009).
Both fossil and Recent records of Archivesica
kawamurai are confined to the accretionary prism on
the Pacific side of southwestern Honshu, an area with
many eold-seep sites (Fujioka and Taira, 1989; Kojima,
2002), indicating that A. kawamurai has not changed its
area of distribution since the Pliocene. Such distribution
pattern might relate to stable environmental conditions
in this area: the basic tectonic framework of Japan has
not changed from the late Miocene to the Recent (e.g.
Iijirna and Tada, 1990) probably resulting in constant
methane seepage along the accretionary prism off south-
western Honshu.
ACKNOWLEDGMENTS
We thank Takami Nobuhara (Shizuoka University),
Akihiko Suzuki (Hokkaido University of Education),
Tomoki Kase (National Science Museum, Tokyo) and
Hiroshi Saito (National Science Museum, Tokyo) for
their help in examining some recent and fossil spec-
imens. We also thank Richard L. Squires (California
State University) and an anonymous reviewer for their
critical reading of the manuscript and their useful
suggestions. This study was partly supported by a Grant-
in-aid for Scientific Research from the Japan Society for
Promotion of Science (C, 20540456, 2008-2010).
LITERATURE CITED
Amano, K. 1994. Pliocene molluscan fauna and its environment
in Matsunoyama-machi, Niigata Prefecture. Journal of
Geography 103: 653-673. [in Japanese with English
abstract]
Amano, K. 2003. Predatory gastropod drill holes in Upper
Miocene cold seep bivalves, Hokkaido, Japan. The Veliger
46: 90-96.
Amano, K. and S. Kanno. 2005. Cahjptogena (Bivalvia:
Vesicomyidae) from Neogene strata in the Joetsu District,
Niigata Prefecture, central Japan. The Veliger 47: 202-212.
Amano, K and S. Kiel. 2007. Fossil vesieomyid bivalves from
the North Pacific region. The Veliger 49: 270-293.
Amano, K and S. Kiel, in press. Fossil Adulomya
(Vesicomyidae, Bivalvia) from Japan. The Veliger 51.
Amano, K. and A. Suzuki. 2010. Redescription of “Cahjptogena”
shiretokensis Uozumi (Bivalvia: Vesicomyidae) from the
Miocene Rusha Formation on the Shiretoko Peninsula,
eastern Hokkaido. Japan. Venus 68: 165-171.
Criekmay, C.H. 1929. On a new pelecypod Cahjptogena
gibbera. The Canadian Field-Naturalist 43: 93.
Dali, W. IP 1891. Scientific results of explorations by the U.S.
Fish Commission Steamer Albatross. XX. On some new
or interesting West American shells obtained from dredg-
ings of the U.S. fish commission steamer Albatross in 1888.
Proceedings of the U.S. National Museum 14: 174-191.
Page 164
THE NAUTILUS, Vol. 124, No. 4
Dali, W. H. 1896. Diagnoses of new species of mollusks from
the west coast of America. Proceedings of the U.S.
National Museum of Natural History 18: 7-20.
Dali, W. H. 1908. Reports on the dredging operations off the
west coast of Central America . . . The Mollusca and
Brachiopoda. Bulletin of the Museum of Comparative
Zoology at Harvard University 43: 205-487.
Dali, W. II and C.T. Simpson. 1901. The Mollusca of Porto
Rico. Bulletin of the United States, Fish and Fisheries
Commission 20: 351-524.
Fujioka, K. and A. Taira. 1989. Tectono-sedimentary settings
of seep biological communities. A synthesis from the
Japanese subduction zone. In: Taira, A. and F. Masuda
( eels . ) . Sedimentary facies in the active plate margin.
Terrapub, Tokyo, 577-602.
Gill, F.L., I.C. Harding, C.T.S. Little, and J.A. Todd
2005. Palaeogene and Neogene cold seep communities
in Barbados, Trinidad and Venezuela: An overview.
Palaeogeography, Palaeoelimatology, Palaeoeeology 227:
191-209.
Habe, T. 1951. Genera of Japanese Shells, no. 2. Kairui Bunken
Kanko Kai, Kyoto: 97-186. [in Japanese]
Habe, T. 1961. Colored Illustration of the Shells of Japan (II).
Hoikusha, Osaka, xii+183 pp. [in Japanese]
Habe, T. 1977. Systematies of Mollusca in Japan. Bivalvia and
Scaphopoda. Zukan-no-Hokuryukan, Tokyo, 372 pp. [in
Japanese]
Hachiya, II. 1904. Geology of the Iwaki Volcano. Report of the
Imperial Earthquake Investigation Committee 48: 1-51.
[in Japanese]
Hatai, K. and S. Nisiyama. 1952. Check list of Japanese Tertiary
marine Mollusca. Science Report of the Tohoku Univer-
sity, Special Volume 3: 1—464.
Horikoshi, M. 1989. Deep-sea giant white clams, Cah/ptogena
s.L, found in the hot-vent and eold-seep sites. Venus, Sup-
plement 1: 59-74. [in Japanese with English abstract]
Iijima, A. and Tada, R., 1990: Evolution of Tertiary sedimentary
basins of Japan in reference to opening of the Japan Sea.
Journal of the Faculty of Science, the University of Tokyo,
Section 2 22: 121-171.
Kanie, Y., and T. Kuramochi. 2001. Two new species of the
Vesieomyidae (Bivalvia: Mollusca) from the Pliocene
Shiramazu Formation of the Chikura Group in the Boso
Peninsula, Japan. Science Reports of the Yokosuka City
Museum 48: 1-9. [in English with Japanese abstract]
Kanie, Y., M. Ilattori, T. Kuramochi, H. Okada, T. Ohba, and
C. Honma. 1997. Two vesicomyid Bivalvia from the
Shiramazu Formation of the Chikura group in the south-
ernmost part of the Boso Peninsula. Journal of the Geo-
logical Society of Japan 103: 794-797. [in Japanese]
Kanno, S. 1990. On the fossil “Calyptogena” from the Ikego
area loaned to US Army. In: Taira, A. (ed.). Report of the
fossil "Calyptogena" . Yokohama Defense Facilities
Administration Bureau, Yokohama: 91-106. [in Japanese,
title translated]
Kanno, S. 1991. On the fossil “Cah/ptogena" from the vicinity
of Zushi City. In: Horikoshi, M. (ed.). Report o( the fossil
“Cah/ptogena" in Ikego, Zushi City. Education Board of
Zushi City: 60-69. [in Japanese, title translated]
Kanno, S. 1993. On the fossils of “Cah/ptogena" from Ikego
(2"cl Report). In: Hasegawa, Y. (ed.). Last report of the
fossil “Cah/ptogena" from Ikego. Yokohama Defense
Facilities Administration Bureau, Yokohama: 123-162. [in
Japanese, title translated]
Kanno, S., K. Amano, and H. Ban. 1989. Calyptogena
( Calyptogena ) pacifica Dali (Bivalvia) from the Neogene
system in the Joetsu district, Niigata prefecture. Transac-
tions and Proceedings of the Palaeontological Society of
Japan, New Series 153: 25-35.
Keen, M. 1969. Family Vesieomyidae. In: C. Moore (ed.) Trea-
tise on Invertebrate Paleontology, Part N, vol. 2 (of 3).
University of Kansas and Geological Society of America,
Lawrence: N663-664.
Kiel, S. 2007. Status of the enigmatic fossil vesicomyid
bivalve Pleurophopsis . Acta Palaeontologica Poloniea 52:
639-642.
Kiel, S. and K. Amano. 2010. Oligocene and Miocene
vesicomyid bivalves from die Katalla district in southern
Alaska, USA. The Veliger 51: 76-84.
Kiel, S. and J. Peckmann 2007. Chemosymbiotic bivalves and
stable carbon isotopes indicate hydrocarbon seepage at four
unusual Cenozoie Fossil localities. Lethaia 40: 345-357.
Kobayashi, I., M. Tateishi, T. Yoshioka, and M. Shimazu.
1991. Geology of the Nagaoka District. Geological Survey
of Japan, Tsukuba, 132 pp. [in Japanese with English
abstract]
Kojima, S. 2002. Deep-sea chemoautosynthesis-based commu-
nities in the Northwestern Pacific. Journal of Oceanogra-
phy 58: 343-363.
Kojima, S. and Ohta, S. 1997. Calyptogena okutanii n. sp., a
sibling species of Calyptogena sot/oae Okutani, 1957
(Bivalvia: Vesieomyidae). Venus 56: 189-195.
Kojima, S., E. Tsuchida, PI. Numanami, K. Fujikura and
T. Okutani 2006. Synonymy of Calyptogena solidissima
with Calyptogena kawamurai (Bivalvia: Vesieomyidae)
and its population structure revealed by mitochondria
DNA sequences. Zoological Science 23: 835-842.
Kuroda, T. 1931. Fossil Mollusca. In: Honnna, F. (ed.) Geology
of the central part of Shinano, part 4. Kokin Shoin, Tokyo,
90 pp. [in Japanese]
Kuroda, T. 1943. Akebiconcha, a new peleeypod genus. Venus
13: 14-18. [in Japanese with English description]
Majima, R., S. Imai, R. Uehimura, S. Kida, and M. Hayakawa.
1990. Finding of Cah/ptogena sp. (Bivalvia) from the Late
Pliocene Hijikata Formation, Kakegawa City, Shizuoka
Prefecture, central Japan. Journal of the Geological Soci-
ety of Japan 96: 553-556. [in Japanese]
Majima, R., T. Kase, S. Kawagata, Y.M. Aguilar, K. Hagino
and M. Maeda. 2007. Fossil cold-seep assemblages from
Leyte Island, Philippines. Journal of Geography 116:
643-652. [in Japanese with English abstract]
Majima, R., T. Nobuhara, and T. Kitazald. 2005. Review of fossil
chemosynthetie assemblages in Japan. Palaeogeography,
Palaeoelimatology, Palaeoeeology 227: 86-123.
Majima, R., S. Tanase, R. Uehimura, and T. Honme. 1992.
Finding of Cah/ptogena sp. (Bivalvia) from the Neogene
of the southern end of the Boso Peninsula, central Japan.
Journal of the Geological Society of Japan 98: 373-376. [in
Japanese with English abstract]
Matsushima, Y., K. Taguchi, and K. Chinzei. 2003. Molluscan
fossils from the Ochiai Formation, the Tanzawa Moun-
tains, central Japan. Bulletin of the Kanagawa Prefecture
Museum, Natural Science 32: 27-68. [in Japanese with
English abstract]
Nobuhara, T. 2003. Cold see carbonate mounds with Vesicomya
( Cali/ptogena ) kawamurai (Bivalvia: Vesieomyidae) in slope-
mud facies of the Pliocene forearc basin of Sagara-Kakegawa
area, central Japan. Paleontological Research 7: 313-328.
K. Amano and S. Kiel, 2010
Page 165
Nobuhara, T. and R. Takatori. 1999. Occurrence of
Colyptogena sp. (Bivalvia: Vesicomyidae) from the Plio-
cene Horinouchi Formation, Shizuoka Prefecture, central
Japan. Journal of the Geological Society of Japan 105:
140-150. [in Japanese with English abstract]
Nobuhara, T. and Tanaka, 1993. Paleoecology of Akebiconclia
kawamurai (Bivalvia: Vesicomyidae) from the Pliocene
Tamari Silt Formation in the Kakegawa area, central
Japan. Palaeogeography, Palaeoclimatology, Palaeoecology
102:27-40.
Noda, H. 1980. Mollusean fossils from the Ryukyu Islands,
southwestern Japan: Part 1. Gastropoda and Peleeypoda
from the Shinzato Formation in southeastern part of
Okinawa-jima. Science Report of the Institute of Geosci-
ence, University of Tsukuba, Section B. 1: 1-95.
Nomura, S. 1935. Miocene Mollusca from the Nishi-Tsugaru
District, Aomori-Ken, Northeast Honshu, Japan. Saito
Ho-on Kai Museum, Research Bulletin 6: 19-74.
Oinomikado, T. and K. Kanehara. 1938. A new species of
Cah/ptogena from the Higashiyama Oil Field, Niigata-
Ken, Japan. Journal of the Geological Society of Japan 45:
677-678.
Okutani, T. 1966. Identify of Cah/ptogena and Akebiconcha
(Bivalvia, Cyprinidae). Venus 24: 297-303. [in Japanese
with English summary]
Okutani, T. 2000. Vesicomyidae. In: Okutani, T. (ed.) Marine
molluscs in Japan. Tokai University Press, Tokyo: 996-999.
[in Japanese and English]
Okutani, T., J. Hashimoto, and K. Fujikura. 1992. A new
species of vesicomyid bivalve associated with hydrothermal
vents near Amami-Oshima Island, Japan. Venus 51:
225-233.
Okutani, T. T. Koshi-ishi, T. Sato, T. Imai, and C. Kato. 2009.
Vesicomyid fauna in the Chishima (Kurile) Trench:
Occurrences of a new taxon and Cah/ptogena extenta.
Venus 68: 15-25.
Okutani, T. and W. Sob. 2005. Cah/ptogena ( Arcliivesica )
gamda , a magnificent new species of vesicomyid bivalve
from the Java Trench, Indonesia. Venus 64: 23-29.
Olsson, A. A. 1931. Contributions to the Tertiary paleontology
of northern Peru. Part 4. The Peruvian Oligocene. Bulle-
tins of American Paleontology 17: 97-264.
Ozaki, H. 1958. Stratigraphical and paleontological studies
on the Neogene and Pleistocene formations of the Tyosi
district. Bulletin of the National Science Museum, New
Series 4: 1-182.
Sasaki, T., T. Okutani, and K. Fujikura. 2005. Molluscs
from hydrothermal vents and cold seeps in Japan: A review
of taxa recorded in twenty recent years (1984—2004). Venus
64: 87-133.
Shikama, T. 1962. On some noteworthy shells from off Choshi,
Chiba Prefecture. Science Reports of the Yokohama
National University 8: 29-56.
Shikama, T. and A. Masujima. 1969. Quantitative studies of the
mollusean assemblages in the Ikego-Nojinra formations.
Science Reports of the Yokohama National University
15: 61-94.
Squires, R.L. 1991. New morphologic and stratigraphic infor-
mation on Cah/ptogena ( Cah/ptogena ) gibbera Criekmay,
1929, (Bivalvia: Vesicomyidae), from the Pliocene and
Pleistocene of southern California. The Veliger 34: 73-77.
Takeda, H. 1953. The Poronai Formation (Oligocene Tertiary)
of Hokkaido and South Sakhalin and its fossil fauna. Stud-
ies on Coal Geology, the Hokkaido Association of Coal
Mining Technologists 3: 1-103.
Tsuchida, E. 1986. Akebiconcha kawamurai collected from Off
Kii Channel. Chiribotan 17: 29-31. [in Japanese]
Uozumi, S. and Ishikawa, T. 1967. Fossils from Shiretoko Pen-
insula. In: Education Board of Hokkaido (ed.) Cultural
properties in Hokkaido 9, Shiretoko Peninsula, pp. 43-44,
Education Board of Hokkaido, Sapporo, [in Japanese, title
translated]
THE NAUTILUS 124(4): 166-174, 2010
Page 166
Descriptions and illustrations of some new and poorly known
turrids of the tropical northwestern Atlantic. Part 1. Genera
Buchema Corea, 1934 and Miraclathurella Woodring, 1928
(Gastropoda: Turridae: Crassispirinae)
Phillip J. Fallon, Jr.
77 Cedar Drive
Farmingdale, NY 1 1735 USA
[email protected]
ABSTRACT
Descriptions and illustrations are presented for four small, less
than 12 mm in length, crassispirine turrids from the southeast-
ern Caribbean, three in the genus Buchema Corea, 1934 and
one in Miraclathurella Woodring, 1928. One of the three
Buchema is described for the first time. The other two,
Buchema bellula (E.A. Smith, 1882) and Buchema primula
(Melvill, 1923), are redescribed because they are relatively
unknown, and lack published photographs and adequate de-
scription. Their identification is compounded by the existence
of a hitherto undescribed small Buchema that is similar in
appearance, Buchema nigra new species, and by similar
looking small Crassispira in the subgenus Monilispira Bartseh
and Rehder, 1939 that will be addressed in a later paper. The
fourth small crassispirine, Miraclathurella peggy will iamsae
new species, is only the second known member presently
placed in this genus in the tropical northwestern Atlantic. Var-
iation in form of the four species is described.
Additional keywords: Taxonomy, systematic^, new species, gas-
tropods, Neogastropoda, western Atlantic
INTRODUCTION
Tl lis is the first in a series of papers covering small
crassispirine turrids. Turrids are among the least under-
stood of the tropical northwestern Atlantic (TNWA) mol-
lusks for a number of reasons. They are very speciose,
small, scarce, and for some, incompletely described by
their original authors. Relative inaccessibility of types,
such as those deposited in the British Museum of Natu-
ral History, has contributed to their anonymity. The focus
of this part of the series is primarily on the genus
Buchema Corea, 1934, most of whose members are
poorly known. Scarce reports of Buchema in the litera-
ture offer little additional new descriptive or biogeo-
graphic information beyond what is given in the original
descriptions. Reports in which Buchema have appeared
include surveys (Altena, 1975; Olsson and McGinty,
1958; Ekdale, 1974; Absalao et ah, 2005), and identifica-
tion guides (Warmke and Abbott, 1961; Abbott, 1974;
Rios, 1975, 1985, 1994, 2009; Humfrey, 1975; Kaicher,
1984; Diaz and Puyana, 1994; Williams, 2005, 2006,
2009). Maes (1983) published new information about
Buchema interstrigata (E.A. Smith, 1882), for a popula-
tion in a shallow water community at White Island, Brit-
ish Virgin Islands, and described differences between
this species and Buchema interpleura (Dali and Simpson,
1901). These two larger, better known species are not
treated in this work. Instead two smaller, little known
ones, Buchema bellula (E.A. Smith, 1882) and Buchema
primula (Melvill, 1923), are re-described. Buchema
bellula was collected as early as 1964 (based on data
labels of specimens at the Academy of Natural Science
of Philadelphia). More recently, it has been found by
diver-collectors multiple times, and sufficient material
has become available to improve its description, describe
its variability, and better illustrate the species. Buchema
primula is very close in appearance to B. bellula and
similar to another small species described here for the
first time, Buchema nigra new species. These two species,
B. primula and B. nigra , have also been found in multiple
locations by different explorers. Another two, very similar
but as yet undescribed Buchema, will be mentioned and
illustrated, although not fully described because of insuf-
ficient specimens. The species treated here share impor-
tant characteristics of the genus Buchema, in addition
to the characteristics of the subfamily. Discussing them
together here will better illustrate these shared character-
istics but also their individual uniqueness.
The last species described in this paper, a Recent
species, is a member of the genus-group Miraclathu rella
Woodring, 1928, which was erected for fossil species
from the Bowden Formation of Jamaica. It is similar in
some basic sculptural elements and overall appearance
to small Buchema, so is included here for comparison
purposes. It has also been taken from several different
localities to allow a fair picture of its variability and
distribution.
P.J. Fallon, Jr., 2010
Page 167
Species are treated systematically, including known
synonyms, description, range, distinguishing characteris-
tics, and variability.
MATERIALS AND METHODS
The literature of TNWA crassispirines was reviewed for
descriptions, synonymy, and reported occurrences. A list
of reported localities was developed for previously
described species using published sources and data slips
ol museum lots.
Specimens for study were acquired from personal
sampling trips, private collections, and from commercial
dealers. In all cases, only the shell is used for identifica-
tion and descriptive purposes. To supplement personally
acquired material, museums lots were examined to gain
a better understanding of a species variability and to
identify characters that are consistent within and best
distinguish it from other species. Collections in the
National Museum of Natural History (USNM), Wash-
ington DC, and the Academy of Natural Science of
Philadelphia (ANSP) were examined. Specimens of pre-
viously described species were compared to type mate-
rial located at the British Museum of Natural History
(BMNH).
Measurements of overall shell dimensions were taken
to the nearest 0.1 mm employing an ocular micro-
meter mounted in a Bauseli & Lomb stereo binocular
dissecting microscope. Photographs of all species were
taken employing a stand-mounted Nikon® D-90 digital
camera with an AF-S VR Micro-Nikkor 105 mm f/2.8G
macro lens fitted with one or more extension tubes (12,
20, or 36 mm) to obtain the largest image. Light was
provided by the Nikon close-up remote kit with dual
remote speedlights attached to a front-mounted ring.
Individual specimen photos were cropped and sized
appropriately for the plates using Adobe® Photoshop R
CS2 computer software.
Types and voucher specimens originally in the posses-
sion of the author have been deposited in the ANSP,
The Bailey Matthews Shell Museum (BMSM), Florida
Museum of Natural History (FLMNH), and USNM.
Catalog numbers are given in the text. A few paratypes
remain in private collections for deposition elsewhere at
a later time. Saint Vincent and the Grenadines is herein
abbreviated SVG.
SYSTEMATICS
Subfamily Crassispirinae McLean, 1971
Remarks: The characteristics common to members of
this subfamily are the presence of a well developed pari-
etal callus adjoining the anal sinus, a subsutural cord,
sulcus with microscopic growth lines and occasionally
with one or two spiral threads, a smooth protoconch with
fine axials on about the last 0.25—0.5 whorl, and a
teleoconeh sculptured with axial ribs and spiral cords
(McLean, 1971: 119). These characteristics are all pre-
sent to a greater or lesser degree in genera within this
large subfamily.
Genus Buchema Corea, f 934
Type Species: Buchema tainoa Corea, 1934, by origi-
nal designation
Remarks: Corea (1934: 1-2) erected Buchema for
Carinodrillia- like species that, among other differences,
lacked a median carina on the nuclear whorls, had strong
axial ribs with overriding heavy spiral cords, and with
fine threads between the cords. In addition, she stated
that Buchema have hair-like incremental lines that create
a “cloth-like pattern, while their junction sometimes
almost appears granulose.” Not all species placed by
subsequent workers in the genus have the spiral threads
between cords, or visible growth lines, but the other
characteristics are found consistently in the group mem-
bers. The small Buchema are similar in appearance
to the Crassispira subgenus Monilispira Bartsch and
Rehder, 1939. They differ from the Monilispira in
lacking beaded spiral cords on the whorl periphery and
shell base. Plain cords, or cords with swellings on rib
crests, not rounded beads, are present instead. Another
distinguishing characteristic, although not unique to
Buchema, is the location of the subsutural cord, which
is usually very near the suture, not positioned well into
the sulcus as in some of the other subgenera within
Crassispira.
Buchema hellula (E.A. Smith, 1882)
(Figures 1-8)
Pleurotoma (Clams) bellula E.A. Smith, 1882: 209-210.
Pleurotoma bellula E.A. Smith, 1882: Paetel (1888).
Drillia (Clams) bellula (E.A. Smith, 1882): Tryon (1884: 191).
Buchema bellula (E.A. Smith, 1882): Maes (unpublished, from
specimen labels ANSP 299773 and ANSP 297289, dated
9 Oct 1981); Williams (2006, 2009: number 3007, left,
photographs of holotype only).
Not Buchema bellula (E.A. Smith, 1882): Williams (2005:
number 3007, both photographs); Williams (2006, 2009:
number 3007, right, 2 photographs only).
Sedilia melanacme (E.A. Smith, 1882): Fallon (2008: 12, 13,
figs. 25a, b) (non E.A. Smith, 1882.)
Description: Shell 8.5 x 3.4 mm (holotype), fusiform,
anterior portion truncated, consisting of ~8 whorls; color
a faded pale yellow, except for the primary and sec-
ondary spiral cords, which are white to dingy white
(Figure 1). Protoconch light brown, of 2 smooth whorls,
bulbous but not wider than the first teleoconeh whorl;
tip partially immersed so that the first whorl is slightly
tilted relative to the shell axis. Although not visible in the
holotype because of wear, younger, less worn specimens,
have fine axial riblets on the last 0.5 whorl (Figure 3).
Teleoconeh of ~6 whorls, whorls 4 and 5 with 7 primary
and secondary cords: a subsutural cord, 3 secondary spi-
ral cords in the sulcus, 2 primary cords on the whorls’
Page 168
THE NAUTILUS, Vol. 124, No. 4
Figures 1 — 18. Buchema species. 1 — 8. Buchema bellula (E.A. Smith, 1882), 1. Holotype BM(NH) 1964223, St. Vincent, West
Indies, 8.5 x 3.4 mm. Photo digitally enhanced (contrast and brightness) to show color pattern. 2. ANSP 424360, Clifton Harbor,
Union I., SVG, 8.1 x 3.4 mm. 3. Same specimen as 2, enlarged views of protoconch. 4. ANSP 424359, Corbec Bay, Canouan 1., SVG,
8.9 x 3.6 mm. 5. ANSP 355800, Grenada, 5.9 x 2.4 mm. 6. ANSP 296638, E side of Prickly Pt., SW Grenada, 7.5 mm. 7. ANSP
297289, mouth of St. George Harbor, W Grenada, 7.8 x 3.0 mm. 8. USNM 1139712, Clifton Harbor, Union I., SVG, 8.9 x 3.5 mm.
9. Buchema melanacme (E.A. Smith, 1882), holotype BM(NIl) 1998116, St. Vincent, West Indies, 8.5 x 3.3 mm. 10. Buchema aff.
bellula (E.A. Smith, 1882), author’s collection, Calliaqua Bay, St. Vincent I., SVG, 9.2 x 3.5 mm. 11 — 14. Buchema primula (Melvill,
1923), 11. Holotype BM(NPI) 1982080, Cuba, 6.3 x 2.7 mm. Digitally enhanced as Figure 1. 12. USNM 1139713, Annas Shoal,
Grenada, 7.0 x 3.0 mm. 13. ANSP 424362, E side of Prickly Pt., SW Grenada, 5.9 mm. 14. Same specimen as 12, enlarged views
of the protoconch. Figures 15—17. Buchema nigra, new species. 15. Holotype USNM 1139714, Petit Nevis, SVG, 8.2 x 3.0 mm.
16. Paratype, Peggy Williams coll., Man of War Bay, Tobago 1., Trinidad and Tobago, 7.2 x 2.7 mm. 17. Paratype ANSP 424361,
Annas Shoal, Grenada, 8.1 x 3.0 mm. 18. Buchema aff. nigra, author’s collection, oil Arraial do Cabo, Bio de Janeiro state, Brazil,
10.0 x 3.8 mm (missing protoconch).
P.J. Fallon, Jr., 2010
Page 169
periphery swollen at rib crests and appearing as rows of
elongate beads, and 1 secondary cord below. Body whorl
has an additional 4 secondary spiral cords on the shell
base, and 4 more that encircle the anterior canal. Tightly
packed spiral threads, ~3-10 in number, lie between the
cords, the greater number between the cords of the body
whorl where they are spaced further apart; 2 threads lie
between the edge of the suture and subsutural cord on
later whorls. Sulcus flat; sculpture as stated before with
secondary spiral cords and threads; growth striae not
readily evident, but faint where seen. Ribs number 10
on the penultimate and 8 to the varix on the body whorl,
veiy short, only obvious at the whorl periphery, reduced
to slight swellings above and below the peripheral cords.
Aperture widest medially; anal sinus deep and rounded
posteriorly, but not constricted at the entrance, or only
very slightly so in mature specimens. Varix a distinct
hump behind the anal sinus; outer lip thin with 2 irregu-
lar narrow axials near its edge, and scalloped by the ends
of spiral cords; with a shallow stromboid notch. Inner lip
thin, lies along the columella and parietal wall; a callus at
its junction with the outer lip forms the parietal wall side
of the anal sinus.
Type: Holotype BM(NH) 1964223.
Type locality: St. Vincent, West Indies.
Other Material Examined: Four spec., worn, at 30 ft
[9.1 m] on sand, shell and coral, 1/8 mi [0.2 km] W of Ft.
George, St. George, Grenada, (ANSP 296915); 3 spec.,
5.7, 7.5, and 8.2 mm (broken tip), at 0-0.9 m, in
Thalassia, sand coral rock, E side of Prickly Pt., SW
Grenada, coll, by R. Ostheimer, Jan-Feb 1964 (ANSP
296638); 1 spec., 5.9 x 2.4 mm, Grenada, coll, by
Cosman (ANSP 355800); 1 spec., 7.8 x 3.0 mm, at 7.3-
11.0 m, trash, coral rubble, mud, mouth of St. George
Harbor, W. Grenada (ANSP 297289); 1 spec., 2.6 mm
juvenile, at 7.3 m, in sand, fine grass, 500 yds [457 m]
off fish market, W of St. George, Grenada, coll, by
R. Ostheimer, 12 Feb 1964 (ANSP 299787); 1 spec.,
4.6 mm juvenile, at 3.7 m, in sand, mud, coral rubble,
lagoon channel, St. George Harbor, Grenada, coll, by
R. Ostheimer, 8 Jan 1964 (ANSP 297412); I spec., 7.9 x
3.0 mm, at 12.2-15.2 m, Carriacou 1., Grenada, coll, by
T. McCleery May 2004 (author’s coll.); 6 spec., 8.7 x 3.5,
9.0 x 3.7 (both USNM 1139710), 8.6 x 3.3 (BMSM
17964), 6.7 x 2.9, 6.2 x 2,5 (both UF 441321), and
8.9 x 3.6 mm (ANSP 424359), at 7.6 m, on rock and
sand, Corbec Bay, Canouan I., SVG, coll, by G. Mackin-
tosh 8, 9 Jun 2004; 15 spec., 8.1 x 3.4 (ANSP 424360),
8.3 x 3,5, 6.7 x 2.8 (both USNM 1139711), 8.8 x 3.6,
6,5 x 2.8 (both UF 441320), 6,5 x 2.9, 5.9 x 2.7 (both
BMSM 17965), 6.1 x 2.6, 5.7 x 2,5 (both P. Williams
coll.), 6.7 x 2.9, 6.1 x 2.6, 7.8 x 3.2, 8.8 x 3.7, 6,3 x
2.7 and 7.8 x 3,5 mm (missing protoconch, anthor’s
coll.), at 10.7 m, Clifton Harbor, Union I., SVG, coll, by
G. Mackintosh 30 May 2004; 7 spec. 9.9 x 4.0, 9.2 x 3.5,
9.3 x 3.9, 9.6 x 3.8, 8.2 x 3,5 (broken apex), 6.0 x 2.4,
and 5.8 x 2,5 mm, at 10.7 m, Chatham Bay, Union I.,
SVG, coll, by G. Mackintosh, 8 Apr 2007 (author’s coll.);
1 spec., 11.1 x 4.5 mm, at 8 m, Green I., Grenada, coll,
by G. Mackintosh, 1 Nov 2003 (author’s coll.); 1 spec.,
7.4 x 2.9 mm, at 10.7 m. Saline I., Grenada, coll, by
G. Mackintosh, 1 Feb 1997 (author’s coll.); and 1 spec.,
8.9 x 3.5 mm (USNM 1139712), and 207 others, inter-
tidal, crabbed, Clifton Harbor, Union I., SVG, coll by
P. Fallon, 16 Jun 2007 (author’s collection).
Distribution: SVG (Canouan I., Union I.) and Gre-
nada (Grenada I., Carriacou I., Green I., Saline I.).
Remarks: This species clearly has the characteristics
of Buchema , with heavy spiral cords overriding the ribs
and spiral threads in between. It is virtually unknown
because the original description by Smith in 1882 was
not illustrated, and until now this remained the only de-
scription of the species. Virginia O. Maes identified sev-
eral lots in the ANSP collected in Grenada as this
species, and she was likely the first to place it in the
genus Buchema , (unpublished, based on information
from specimen labels ANSP 299773 and ANSP 297289,
dated 9 Oct 1981). Williams (2006: number 3007) was
the first to publish a photograph of the holotype.
The largest specimen examined had a length of
11.1 mm. Color seems to vary among local populations;
shallow water specimens taken on Union I., SVG, are
brown (Figure 8), while gold-colored specimens, proba-
bly the holotype’s original color, have been found at
10.7 m in Clifton Harbor, also Union I. (Figure 2). The
black form has been taken at 5. 5-7.6 m in Chatham Bay,
Union I., at Canouan P, SVG (Figure 4), and from
Grenada at unknown depth (Figure 5). None of these
color forms have been found to have differences that
might suggest a separate species.
Other characters are variable in B. bellula. The num-
ber of ribs and spiral cords vaiy from 10 to 12 ribs and
5 to 10 spiral cords on the penultimate whorl among
the specimens examined. There can be as few as 1
or as many as 4 primary cords (Grenadian specimens
(Figures 6 and 7). Shallow water Union I. specimens
were quite uniform in having 2 (Figure 8). The number
of spirals on the last whorl varies from 13 to 25.
Buchema bellula is easily recognized by the regularly
spaced, smooth, fine light-colored spiral cords (the sec-
ondary spirals) spaced along the entire length ol the
shell, and by the 1-4 primary white cords swollen at
the crests of broad, short ribs that are mostly limited to
the whorls periphery. It is most similar to Buchema prim-
ula (Melvill, 1923); see the remarks under that species
for differences. Buchema melanacme (E.A. Smith, 1882)
differs in having an excavated sulcus with well-marked
growth striae and without secondary spiral cords, longer
and more distinct ribs, and broken or slightly nodulose
spirals on its base (Figure 9). Also, B. melauacme has
patches of darker color between ribs, which contrasts
with B. bellula’s uniform base color. B. nigra, new species
is similar to the black form of B. bellula — see under
B. nigra for a discussion of their differences.
Page 170
THE NAUTILUS, Vol. 124, No. 4
An undescribed species, shown in Figure 10 and tem-
porarily identified as Buchema aff. belliila , is larger,
peripheral spirals only slightly swollen, and secondary
spirals in the sulcus are lacking.
Buchema primula (Melvill, 1923)
(Figures 1 1-14)
Drillia primula Melvill, 1923: 166, pi. 4, fig. 9: Trew (1987: 58).
Buchema primula (Melvill, 1923): Williams (2005, 2006, 2009:
number 3013).
Buchema bellula (E.A. Smith, 1882): Williams (2005, 2006,
2009: number 3007, only second photograph from right)
(non E.A. Smith, 1882).
Description: Shell 6.3 x 2.7 mm (holotype), with ~7
whorls; fusiform, stout, anterior end truncated (Fig-
ure 11). Protoconch of ~2 worn whorls. On the fresh
specimen shown in Figure 12, there are 1.5 regularly
expanding, symmetrical, smooth whorls, followed by
0.5 whorl with 6 distinct, prominent, curved riblets;
protoconch white on the holotype, light brown with a
dark brown band next to the suture on the fresh speci-
men (Figure 14). Spiral sculpture consists of a subsutural
and 3 other cords on the spire whorls, 2 swollen at the rib
crests. Body whorl has 4 additional spiral cords on shell
base, also swollen at the rib crests, and 4 plain spiral
cords on the anterior canal. On the fresh specimen, the
subsutural cord is offset from the suture by 1-3 distinct,
packed spiral threads, and undulates with ribs that
underlie the appressed suture. Spiral threads are present
between the cords overall. Sulcus moderately wide,
slightly excavated, with spiral threads throughout. Axial
sculpture of 11 ribs on the penultimate and 9 to the varix
on body whorl, where they evanesce on the shell base.
Ribs about as broad as their interspaces. Outer lip bro-
ken on holotype; on fresh specimen lip thin, slightly
scalloped by 8 spiral cords; weak stromboid notch pre-
sent; anal sinus lies just below the subsutural cord, deep
and rounded at its apex, sides slightly divergent. Varix
lies behind the anal sinus, about the width of two swollen
ribs. Inner lip thin, transparent, with a parietal lobe at its
junction with the outer lip. Aperture narrow, ending in a
short, open anterior canal. Shell color pale yellow, prob-
ably faded; fresh specimens examined are all dark
brown, lighter near apex, with a white band spiral cords
on the periphery.
Holotype: Holotype BM(NH) 1982080.
Type Locality: Cuba.
Other Material Examined: I spec., 7.0 x 3.0 mm, at
12 m, Annas Shoal, Grenada (USNM 1139713); 1 spec.,
5.9 mm, at 0-0.9 m, in Thalassia , sand, coral rock, E side
of Prickly Point, SW Grenada, coll, by R. Ostheimer
(ANSP 424362); 1 spec., 6.6 x 2.5 mm, at 0.3-0. 9 m,
Prickly Bay, SW Grenada (ANSP 299773); 1 spec., 6.5 x
2.6 mm, from on coralline sand among dead coral at
I I m. Saline 1., Grenada, coll, by G. Mackintosh, Feb
1997 (UF 441322); and 1 spec., 7.4 x 2.9 mm, on rock
and sand at 7.6 m, Corbee Bay, Canouan I., SVG, coll,
by G. Mackintosh, 8 Jun 2004 (BMSM 17966); 2 spec.,
7.7 x 3.1 and 6.8 x 2.9 mm, at 5.5 m on silt-covered
rocks, Corbee Bay, Canouan 1., SVG, coll, by G. Mackin-
tosh, 6 Dec 2006 (authors coll.).
Distribution: Unspecified type locality in Cuba;
examined specimens are limited to SVG (Canouan I.)
and Grenada (Saline I.). A specimen in Peggy Williams
collection not examined (Williams, 2005; number 3007,
second photo from right), is 6.5 x 2.5 mm, and was taken
at 9 m, Canoe Bay, Grenada, coll, by G. Mackintosh,
20 Sep 1996 (Tippett, pers. observ.).
Remarks: Buchema primula has spiral cords overrid-
ing relatively broad ribs, witli spiral threads in between
the cords, characteristics of the genus. Intraspecific var-
iation is seen in the number and degree of swelling of the
peripheral white cords, and the whiteness of the cords.
Cords are more swollen in the specimen depicted in
Figure 12 than the one shown in Figure 13. Another
specimen not shown, ANSP 299773, has only two white
peripheral cords.
This species is most similar to and has been mistaken
for B. bellula (Williams, 2005, 2006, 2009: number 3007,
second photo from right). The confusion with B. bellula
is understandable; only Smith’s description has been
available for study, and only recently has a photograph
of the holotype of B. bellula been published (in Williams,
2006, 2009: number 3007, left photos). Buchema bellula
has a different protoconch: dark glassy brown, almost
black, of 2 smooth whorls, bulbous but not wider than
the first teleoconch whorl, and with tip partially
immersed so that the first whorl is slightly tilted relative
to the shell’s axis. This contrasts with the 2 regularly
expanding, symmetrical, and smooth whorls of B. prim-
ula that bear axial riblets terminally (Figure 14). The
teleoconch sculpture differs too. B. primula has a thicker
subsutural cord, which undulates with the ribs that
underlie the appressed suture; a narrower sulcus; typi-
cally 3 peripheral spiral cords (not 2) that are swollen
where they cross the ribs, the swellings rounder or
shorter, and the ribs narrower, with the interspaces about
the same width; more pronounced and longer ribs on the
body whorl; and fewer spiral cords on the body whorl.
Buchema nigra new species
(Figures 15-17)
Buchema bellula (E.A. Smith, 1882): Williams (2005, 2006,
2009: number 3007, rightmost photograph) (non E.A.
Smith, 1882).
Description: Shell 8.2 x 3.0 mm (holotype), nar-
rowly fusiform, truncated anteriorly; 7.5 whorls (Fig-
ure 15). Protoconch of 2.5 smooth glassy whorls,
except the last 0.25 whorl with ~4 faint axial riblets;
whorls dark brown, lighter mid-whorl. Teleoconch of
5 whorls; first whorl with 4 spiral cords, uppermost a
subsutural cord slightly thicker than the second, third
P.J. Fallon, Jr., 2010
Page 171
is swollen where it overrides the ribs and forms the
periphery of the shell, fourth lies next to the suture
with the succeeding whorl and is very fine. Spiral cords
increase to 6 on the penultimate whorl, the 3 periph-
eral ones are slightly swollen across the ribs. Sub-
sutural cord heaviest and 2 in the sulcus, which is Hat.
Body whorl has a total of 15 spiral cords: 6 to the
suture line as in the penultimate whorl, 4 more on
shell base that are slightly swollen across the ribs, and
5 encircle the anterior canal. Distinct spiral threads are
packed between the spiral cords, from about the third
teleoconeh whorl to the anterior canal. Ribs begin
about midway in the sulcus and evanesce on shell base;
number 11 to the varix on body whorl, 12 on penulti-
mate; distance between the ribs less than the rib width.
Varix lies close to the edge of the outer lip, just behind
the anal sinus, and is broader and higher than the ribs.
Outer lip thin, scalloped by the ends of spiral cords,
and with a slight stromboid notch. Anal sinus u-shaped,
shallow, slightly constricted on parietal side by callus;
located just below subsutural cord. Inner lip narrow,
appressed to the columella and parietal wall, terminat-
ing posteriorly at the parietal callus that forms the
roof of the aperture. Aperture ovate, about 37% of
the overall height of the shell, including the anterior
canal, which is very short. Shell color veiy dark brown
to black, spiral threads between the two peripheral
cords, and between subsutural cord and suture are
dark brown to black; spiral cords whitish; subsutural
cord brown.
Types: Holotype USNM 1139714. Paratypes: 1 spec.,
7.9 x 2.9 mm, at 40-50 m, Carriacou I., Grenada, coll,
by T. McCleery, May 2004 (UF 441323); 1 spec., 7.2 x
2.8 mm, at 9.8 m. Petit Nevis, SVG, coll, by G. Mackin-
tosh, 19 Aug 2000 (BMSM 17967); 1 spec., 7.4 x 3.2
mm, at 12.2 m, S end of Baliceaux I., SVG, coll, by
G. Mackintosh, April 1997 (USNM 1139715); 1 spec.,
8.1 x 3.0 mm, at 13.7 m, Annas Shoal, St. George,
Grenada, coll, by G. Mackintosh, 4 Aug 1996 (ANSP
424361); 1 spec., 7.2 x 2.7 mm, at 3.7 m under rock,
Man of War Bay, Tobago I., Trinidad and Tobago, coll, by
G. Mackintosh, 1 1 Feb 1998 (P. Williams coll.).
Type Locality: Petit Nevis, St. Vincent and the Gren-
adines, in 8.5 m.
Distribution: SVG (Baliceaux I.; Petit Nevis); Grenada
(Grenada I.; Carriacou I.); and Trinidad and Tobago
(Tobago I.).
Remarks: This species has the characteristics of
the genus Buchema , with spiral cords overriding rela-
tively broad ribs, and spiral threads in between the
cords. B. nigra is most similar to the black form of
B. bellula , but its peripheral cords are less swollen on
the rib crests, and it has a brown subsutural cord, which
is white in B. bellula.
Unlike B. bellula , little variation is seen in specimens
of B. nigra from different localities within its known
range. The specimen from Man ot War Bay, Tobago
(Figure 16) is indistinguishable from the holotype
(Petit Nevis, SVG), as is the specimen from Grenada
(Figure 17). An undescribed species from off Arraial
do Cabo, Rio de Janeiro state, Brazil (Figure 18), has
similar sculpture but is larger and brown in color. Only
this single imperfect specimen was available, so no
further analysis was undertaken. The right-most photo
in Williams (2009: number 4014), which is also from
Brazil, may be this undescribed species.
Etymology: From the Latin adjective niger , meaning
black (Oxford Latin Dictionary). This species is named
for its characteristic color, which is a very dark brown to
black in strong light under magnification, but decidedly
black to the naked eye.
Genus Miraclathurella Woodring, 1928
Type Species: Miraclathurella vittata Woodring, 1928,
by original designation. Miocene ol Jamaica (Bowden
Formation).
Remarks: Woodring (1928: 189) described members
of this genus as being veiy slender, having 2. 5-3.0 stout
nuclear whorls with a few opisthocline axial riblets, a
teleoconeh with narrow, closely spaced axial ribs, narrow
and more closely spaced on body whorl, overridden by
strong spiral cords, and a sulcus with a strong subsutural
cord. In addition they have a deep, round anal sinus, very
long and narrow aperture, relatively long anterior canal,
and a deep or relatively deep stromboid notch. The com-
bination of characters that separate this group from both
Buchema and Crassispira is a slender shell, narrow aper-
ture, a relatively heavy varix close to the edge of the
outer lip, a relatively long anterior canal, and a strong
stromboid notch.
Miraclathurella peggywilliaimae new species
(Figures 19-22)
Miraclathurella ? . — Williams, 2005: number 9036.
Description: Shell with 8 slightly convex whorls (holo-
type), 10.3 x 3.6 mm, fusiform, slender, spire about
58% of overall shell height (Figure 19). Protoconch
paucispiral, ~1.75 smooth whorls, except last 0.25 whorl
with 4 fine axials; tip partially immersed, giving the shell
apex the appearance of being flat-topped. The transition
to the teleoconeh is marked by the appearance of the
subsutural cord and angular axial ribs. Teleoconeh of
6.25 whorls bearing 3-5 spiral cords that are beaded at
the intersection of axials on early whorls, becoming more
elongated and less swollen on the body whorl, and then
plain cords on the varix and outer lip. Four more beaded
cords are present on the shell base; anterior canal with
8 rather plain spiral cords. Sulcus about a third the
height of the whorl, slightly excavated, marked with
arcuate incremental growth lines. Subsutural cord dis-
tinct, smooth, and located veiy close to the suture except
on the last 2 whorls where it is slightly offset below.
Finely granulose spiral threads, spaced about as far apart
Page 172
THE NAUTILUS, Vol. 124, No. 4
as they are wide and variable in thickness, are present
between the cords, in the sulcus, and a few between the
subsutural cord and the summit of the last 2 whorls only.
Axial ribs present but reduced in the anterior half of the
sulcus, continue to shell base where they evanesce. Axial
ribs are narrow with wide interspaces in early whorls,
and low and broad with narrow interspaces on later
whorls. Penultimate whorl has 23 axials; body whorl
about 18 to the varix. Varix a thick swelling a short dis-
tance behind the edge of the outer lip. Outer lip thin and
straight, running from the anal sinus to the small but
distinct stromboid notch. A short axial is present near
edge of outer lip. Anal sinus deep, its apex round, open-
ing partially constricted by the parietal callus and projec-
tion of the outer lip. Aperture oval, joins a distinct, open
anterior canal, which begins at the constriction imposed
by the stromboid notch. Canal turned slightly to the
right, viewed ventrally. Inner lip narrow, appressed to
the columella and parietal wall its entire length. Roof of
the aperture formed by the parietal callus that fills die
junction of the inner and outer lips. Shell color a light
golden yellow; 2 peripheral cords lighter still, almost
white.
Types: Holotype USNM 1139716; Paratypes: 1 spec.,
9.8 x 3.3 mm, at 7.6 m, St. Elair Pt., Friendship Bay,
Bequia, SVG, coll, by G. Mackintosh, 30 Jul 1996 (UF
441324); 4 spec., 10.3 x 3.5, 10.1 x 3.7, 10.4 x 3,5 (miss-
ing protoconch), and 9.9 x 3.3 mm, at 12.2 m, S end of
Baliceaux I., SVG, coll, by G. Mackintosh, 25 Apr 1997
(ANSP 424358); 1 spec., 9.7 x 3,5 mm, at 12.2 m, S end of
Baliceaux I., SVG, coll, by G. Mackintosh, 23 Apr 1997
(BMSM 17968); 2 spec., 9.9 x 3.6 (missing protoconch)
and 8.3 x 2.7 mm, at 10.7 m, Baliceaux I., SVG, coll, by G.
Mackintosh, 24 Apr 1997 (P. Williams coll.); 1 spec., 9.2 x
3.1 mm, at 3.0 m, Glover I., Grenada, coll, by G. Mackin-
tosh, 26 Nov 1996 (ANSP 424356); 1 spec., 10.2 x 3.8 mm
(missing apex), at 6.7 m, Glover I., Grenada, coll, by
G. Mackintosh, 4 Nov 1996 (P. Williams coll.); 1 spec.,
9.4 x 3.5 mm (missing apex), at 9.1 m. Devils Bay, Gre-
nada, coll, by G. Mackintosh, 8 Sep 1996 (P. Williams
coll.); and 1 spec., 10.6 x 3.5 mm, at 12.8 m, Limekiln
Bay, Carriacou, Grenada, coll, by G. Mackintosh, 28 Jun
1998 (BMSM 17969).
Type Locality: Baliceaux Island, St. Vincent and the
Grenadines, at 12.2 m depth.
Other Material Examined: 1 spec., 9.3 x 3.4 mm
(missing apex), Clifton Harbor, Union I., SVG, coll, by
P. Fallon (author’s coll.); 1 spec., 10.6 x 3.5 mm, at 3.7 m
under rock, Man of War Bay, Tobago I., Trinidad and
Tobago, coll, by G. Mackintosh, 2 Nov 1998 (ANSP
424357); 1 spec., 8.9 x 3.0 mm, at 9.1 m, Parlatuvier
Bay, Tobago I., Trinidad and Tobago, coll, by G. Mackin-
tosh, 14 Oct 1998 (USNM 1 139718); 1 spec., 10.1 x 3.5
mm, at 6.1 m, Pampatar, Margarita I., Venezuela, coll, by
G. Mackintosh, 15 Jun 1993 (USNM 1 139717).
Distribution: SVG (Bequia I., Baliceaux I., Union I.);
Grenada (Grenada I., Glover I., Carriacou I.); Trinidad
and Tobago (Tobago I.); and Venezuela (Margarita I.).
Remarks: The genus was erected for fossil species of
the Bowden Formation oi Jamaica (Woodring, 1928),
and although veiy similar, there are some minor differ-
ences from Woodring’s description of the genus. The
nuclear whorls number 1.75, not 2. 5-3.0, although there
is some room for difference in interpretation, and the
anterior canal appears relatively shorter than those of
the fossil specimens placed in this genus. The shell’s
Figures 19—22. Miraclathurella peggywilliamsae new species. 19. Holotype, USNM 1139716, Baliceaux I., SVG, 10.3 x 3.6 mm.
20. Paratype, ANSP 424356, Glover I., Grenada, 9.2 x 3.1 mm. 21. ANSP 424357, Man of War Bay, Tobago I., Trinidad and Tobago,
10.6 x 3.5 mm. 22. Same specimen as 21, expanded views of the protoconch.
P.J. Fallon, Jr., 2010
Page 173
spindle shape, elongate aperture, prominent varix close
to the outer lip, distinct stromboid notch, subsutural
cord and other sculptural details support placement
here, as they are consistent with his description. The
height ol' this species falls within the range of 6.9-
15.5 mm reported for Bowden Formation fossils
(Woodring, 1928: 190-191). The largest specimen of
M. peggywilliamsae examined is 12.6 x 3.8 mm, but is
not included in the list of examined specimens above
because the locality data has been lost. The only other
extant species from the TNWA area (tentatively placed in
the Miraclathurella by the describer) is M. clendenini
Garcia, 2008, the largest of which was reported to be
10.1 mm (Garcia, 2008: 11).
Geographic variation is evident in specimens exam-
ined. Those from St. Vincent and the Grenadines are
light golden yellow, the Grenadian ones a darker golden
color (Figure 20), and those from Tobago and Margarita I.
mostly brown (Figure 21). The Man of War Bay, Tobago
specimen has fewer cords on the body whorl and ante-
rior canal, the spiral sculpture is more pronounced, the
beading is slightly larger, the axials better defined, and
the elongated beads on the body whorl do not tend
to coalesce into a thick cord. The Margarita I. specimen
is similar to the holotype in most respects except that
it has fewer threads between the cords. Although only
minor differences in sculptural detail are present in the
specimens from these more distant geographic areas
(from the type locality), they have been left out of
the type series. However, it is not believed they war-
rant separation at the specific level because of these
differences.
Darnjlia kleinrosa (Usticke, 1969) is closest to this but
differs in being pink in color, generally smaller, and in
lacking a distinctive subsutural cord. It also has a strong
denticle at the beginning of the anterior canal that
constricts its opening (Garcia, 2008: 10). Crassispira
nigrescens (C. B. Adams, 1845) has a similar appearance
but, most significantly, it has a much shorter aperture
and anterior canal, and only a modest varix, compared
with the longer anterior canal and thick varix of
M. peggywilliamsae . Also, the beading on C. nigrescens
is generally heavier.
Etymology: Named after Peggy Williams because of
her passion for tropical western Atlantic turrids and pro-
motion of their greater understanding with her book,
Shallow-Water Turridae of Florida and the Caribbean ,
and for recognizing this species as undescribed.
ACKNOWLEDGMENTS
I wish to thank Dr. Jon Greenlaw who first interested me
in the review of malaeological literature for what it could
reveal about the kinds, habitat and distribution of
mollusks of the TNWA, and for his helpful suggestions
on the manuscript. I am grateful to Dr. Donn Tippett
who generously gave so much of his time to explain the
complex world of turrid systematics, terminology, for his
advice and opinion on the manuscript, and very
importantly, use of his invaluable turrid study notes.
Thanks are due Dr. ferry Harasewych and Paul
Callomon, curators of the USNM and ANSP malacology
departments, respectively, who allowed me free run of
the valuable collections under their care. 1 also thank
Peggy Williams for generously parting with many of the
Mackintosh crassispirine turrids, and for her astute
observations helpful in this research, and also to Bandy
Allamand and Andre Poremsld, both for supplying
additional shells collected by the Mackintoshes. Ack-
nowledgement is due Gaiy and Margaret Mackintosh
because, were it not for the years ol sailing and
collecting around the Caribbean, these new species
would have remained unknown, and we would be
ignorant of the surprising diversity of small erassispirines
in the southeastern Caribbean. Gary’s many dives and
the resulting mass of material collected from relatively
inaccessible corners of the Caribbean have not been
matched by any other modern day explorer.
LITEBATURE CITED
Abbott, R.T. 1974. American Seashells. 2nd Edition. Van
Nostrand Reinhold Co., New York, 663 pp., 24 pis.
Absalao, R.S., A. D. Pimenta and C.II.S. Caetano. 2005.
Turridae (Mollusce, Neogastropoda, Conoidea) coletados
no litoral sudeste do Brazil, Programa REVIZEE “Score”
Central. Biociencias 13: 19-47.
Altena, C.O. van Regteren. 1975. The marine Mollusca of Suri-
name (Dutch Guiana) Holocene and Recent. Part III.
Gastropoda and Cephalopoda. Zoologische Verhandelingen
139: .3-104.
Corea, L.F. 1934. Reports on the collections obtained by the
first Johnson-Smithsonian deep-sea expedition to the
Puerto Rican Deep: new marine mollusks. Smithsonian
Miscellaneous Collections 91(16): 1-9 + 3 pi.
Diaz, J. M. and M. Puyana. 1994. Moluscos del Caribe
Colombiano, un catalogo ilustrado. Colciencias y Fundacion
Natura Colombia, Santa Fe de Bogota, 291 pp.
Ekdale, A. A. 1974. Marine molluscs from shallow-water envi-
ronments (0 to 60 meters) off the northeast Yucatan coast,
Mexico. Bulletin of Marine Science 24: 638-668.
Fallon, P.J., Jr. 200S. Hermit crab swarm. American Coneholo-
gist 36: 9-13.
Garcia, E.F. 2008. Eight new molluscan species (Gastropoda:
Turridae) from the western Atlantic, with the description
of two new genera. Novapex 9: 1-15.
Humfrey, M. 1975. Sea shells of the West Indies. Taplinger
Publishing Company, New York, 351 pp. + 32 pis.
Kaicher, S.D. 1984. Card catalogue of world-wide shells. Pack
39 - Turridae. S.D. Kaicher, St. Petersburg, Florida, cards
[i-ii], 3882-3987.
Maes, V.O. 1983. Observations on the systematics and biology
of a turrid gastropod assemblage in the British Virgin
Islands. Bulletin of Marine Science 33: 305-335.
McLean, J.H. 1971. A revised classification of tire family
Turridae, with the proposal of new subfamilies, genera,
and subgenera from the eastern Pacific. The Veliger 14:
114-130.
Melvill, J.C., 1923. Descriptions ot twenty-one species of
Turridae (Pleurotomidae) from various localities in the
Page 174
THE NAUTILUS, Vol. 124, No. 4
collection of Mr. E.R. Sykes. Proceedings of the Malaeo-
logical Society of London 15: 162-171.
Olsson, A. A. and T. L. McGinty. 1958. Recent marine mollusks
from the Caribbean coast of Panama with the description
of some new genera and species. Bulletins of American
Paleontology 39: 1-58.
Paetel, F. 1888. Catalog der Conchylien-Sammlung. Erste
Abtheilnng: Die Cephalopoden, Pteropoden und Meers-
Gastropoden. Gebriider Paetel, Berlin, [1] + 639 pp.
Rios, E.C. 1975. Brazilian marine mollusks iconography.
Fun day ao Universidade do Rio Grande, Rio Grande, xii,
331 pp. + 91 pis.
Rios, E.C. 1985. Seashells of Brazil. Fundayao Universidade
do Rio Grande, Rio Grande, xii, 328 pp. + 102 pis.
Rios, E.C. 1994. Seashells of Brazil. 2nd ed. Fundayao Uni-
versidade do Rio Grande, Rio Grande, 368 pp. + 113 pis.
Rios, E.C. 2009. Compendium of Brazilian Sea Shells.
Evangraf, Rio Grande, RS, Brazil, viii, 668 pp.
Smith, E.A. 1882. Diagnoses of new species of Pleurotomidae
in the British Museum. Annals and Magazine of Natural
History Series 5, no. 10: 206-218.
Trew, A. 1987. James Cosmo Melvill’s New Mollusean Names.
National Museum of Wales, Cardiff, 84 pp.
Tryon, G.W., Jr. 1884. Conidae, Pleurotomidae. Manual of
Conehology, Structural and Systematic, with Illustrations
of the Species. Tryon, Philadelphia, 413 pp. + 34 pis.
Warmke, G.L. and R.T. Abbott. 1961. Caribbean Seashells A
Guide to the Marine Mollusks of Puerto Rico and Other
West Indian Islands, Bermuda and the Lower Florida
Keys. Dover Publications, Inc., New York, 348 pp.
Williams, M.A. S. 2005. Shallow- Water Turridae of Florida and
the Caribbean. Published by the author, Tallevast, 223 pp.
Williams, M. A. S. 2006. Shallow-Water Turridae of Florida and
the Caribbean, version 3. Published by the author,
Tallevast, 223 pp.
Williams, M.A. S. 2009. Shallow- Water Turridae of Florida
and the Caribbean. Published by the author, Tallevast,
230 pp.
Woodring, W. P. 1928. Miocene Mollusks from Bowden,
Jamaica. Part II. Gastropods and discussion of results.
Carnegie Institute of Washington, Washington, D.C.,
vii, 564 pp. + 40 pis.
THE NAUTILUS 124(4). 175-180, 2010
Page 175
A new species of Cerberilla (Gastropoda: Nudibranchia:
Aeolidiidae) from northeastern Brazil
Vinicius Padula1
Departamento de Invertebrados
Museu Nacional
Universidade Federal do Rio de Janeiro
Rio de Janeiro 20940-040, BRAZIL
[email protected]
Marlon Delgado
Departamento de Oeeanografia e Limnologia
Laboratorio de Biologia Pesqueira
Universidade Federal do Rio Grande do Norte
Natal 59014-100, BRAZIL
[email protected]
ABSTRACT
Few specimens of the 15 named species of Cerberilla are
known. Body color pattern and teeth morphology have been
used as the main diagnostic characters to separate species of
the genus. To date, Cerberilla tanna is the only species of the
genus described from the western Atlantic. Because its original
description does not provide much information about body
coloration, the identity of this species remained unclear until
now. In this paper, we describe Cerberilla potiguara, a new
species from the northeastern coast of Brazil, and compare it
with C. tanna. The holotype of C. tanna was located and exam-
ined. Cerberilla potiguara new species is longer than C. tanna
but has relatively shorter oral tentacles and a narrower foot; the
radular teeth of Cerberilla potiguara new species have promi-
nent central and marginal cusps, which are absent in C. tanna.
A prominent unarmed penis associated with a conical atrium,
observed in Cerberilla potiguara new species and other Cerberilla
species, is herein considered a distinguishing characteristic of the
genus among the Aeolidiidae.
Additional keywords: Biodiversity, Opisthobranchia, Rio
Grande do Norte, morphology, Marcus collection.
INTRODUCTION
Because of their habit of burrowing in sand, few spec-
imens are known of the 15 named species of Cerberilla.
Body color pattern and teeth morphology have been
used as the main diagnostic characters to separate the
species (McDonald and Nybakken, 1975; Hermosillo
and Valdes, 2007). In fact, body color and its patterns
constitute an important character for taxonomic studies
of nudibranchs in general (Behrens, 2005). Only recently
the nudibranch fauna from the western Atlantic began
to be well illustrated, with the publication of books
containing color photographs of a series of species
1 Current Address: Zoologische Staatssammlung Miinchen/
Bavarian State Collection of Zoology, Mollusca Department,
Miinehhausenstr. 21, 81247 Miinchen, Germany.
(Redfern, 2001; Valdes et ah, 2006; Garcfa-Garcfa et ah,
2008). Previously, most western Atlantic species were
known only from black-and-white ink drawings and gen-
erally brief descriptions of color (e.g. Marcus, 1955,
1957). In addition, some original descriptions of western
Atlantic species were based on preserved and faded
specimens (e.g. Nanuca sebastiani Marcus, 1957), the
color of original living forms remained unknown.
The only named species of Cerberilla known from the
western Atlantic is Cerberilla tanna Marcus and Marcus,
1960 described from a single preserved specimen from
Texas, USA. The only mention of body color in the orig-
inal description was of the presence of an “orange-brown
spot on the outer surface ol many, not all, cerata” on the
dirty-yellow preserved holotype (Marcus and Marcus,
1960). Since the original description, new specimens of
C. tanna have not been studied and this species
remained for a long time as the only known representa-
tive of the genus in the western Atlantic. Humann and
Deloach (2002) illustrated a brilliant blue Cerberilla
from St. Vincent Island, called Cerberilla sp., in then-
book on reef creatures. This morphotype was also
photographed in Florida, Bahamas, and Bonaire
(Behrens, 2003; Hutchinson, 2003; Ferretti, 2009).
Later, a pale-cream Cerberilla was recorded in the
Gulf of Mexico (Hooper, 2004) and subsequently
photographed from the coast of Mississippi and
St. Vincent Island (Perry, 2005; Wilk, 2005). Another
pale-cream morphotype, from Florida, was illustrated
by Ianniello (2003) and Valdes et al. (2006: 276-277, as
C. tanna). These pale-cream morphotypes have cerata
with dark spots, more closely resembling the characteris-
tics of C. tanna. However, the identity of all morphotypes,
the brilliant blue and the two pale-cream forms, remained
unclear because no data on their anatomy were available.
Material of the blue Cerberilla, recently collected on
the northeastern coast of Brazil, is described herein. We
compare it with the type material and the original de-
scription of C. tanna. A new species is described, and the
situation of the genus in the western Atlantic is, at least
in part, clarified.
Page 176
THE NAUTILUS, Vol. 124, No. 4
MATERIALS AND METHODS
The holotype of Cerberilla tanna new species was
located in the Marcus collection, deposited in the Mala-
cological collection of the Museu de Zoologia da
Universidade de Sao Paulo (MZSP), Brazil. Living mate-
rial of the new species was photographed in situ, manu-
ally collected, fixed with 4% formalin, and preserved in
70% ethanol. It was deposited in the Malacological col-
lection of the Museu Nacioual/Universidade Federal do
Rio de Janeiro (MNRJ), Brazil. Specimens were observed
using a binocular microscope. External structures of inter-
est were photographed using a Nikon digital camera
coupled to the microscope. Material of the new species
was dissected through a dorsal incision. The buccal mass
was removed and placed in 10% sodium hydroxide until
the jaws and radula were isolated from the adjacent tissue.
The jaws and radula were then rinsed in water, dried, and
mounted for examination with a scanning electron micro-
scope (SEM). The reproductive system was drawn using
the camera lucida mounted on the binocular microscope.
The holotype of C. tanna , previously dissected, was
photographed, but, in order to preserve its morphology,
no new cuts or dissections were made.
SYSTEMATICS
Family Aeolidiidae Gray, 1827
Genus Cerberilla Bergh, 1873
Cerberilla potiguara new species
(Figures 1-6, 10)
Cerberilla sp. Humann and Deloach, 2002: 309; Valdes et al.
2006: 276-277.
Cerberilla sp. 7. — Rudman, 2004.
Cerberilla tanna. — Behrens, 2003.
External Morphology (Figures 1, 2, 10): Living holo-
type 45 mm long (18 mm long preserved). Body long,
narrow. Distinct head, cylindrical oral tentacles and
rhinophores. Pair ol rounded, slightly protruded lips.
Oral tentacles relatively short (3 mm long, preserved),
projected laterally. Rhinophores short, smooth, with
adjacent bases. Small eyes located at base of each
rhinophore, laterally on head. Foot wider than body,
with triangular anterior corners; anterior margin
broader, tapers slightly, rounded posterior end. Cerata
club-shaped, 15 rows, anterior rows more spaced; poste-
rior cerata longer (8 mm long, preserved) covering dor-
sum. Gonopore, body right side, below first row of
cerata. Anal and renal openings, body right side, behind
pericardium, between fifth and sixth cerata rows.
Coloration (Figures 1, 2): Body brilliant blue. Upper
oral region witl i orange line bordered in yellow, extended
to inner area of each oral tentacle base. Oral tentacles
blue. Oral lips light blue. Foot anterior margin yellow
bordered. Rhinophores blue. Eyes region less pig-
mented. Head with remarkable pattern: thin triangular
orange spot in front of each rhinophore; black line bor-
ders external side of each triangular spot, runs toward
pericardium and behind rhinophores, where borders
elliptical orange spot. Pericardial zone grayish black.
Cerata grayish-blue, anterior portion with round yellow-
Figures 1-2. Cerberilla potiguara new species, living holotype (MNRJ 15111, length: 45 mm). 1. Specimen crawling near reef.
2. Detail of structures of the anterior region ol the body. Abbreviations: fc, foot corner; li, lips; ot, oral tentacle; rh, rhinophore.
Photo: Liana Mendes.
V. Padula and M. Delgado, 2010
77
Figures 3-4. Cerberilla potiguara new species, holotype (MNR| 1.5111), scanning electron micrographs. 3. Lelt jaw, external
face. Scale bar = 500 pm. 4. Radular teeth, general view. Scale bar = 100 pm 5. Detail of the denticles of the eighth tooth.
Scale bar = 50 pm.
orange spot; spot longer on anterior cerata; posterior
cerata with spot located near apical zone.
Radula and Jaw (Figures 3-5): Uniseriate radula, 19
teeth (holotype, 45 mm long alive). Radular teeth large,
many times as wade as long. Tooth with series of denticles
of different sizes (around 25 per tooth), submarginals
highest; in some teeth, each short denticle alternates
with high denticle; sequence of up to three high denti-
cles located near central region of tooth. Jaw plates wide,
rounded, slightly larger in posterior region; smooth
projecting masticatory border.
Reproductive System (Figure 6): Hermaphroditic
duct long, narrow. Ampulla veiy long, flattened, with
four folds proximally; distal portion narrow, connected
to prostate as well as to common atrium with vagina and
receptaculum seminis insertion. Receptaculum seminis
heart-shaped, projecting in a thin tube. Prostate volumi-
nous, curved. Deferent duct large, curved. Penis large,
unarmed. Male atrium conical, with small oval aperture.
Holotype: MNRJ 151 11, Liana Mendes and Aline S.
Martinez col., 14 Nov. 2008.
Type Locality: Praia de Brizios, Rio Grande do Norte,
northeastern coast of Brazil (06° 0013" S; 35°06'24" W),
intertidal zone of the coastal reef.
Etymology: The specific name refers to the Potiguar
native Brazilian people, who inhabited the region of Rio
Grande do Norte, Brazil.
Geographic Distribution: Known from type locality,
Florida, the Bahamas, St. Vincent and the Grenadines,
and Bonaire (Humann and Deloach, 2002; Behrens,
2003; Rudman, 2004; Valdes et al. 2006).
Cerberilla tanna Marcus and Marcus, 1960
(Figures 7-9)
Cerberilla tanna Marcus and Marcus, 1960: 259, figures
18-19.
?Cerberilla tanna. — Hooper, 2004; Perry, 2005; Wilk, 2005.
?Cerberil1a tanna. — Ianiello, 2003; Valdes et al., 2006: 276.
External Morphology (Figures 7-9): Strongly con-
tracted and curved holotype, 14 mm long. Body long,
narrow. Distinct head with cylindrical oral tentacles
and rhinophores. Oral region with marginal, grooved
lip. Oral tentacles long (5 mm), projecting laterally.
Rhinophores veiy short, smooth, with adjacent bases.
Foot wider than body, oval shape, central region larger
than the rest, triangular anterior comers. Cerata club-
shaped, 13 closely set rows; anterior rows more spaced;
posterior cerata longer (5 mm long, preserved) covering
Page 178
THE NAUTILUS, Vol. 124, No. 4
Figure 6. Cerberilla potiguara new species, holotype
(MNRJ 15111), reproductive system. Scale bar = 1 mm.
Abbreviations: am, ampulla; del, deferent duct; fg, female
gland; hd, hermaphroditic duct; ma, male atrium; pe, penis;
pr, prostate; rs, receptaculum seminis; va, vagina.
dorsum. Gonopore on right side, below third row of cerata.
Anal and renal openings on right side, behind pericardium,
under sixth row of cerata. Left side ol body of holotype
with a cut, made previously, from head to middle region.
Coloration: Body pale yellowish. Some cerata with
orange-brown spot located on outer surface, under
cnidosac. Cnidosacs whitish and translucent.
Radula and Jaw: Unfortunately, no digestive or
reproductive structures were found upon examination
of the holotype of C. tanna. For description of jaws and
radula, see Marcus and Marcus (1960: 259).
Material Examined: Holotype (with the original
label). Off Sabine Jetties, Texas, 15 June 1951, 3.6-12 m,
Hildebrand col. (MZSP 75244).
Geographic Distribution: Known from Texas, Gulf
of Mexico (type locality). The range of this species may
include the coast of Mississippi, Florida, St. Vincent and
the Grenadines Islands (Ianiello, 2003; Hooper, 2004;
Perry, 2005; Wilk, 2005; Valdes et ah, 2006).
DISCUSSION
Cerberilla potiguara new species is included in the
genus by having large, strong and pectinate radular
teeth with high marginal denticles; foot wider than the
body with distinct tentaculiform anterior corners; small,
cylindrical, smooth rhinophores; and penis large and
unarmed, according to the definitions given by Bergh
(1873), Burn (1966), and McDonald and Nybakken
(1975). The last characteristic (penis large and unarmed)
was reported originally by Bergh (1873) but was not
discussed in subsequent studies.
The characteristics herein observed in the holotype of
Cerberilla tanna agree with the original description of
Marcus and M arcus (1960), including the very short
rhinophores, long oral tentacles (around 1/3 of the pre-
served body length) and the orange-brown spot on the
outer face of some cerata. These characteristics contrast
with the morphology and coloration of Cerberilla
potiguara new species, which has longer rhinophores,
shorter oral tentacles (around 1/6 of the preserved body
length) and a light spot on the outer face of each dark
cerata (see Figures 8-10). Cerberilla potiguara new spe-
cies has a longer body with a relatively narrower foot
when compared to C. tanna, which has an oval foot.
Although only one specimen of each species was avail-
able for study, remarkable differences could be observed
in relation to their internal morphology. The radular
teeth of Cerberilla potiguara new species have long and
short, irregularly arranged denticles, with a sequence of
high submarginal and up to three high central denticles.
In contrast, the teeth of C. tanna have a sequence of
alternating short and high denticles, with one to three
small denticles between high denticles, and four to seven
small denticles of different sizes in the center of the
tooth, with the median denticles minute (Marcus and
Marcus, 1960, Fig. 19).
Information on the reproductive system morphology
is available for few species of Cerberilla: C. ajfinis
Bergh, 1888; C. ambonensis Bergh, 1905; C. bernadettae
Tardy, 1965; C. chavezi Hermosillo and Valdes, 2007;
C. longicirrha Bergh, 1873; and C. moebii (Bergh, 1888).
No general characterization about the shape and organi-
zation of the reproductive structures exists for the genus.
After checking previous descriptions and the morphology
of C. potiguara new species, some characteristics shared
among the species could be observed, including the pres-
ence of a large unarmed penis, associated in most cases
with a conical atrium; a wide prostate and deferent duct; a
small oval receptaculum seminis connected by a narrow
tube, which is elongated in most species; and a long,
convoluted ampulla. These characteristics are shared
by C. potiguara new species, C. afftnis, C. bernadettae,
C. chavezi, and C. moebii (see Bergh, 1888, 1888a; Tardy,
1965; Gosliner, 1985; Hermosillo and Valdes, 2007). For
C. ambonensis and C. longicirrha, only references to
penis morphology exist, for the former relative to its
length (2 mm; Bergh, 1905: 226) and for the latter to the
penis length and shape: long and conical (Bergh, 1873:
28). The prominent unarmed penis associated with a con-
ical atrium is herein considered a distinguishing charac-
teristic of the genus Cerberilla among the Aeolidiidae.
The elucidation of the identity of the western Atlantic
blue morphotype of Cerberilla, i.e., corresponding to the
V. Padula and M. Delgado, 2010
Page 179
Figures 7-9. Cerberilla tanna , preserved holotype (MZSP 75244), external morphology. 7. Holotype and original labels. Scale bar =
10 mm. 8. Frontal view of the oral region. Scale bar = 2.5 mm. 9. Right side view of the anterior portion of the body. Scale bar = 2.5 mm.
10. Cerberilla potiguara new species, preserved holotype (MNRJ 15111), right side view of the anterior portion of die body.
Scale bar - 3 mm.
new species herein described, clarifies, at least in part, the
situation of the genus in the western Atlantic. Cerberilla
tanna resembles more the pale-cream morphotype from
the Gulf of Mexico, Mississippi and St. Vincent (Hooper,
2004; Perry, 2005; Wilk, 2005) than the pale-cream
morphotype from Florida (Ianiello, 2003; Valdes et al.,
2006) because the former has short rhinophores and very
long oral tentacles, as originally described and herein
observed for the holotype of this species. Although it might
be a different species, we do not discard the possibility that
the material from Florida represents a juvenile color form
of Cerberilla potiguara new species, as commented by
Rudman (2003) and supported by the existence of other
specimens with less blue pigmentation (Behrens, 2003;
Ferretti, 2009; McVicar, 2009). The answers to this and
other remaining questions about western Atlantic
Cerberilla depend on more field observations and anatom-
ical studies, when specimens become available.
ACKNOWLEDGMENTS
We thank Dr. Liana Mendes (UFRN) and M.Sc. Aline
S. Martinez for providing us material and photographs
of the new species. Dr. Luiz Simone (MZSP) and
Dr. Franklin Santos (UFES) for the loan. Dr. Gary
McDonald (Long Marine Laboratory) for his support
with bibliography, Mrs. Janet Reid for the English
revision of the manuscript. Dr. W.B. Rudman (Austra-
lian Museum) for the amazing and helpful Sea Slug
Forum. We thank also two anonymous referees for their
valuable comments on the manuscript.
LITERATURE CITED
Behrens, D.W. 2003. Cerberilla tanna. Available via http://
slugsite.us/bow/nudwk366.htm [Accessed August 2010],
Behrens, D.W. 2005. Nudibranch Behavior. New World Publi-
cations, Inc., Jacksonville, 176 pp.
Bergh, L. S.R. 1873. Neue Nacktschnecken der Siidsee,
Malacologische Untersuehungen. Journal des Museum
Godeffroy 1: 65-96.
Bergh, L. S.R. 1888. Beitrage zur Kenntniss der Aeolidiaden.
IX. Verhandlungen der koniglichkaiserlieh Zoologiseh-
botanischen Gesellsehaft in Wien (Abhandlungen) 38:
673-706.
Bergh, L. S.R. 1888a. Malacologische Untersuehungen. In:
Reisen im Archipel der Philippinen von Dr. Carl Gottfried
Page 180
THE NAUTILUS, Vol. 124, No. 4
Semper. Zweiter Theil. Wissenschaftliche Resultate. Band
2, Theil 3, Heft 16, 1 Halfte, pp. 755-814.
Bergh, l.. S.R. 1905. Die Opisthobranchiata der Siboga-
Expedition. Monographic 50, 248 pp.
Burn, R.F. 1966. Descriptions ol Australian Eolidacea
(Mollusca: Opisthobranchia). 4. The genera Pleurolidia ,
Fiona , Learchis, and Cerberilla from Lord Howe Island.
Journal of the Malacological Society of Australia 1: 21-34.
Ferretti, L. 2009. Cerberilla sp. 7 from Bonaire, Caribbean.
[Message in] Sea Slug Forum. Australian Museum, Syd-
ney. Available via http://www.seaslugforum.net/find/22668
[Accessed August 2010].
Garcfa-Garcfa, F.J., M. Dominguez Alvarez, and J.S. Troncoso.
2008. Opistobranquios de Brasil: Description y distribution
de opistobranquios del litoral de Brasil y del Archipielago
Fernando de Noronha. Vigo: Feito, S.L., 215 pp.
Gosliner, T. M. 1985. The aeolid nudibranch family Aeolidiidae
(Gastropoda: Opisthobranchia) from tropical southern
Africa. Annals of the South African Museum 95: 233-267.
Hermosillo, A. and A. Valdes. 2007. Five new species of aeolid
nudibranchs (Mollusca, Opisthobranchia) from the tropi-
cal Eastern Pacific. American Malacological Bulletin 22:
119-137.
Hooper. K. 2004. Cerberilla tanna from Gulf of Mexico. [Mes-
sage in] Sea Slug Forum. Australian Museum, Sydney.
Available via htqn/Avww.seaslugforum. net/find/12080
[Accessed August 2010].
Humann, P. and N. Deloach. 2002. Reef Creature Identifica-
tion, Florida-Caribbean-Bahamas. 2nd edition. Jackson-
ville: New World Publication, 448 pp.
Hutchinson, J. 2003. Cerberilla tanna ? from Florida. [Message
in] Sea Slug Forum. Australian Museum, Sydney. Avail-
able via http://www.seaslugforum.net/find/9858 [Accessed
August 2010].
Ianniello, L. 2003. Cerberilla tanna? from Florida (2).
[Message in] Sea Slug Forum. Australian Museum, Syd-
ney. Available via htqr://www.seaslugforum. net/find/9868
[Accessed August 2010].
Marcus, Er. 1955. Opisthobranchia from Brazil. Boletim da
Faculdade de Filosofia, Ciencias e Letras, Universidade
de Sao Paulo, Zoologia 207, 20: 89-261.
Marcus, Er. 1957. On Opisthobranchia from Brazil (2). Journal
of the Linnean Society, Zoology 43, 292: 390^486.
Marcus, Ev. and Er. Marcus. 1960. Some opisthobranchs
from the northwestern Gulf of Mexico. Publications of
the Institute ol Marine Science, University of Texas 6:
251-261.
McDonald, G.R. and J.W. Nybakken. 1975. Cerberilla
mosslandica, a new eolid nudibranch from Monterey Bay,
California (Mollusca: Opisthobranchia). The Veliger 17:
378-382.
McVicar, M. 2009. Re: Cerberilla sp. 7 from Bonaire, Carib-
bean. [Message in] Sea Slug Forum. Australian Museum,
Sydney. Available via http://www.seaslugforum.net/find/
22673 [Accessed August 2010].
Perry, H. 2005. Cerberilla tanna from Mississippi, USA. [Mes-
sage in] Sea Slug Forum. Australian Museum, Sydney.
Available via bttp://www.seaslugforum.net/tind/13843
[Accessed August 2010],
Redfern C. 2001. Bahamian Seashells: a thousand species from
Abaco, Bahamas. Boca Raton: BahamianSeashells.com,
Inc, 280 pp.
Rndman, W. B. 2003. Comment on Re: Cerberilla tanna?
from Florida by Dave Belnens. [Message in] Sea Slug
Forum. Australian Museum, Sydney. Available via
http://www.seaslugforum.net/find/9877 [Accessed August
2010],
Rudman, W. B. 2004. Cerberilla sp. 7 [In] Sea Slug Forum.
Australian Museum, Sydney. Available via http://www.
seashigforum.net/showall/cerbsp7 [Accessed August 2010],
Tardy, J.P. 1965. Description et biologie de Cerberilla
bernadetti, espeee nouvelle de Gasteropode Nudibranche
de la cote atlantique franyaise. Discussion sur la
position systematique du genre. Bulletin de l’lnstitut
Oeeanographique, Monaco 65: 1-22.
Valdes, A., J. Hamann, D.W. Behrens, and A. Dupont. 2006.
Caribbean Sea Slugs. Sea Challengers Natural Histoiy
Books, Etc., Gig Harbor, 289 pp.
Wilk, L. 2005. Cerberilla tanna? from St. Vincent. [Message in]
Sea Slug Forum. Australian Museum, Sydney. Available via
http://www.seaslugforum.net/find/15047 [Accessed August
2010],
THE NAUTILUS 124(4): 181-184, 2010
Page 181
A new species of Holospira (Gastropoda: Pulmonata:
Urocoptidae) from Coahuila, Mexico
Lance H. Gilbertson
Malacology Section
Natural History Museum of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007 USA
[email protected]
Edna Naranjo-Garcia
Instituto de Biologia, Departamento de Zoologia
Universidad Nacional Autonoma de Mexico
Avenida Universidad 3000, Ciudad Universitaria
C.P. 04510, Distrito Federal, MEXICO
[email protected]
ABSTRACT
A new trilamellate Holospira Martens, I860 from southeastern
Coahuila, Mexico is described and assigned to Holospira sensu
stricto. The species is found near the summit of Sierra La Viga
at 3,600 meters (11,810 feet), a new elevation record for the
genus; however, Propilsbrya koestneri Rehder, 1940 is found at
a similar elevation.
Additional keywords: Landsnail, lamella, whorl. Sierra La Viga
INTRODUCTION
The urocoptid genus Holospira Martens, 1860 is com-
prised of moderately small species of landsnails bearing
cylindroconic to turriform, nondecollate, tightly coiled
shells. They have a hollow internal column that usually
exhibits a lamella (columellar/axial) within the penulti-
mate whorl. Up to three additional internal lamellae may
be present (parietal, basal, and palatal), arising Irom the
upper, lower, and outer walls of the shell respectively.
When only three lamellae are present, the combination
consists of the columellar, parietal, and basal; the palatal
is lacking (see Pilsbry, 1946; Thompson and Mihalcik,
2005). Thompson and Mihalcik (2005) noted that in the
sequence of ontogenetic development of the shell, the
palatal is the last lamella to form. The species described
herein exhibits this trilamellate condition.
Holospira is a prolific and widespread genus typically
inhabiting isolated limestone outcrops from the south-
western United States (Arizona, New Mexico, and Texas)
to southern Mexico (Oaxaca). The new species is found
near the summit of Sierra La Viga in the northern Mex-
ican state of Coahuila at 3,600 meters, the highest known
elevation site for a Holospira. This mountain is near the
northern end of the Sierra Madre Oriental, the major
mountain range of eastern Mexico. The previously
known elevation record for a Holospira was 2,896 meters
(9,500 feet; Bartsch, 1906) for H. nelsoni Pilsbry, 1903,
from the more westerly Sierra Guadalupe, Coahuila.
However, another urocoptid species, Propilsbrya
koestneri Rehder, 1940, from nearby Nuevo Leon, is
found at 3,650 meters, slightly higher than H. fergusoni
new species.
MATERIALS AND METHODS
Shells of the new species were hand-collected by George
M. Ferguson on 22 May 1986.
For the scanning electron micrograph of the embry-
onic whorls, the uncoated holotype shell was mounted
on a copper stub with carbon-conductive tabs (PELCO
tabs). The micrograph was taken with a Hitachi S-3000N
scanning electron microscope.
Abbreviations of institutions used in this article are
as follows: CNMO, Coleccion Nacional de Moluseos
(Mexico); LACM, Natural Histoiy Museum of Los
Angeles County; SBMNH, Santa Barbara Museum of
Natural Histoiy; UF, Florida Museum of Natural His-
tory, University of Florida.
SYSTEMATICS
Superfamily Urocoptoidea Uit de Weerd, 2008
Family LTrocoptidae Pilsbry and Vanatta, 1898
Subfamily Holospirinae Pilsbry, 1946
Genus Holospira Martens, 1860
Subgenus Holospira sensu stricto
Holospira fergusoni new species
(Figure 1, Table 1)
Diagnosis: Shell medium brown, with a moderately
attenuate cone gradually enlarging into a stout, cylindric
basal region. Armature of three lamellae with greatest
development in antepenultimate or first part of penulti-
mate whorl. Peristome slightly expanded on basal and
columellar margins, otherwise simple.
Description (Figure 1; Table 1): Shell dextral,
cylindroconic, average in size for a Holospira , uniformly
brown in color, whorls 14.5—15.1 in number. Cone
Page 182
THE NAUTILUS, Vol. 124, No. 4
Figure 1. Holospira fergusoni new species. 1. Holotype
(LACM 3112), apertural and side views, shell 14.7 x 4.1 mm.
2. Paratype (CNMO 2562a), shell broken to expose an apertural
view of columella and lamellae, maximum shell width 3.9 mm.
3. Holotype, SEM of embryonic whorls, scale bar = 500 pm.
4. Paratype (CNMO 2562b), shell broken to expose side view of
columella and lamellae, maximum shell width 3.8 mm.
Table 1. Shell measurements (mm.), whorls and number of
lamellae of Holospira fergusoni new species. Mean measure-
ments include holotype. Paratype at SBMNH broken, not
measured. Ap. = aperture; * indicates that apex of shell is
broken off; measurement not used for mean.
moderately attenuate, gradually enlarging into a stout,
cylindric, basal region. Embryonic whorls smooth, 2.6
(holotype) with first 1.6 moderately inflated and steep-
sided. Subsequent whorls of cone about 6.5, gradually
enlarging, convex; costate, with numerous, well-defined.
retractively slanted axial riblets having interspaces about
equal in width to riblets. Whorls of cylindric portion of
spire about 4.5-5.0, fairly equal in size but widest at ante-
penultimate whorl, imperceptibly tapering into whorls of
cone apieally and penultimate and body whorls has ally,
flattened but with marked suture, very slightly wider at
upper margin giving a hint of (upward) overlapping at
suture; riblets less pronounced than on cone (usually
becoming semi-obsolete between whorls of cone and pen-
ultimate whorl), vertical to slightly retracted, thin, numer-
ous (ca. 77 on antepenultimate, 75 on penultimate whorls
of holotype), occasionally discontinuous. Body whorl
barely extended and slightly descending at peristome,
ribbed (or smoothish but becoming ribbed near aperture).
Aperture auriculate (extended at upper-outer angle),
about as wide as high; peristome slightly expanded along
basal and columellar margins, otherwise simple. Umbili-
cus narrowly perforate.
Internal column, hollow, narrow in apical two-thirds of
shell; slowly increasing in diameter as animal grows to
adulthood (about 0.15—0.18 times width of shell at pen-
ultimate whorl); trilamellate. Greatest development of
armature occurs in antepenultimate or first third of pen-
ultimate whorl. Columellar lamella large, thick, arising
slightly below mid-whorl and extending laterally at least
0.5 times width of lumen in first part of penultimate
whorl, becoming sinuous at maximum development,
tapering and spiraling basally through first half of body
whorl. Parietal lamella a smooth (nonserrated), pendant,
wide band, very slightly reflected toward outer wall of
shell in last half of antepenultimate and first half of
penultimate whorls, sometimes occluding view of colu-
mellar lamella (Figure 1, lower right image), becoming
reduced in last half of penultimate whorl, then decreased
to a low crest in first half of body wborl. Basal lamella a
short, low, rounded arch. Palatal lamella lacking.
Type Material: Holotype: LACM 3112; Paratypes:
CNMO 2562 a, b (two shells); SBMNH 84922 (one
shell); UF 425856 (one shell).
Other Voucher Specimens: CNMO 3168, Helicina
sp. (one shell); CNMO 3169 Omphalina sp. (6 shells).
Type Locality: MEXICO, Coahuila, Municipio
Arteaga; Sierra La Viga, 0.5 km E of summit, 25°21/35"
N, 100° 33'15" W; elevation 3,600 m. The site is approx-
imately 55 km ESE of Saltillo, near the border with the
state of Nuevo Leon. Shells of the new species were
found under boulders on the North-facing slope of a
limestone ridge. In addition, a shell of Helicina sp. and
several shells of Omphalina sp. were found at the site.
The area is forested with the dominant plant species
being Pinus hartwegii. The site is rather difficult to
get to.
Etymology: The new species is named after George
M. Ferguson of the University of Arizona, Tucson, who
collected the shells. A herpetologist by training, his inter-
ests also include plants and mollusks. He has always
L. H. Gilbertson and E. Naranjo-Garcfa, 2010
Page 183
shared his landsnail collections from remote places
with ns.
Remarks: The unique internal lamellae of Holospira
species are typically used as characters for taxonomic
purposes. Several subgeneric and section taxa have been
based solely on the number and combinations of these
lamellae, leading to a confusing array of names and even-
tual synonymies. Classically, the nominate subgenus (or
“section”) has been defined by the presence of all four
lamellae in the penultimate whorl (Dali, 1895; Pilsbry,
1903, 1946). Additional section names were erected (pri-
marily in the U.S.) for species having 0, 1, or 2 lamellae
(Dali, 1895). Bartsch (1906) proposed the subgenus
Tristemma for trilamellate species (Type species:
Holospira ferrissi Pilsbry, 1905; Arizona) and later
(1945) replaced it (preoccupied name) with Malinchea.
Pilsbry (1946), noting that no external shell character is
correlated with the number of lamellae, and that several
U.S. species such as H. ferrissi exhibit widely variable
numbers (1—3), synonymized Tristemma, Malinchea ,
and others with the subgenus Bostrichocentrum Strebel,
1880. A few years later, he (Pilsbry, 1953) stated that “the
supposed subgenera based on the number of internal
lamellae merely represent parallel stages in evolution.”
Under the heading of “ Holospira s.str.,” he suggested
that four trilamellate Mexican species of Tristemma and
Malinchea described by Bartsch should be . .viewed
as species of Holospira which have lost that (palatal)
lamina, and not relatives of H. ferrissi of Arizona. . .”
He proceeded to describe a trilamellate species,
H. maxwelli, and place it in Holospira s.s. (however,
leaving Bostrichocentrum unchanged). At the same time,
he introduced subgenus Prionoloplax for a trilamellate
species that exhibits a serrated parietal lamella. Bequaert
(Bequaert and Miller, 1973) working in Arizona, synony-
mized Tristemma and Malinchea (and others) with a
bilamellate subgenus, Eudistemma (Dali, 1895). Later,
Sehileyko (1999) synonymized Tristemma, Malinchea ,
Bostrichocentrum and Eudistemma (and others) with
Holospira sensu strieto. Thompson and Mihalcik (2005)
assigned several trilamellate species from southern
Mexico, to Holospira sensu strieto. More recently,
Thompson (2008) listed Eudistemma, Tristemma, and
Malinchea as synonyms of the nominate subgenus. Based
on the foregoing, the trilamellate H.fergusoni new spe-
cies is presently assigned to Holospira sensu strieto.
The new species resembles the tetralamellate
Holospira (H.) amalthea Bartsch, 1926 from nearby
Monterrey, Nuevo Leon. Holospira amalthea exhibits
a similarly shaped, brown shell that has the greatest
development of its lamellae in the antepenultimate
whorl. Tl rese lamellae are generally comparable to those
of H. fergusoni new species, except that the parietal
is decidedly out-curved at its free margin, the basal is
more strongly developed, and the palatal is present
(and strong). Holospira amalthea also differs by having
a broadly expanded and reflected outer lip of the
peristome.
Holospira fergusoni new species also shows some sim-
ilarities to Holospira (H.) nelsoni and H. (H.) infanta
Bartsch, 1906 from the Sierra Guadalupe, a range
approximately 50 km W of Saltillo. However, H. nelsoni
is larger, white in color (with blue Hecks), and has a more
rounded spire than that of the new species. Holospira
infanta is similar to H. nelsoni but much smaller. The
shells of both species have all four lamellae contained
primarily in the penultimate whorl.
It is noteworthy that the reproductive system of
H. nelsoni is the only published account of this system
from a species assigned to Holospira sensu strieto living
in this region (Pilsbry, 1903). Although different in cer-
tain respects, it shows similarities to that of H. ferrissi
(type of Tristemma) and similar nearby U.S. species
(i.e. Eudistemma sensu Bequaert and Miller) with regard
to the presence of longitudinal internal penial folds
(showing through), a long epiphallus, a similar appearing
spermatheca, and the presence of a spermatheeal diver-
ticulum (see Gilbertson, 1993; Sehileyko, 1999). Hope-
fully, additional descriptions of reproductive systems
from species inhabiting this region will be available in
the near future.
ACKNOWLEDGMENTS
We thank Lred G. Thompson at UL for kindly offering to
review the manuscript prior to submission, Carmen
Loyola-Bianco of the Instituto de Biologia for the
photograph of paratype CNMO 2562b, Scott N. Gilbertson
for assistance with computer formatting and graphics, and
Gair-Ann Kung for assistance with the scanning electron
microscope. SEM microphotography at LACM was made
possible through NSL grant DBf - 0216506.
LITERATURE CITED
Bartsch, R 1906. The urocoptid mollusks from the mainland of
America in the collection of the United States National
Museum. Proceedings of the United States National
Museum 31: 100-160; pis. 3-5.
Bartsch, P. 1926. New urocoptid land shells from Mexico.
Proceedings of the United States National Museum 70:
1-13; pi. 1.
Bartsch, P. 1945. New urocoptid Mollusks from Mexico. Journal
of the Washington Academy of Sciences 35: 92-95; 5 figs.
Bequaert, J.C. and W.B. Miller. 1973. The Mollusks of the arid
Southwest with an Arizona Check List. The University of
Arizona Press, Tucson, i-xvi + 271.
Dali, W. H. 1895. Synopsis of the subdivisions of Holospira and
some related genera. The Nautilus 9: 50-51.
Gilbertson, L. PI. 1993. Reproductive anatomies of Holospira
spp. (Gastropoda: Urocoptidae) from Arizona and Sonora
with a new subgenus and a new subspecies. American
Malacological Bulletin 10: 71-81.
Martens, E. von. 1860. In: Albers, |.C. Die Heliceen, nach
natiirlicher Verwandtschaft systematiseh geordnet. Edi-
tion 2. Wilhelm Engelmann, Leipzig, 359 pp.
Pilsbry, II. A. 1903. Urocoptidae. Manual of Conchology.
Series 2, 15: i-viii + 1-323.
Page 184
THE NAUTILUS, Vol. 124, No. 4
Pilsbry, H.A. 1905. Mollusca of the Southwestern States. I.
Urocoptidae; Helicidae of Arizona and New Mexico.
Proceedings of the Academy of Natural Sciences of Phila-
delphia 57: 211-290, pis. 11-27.
Pilsbry, H.A. 1946. Land Mollusca of North America (north of
Mexico). Academy of Natural Sciences of Philadelphia,
Monograph 3, II, 520 pp.
Pilsbry, H.A. 1953. Inland Mollusca of Northern Mexico. II.
Urocoptidae, Pnpillidae, Strobilopsidae, Valloniidae, and
Cionellidae. Proceedings of the Academy ol Natural Sci-
ences of Philadelphia 105: 133-167, pis. 3-10.
Pilsbry, H.A. and E.G. Vanatta. 1898. Materials toward a natural
classification ol the eylindrelloid snails. Proceedings of the
Academy of Natural Sciences of Philadelphia 50: 264—286.
Rehder, H.A. 1940. A new uroeoptid mollusk from Mexico. Jour-
nal of the Washington Academy of Sciences 30: 31.5—316.
Sehileyko, A. A. 1999. Treatise on recent terrestrial pulmonate
molluscs. Part 3. Ruthenica, supplement 2: 263-436.
Strebel, H. 1880. Beitrag zur Kenntniss der Fauna mexi-
kanischer Land-und Siisswasser-Conehylien. Pt. IV.
Hamburg, 122 pp., 15 pis.
Thompson, F.G. 2008. An annotated checklist and bibliogra-
phy of the land and freshwater snails of Mexico and
Central America. http:/Avww.flmnh. nll.edu/malacology/
mexico-central_america_snail_checklist/
Thompson, F.G. and E.L. Mihalcik. 2005. Uroeoptid landsnails
of the genus Holospira from southern Mexico. Bulletin of
the Florida Museum of Natural History 45: 63-124.
Uit de Weerd, D.R. 2008. Delimitation and phylogenetics
of the diverse land-snail family Urocoptidae (Gastropoda:
Pulmonata) based on 28 rRNA sequence data: a reunion
with Cerion. Journal of Mollusean Studies 74: 317-329.
THE NAUTILUS 124(4): 185-187, 2010
Page 185
Rolleia oberi new species— first record of the genus from the
Dominican Republic, with a lectotype designation of Cyclotus
martensi Maltzan, 1888 (Gastropoda: Annulariidae)
G. Thomas Watters
1315 Kinnear Road
Ohio State University
Columbus, OH 43212 USA
[email protected]
Glenn Duffy
5679 Old Ranch Road
Sarasota, FL 34241 USA
ABSTRACT
The annulariid genus Rolleia Crosse, 1891, previously known
only from Haiti, is recorded here from the Dominican Repub-
lic: Rolleia oberi new species. The syntype lot of a second
Rolleia , Cyclotus martensi Maltzan, 1888 was found to consist
of three different species. A lectotype is herein designated.
INTRODUCTION
Bartsch (1946) listed over 200 nominal species of
annulariids for Hispaniola; only Cuba contains more taxa
of this family. Nevertheless, an examination of Bartsch s
localities reveals that there are areas of Hispaniola that
had not been adequately studied and that will undoubt-
edly prove to harbor additional, new taxa. The northern
provinces of the Dominican Republic and the western
half of the Barahona Peninsula are such areas. Recent
collections in these regions have revealed not only new
species but range extensions of Haitian genera. This
study describes a new Dominican Republic species of
the “Haitian” genus Rolleia. Abbreviations: BMSM: The
Bailey- Matthews Shell Museum, Sanibel, Florida, USA;
OSUM: Ohio State University Museum of Biological
Diversity, Columbus, Ohio, USA; UF: Florida Museum
ol Natural History, Gainesville, Florida, USA; ZMB:
Museum fur Naturkunde Berlin, Germany.
Rolleia Crosse, 1891
Type Species: Cyclotus martensi Maltzan, 1888, by orig-
inal designation
Rolleia oberi new species
(Figures 1-6)
Description: Shell small-sized for family (holotype
8.1 mm maximum length, including peristome x 10.3 mm
maximum width, including peristome), thin, fragile, some-
what depressed helicoid, umbilicus very wide (holotype
36 % ol maximum width), circular until final whorl,
then elliptical, all whorls visible in umbilicus. Protoconch
whorls 1.5, not demarcated from teleoconeh, smooth,
minute but prominent. Teleoconeh of 3. 0-3. 5 whorls, last
l/8th turn free from previous whorl and deflected anteri-
orly. Suture impressed. Peristome double, circular (holo-
type 3.0 mm diameter maximum inner aperture height x
3.1 mm diameter maximum inner aperture width; holo-
type 4.3 mm diameter maximum outer peristome height,
somewhat broken x 4.6 mm diameter maximum outer
peristome width, somewhat broken). Outer lip thin,
expanded perpendicular to whorl, narrowest facing umbi-
licus, touching previous whorl in well-preserved spec-
imens. Inner lip protruded, tube-like, prominent. Inner
lip bears same axial sculpture and appears as only a con-
tinuation of body whorl beyond juncture of outer lip.
Spiral sculpture absent. Axial sculpture of regularly
spaced, narrow lamella (ca.100 on final whorl), interstices
smooth. Suture broken by axial lamella. Teleoconeh dirty-
white or crystalline, most specimens without any apparent
pattern although some show faint tan rays on outer lip.
Nuclear whorls may have a brown peripheral band. Oper-
culum thin, multispiral with wide lamellum, originating
peipendicularly to basal plate, then curling outward to
parallel basal plate. Anatomy and radula unknown.
Type Material: Holotype: UF 434775, Dominican Re-
public, Puerto Plata Province, La Has, El Puerto, on the
road about half way between Santiago and Puerto Plata,
at altitude 830-1000 m in the Cordillera Septentrional;
Paratypes: UF 434776 (9.7 mm maximum length, includ-
ing peristome x 9.2 mm maximum width, including
peristome), UF 434776, (6.1 x 5.0 mm, juvenile), UF
434776, (6.0 mm x 5.0 mm, juvenile), BMSM 17970
(6.7 x 8.2 mm), BMSM 17970 (7.3 mm x 10.0 mm),
OSUM 35489 (2 specimens, 7.4 x 9.2, 7.9 x 10.1 mm),
all from the type locality.
Other Material Examined: Watters collection, GTW
14180a, 2 specimens (1 juvenile), from type locality.
Page 186
THE NAUTILUS, Vol. 124, No. 4
Figures 1—6. Rolleia oberi new species, all from the Dominican Republic, Puerto Plata Province, La Has, El Puerto, on the road
about half way between Santiago and Puerto Plata, at altitude 830—1000 m in the Cordillera Septentrional. 1—4. Holotype UF
434775, 10.3 mm maximum width. 5. Paratype UF 434776, 9.2 mm maximum width. 6. Paratype OSUM 35489, 9.2 mm maximum
width. 7 9. Holotype USNM 504088 of Rolleia haitensis Bartsch, 1946, from Ennery, Haiti, 15.1 mm maximum width. 10, 11.
Leetotype ZMB 40725a of Cyclotus martensi Maltzan, 1888, from Plaisance, Haiti, ca. 15 mm maximum width. Courtesy Malacolog-
ieal Collection, Museum fur Naturkunde Berlin, Leibniz Institute for Research in Evolution and Biodiversity at the Humboldt
University [photography L. Maitas],
G.T. Watters and G. Duffy, 2010
Page 187
Comparison with Similar Species: Rolleia oberi dif-
fers from both Rolleia haitensis Bartsch, 1946 and
Rolleia martensi (Maltzan, 1888) in having a higher
spire, axial sculpture developed into sharp lamellae
rather than low threads, and in the more laterally pro-
duced outer lip.
Distribution: Known only from the type locality. Rolleia
was previously known only from two species, R. haitensis
and R. martensi, both from the Ennery-Plaisance region
of the Massif du Nord of Haiti. Rolleia oberi occurs ca.
200 km to the east in the Cordillera Septentrional of the
Dominican Republic; this is the first record of the genus
from that country.
Discussion: Maltzan (1888) described Cyclotus martensi
from “Plaisance in parte boreali insulae Haiti” widiout
illustration. Bartsch (1946: 141), in his discussion of
that species, makes no mention of having seen the type
material but based his description of it on USNM spec-
imens “collected by Orcutt on limestone rocks 40 miles
south of Cap-Haitien.” Bartsch may have based his iden-
tification on the illustration of Crosse (1891: pi. 2, fig. 4)
although there is no evidence that Crosse had seen the
type lot either. (Wenzs [1939: fig. 1471] illustration of
C. martensi is too crude to be positively identified).
Bartsch then described Rolleia haitensis (Figures 7—9)
from Ennery, with additional localities of “on the moun-
tain summit between Ennery and San Michel,” “14 miles
north of Gonaives,” “15 miles north of Gonaives,” and
“on Peterborough Mountain” (1946: 142). All of these
sites are within a fairly close distance of each other in
the Massif du Nord.
The syntype lot of Cyclotus martensi at ZMB consists
of six specimens that were the combination of Maltzan s
lots 40725 and 41177 (now both 40725). Lot 40725 is
from Plaisance-Gona'ives, lot 41177 is from Plaisance.
Which of the six specimens originally went with which
lot is not known. This combined lot contains all three
species of Rolleia, including the new species described
here: four specimens of C. martensi and one specimen
each of Rolleia haitensis and Rolleia oberi. With the
exception of shell size, Maltzan ’s original description has
little to identify which of the six specimens was used to
describe C. martensi. But he gave the “Diam. maj.” as
14-16 [mm], apparently including more than one speci-
men. This eliminates his specimen of R. haitensis, which
is only 11 mm in maximum diameter, as well as his
specimen of R. oberi, which is only 10 mm. The
remaining specimens are indeed all between 14 and
16 mm in maximum diameter and therefore are the
only specimens in the type lot that could respresent
C. martensi. To avoid future confusion we designate
ZMB 40724a as the lectotype (Figures 10, 11) of Cyclotus
martensi and the remaining three specimens (ZMB
40725b) as paralectotypes. In addition we remove the
specimens of R. haitensis and R. oberi from the type series
of Cyclotus martensi.
What remains to be explained is how a specimen of
R. oberi (and R. haitensis) ended up in the type lot of
C. martensi. Maltzan’s only paper on annulariids de-
scribed species from Haiti collected by the German shell
dealer Hermann Rolle in 1887—88. Rolleia oberi is not
known from the Massif du Nord where R. haitensis or
R. martensi are recorded, nor from Haiti in general.
Unless R. oberi occupies a much larger area than
described here, which is unlikely, it must be the case that
additional lots were somehow mixed.
Etymology: Named for Jim Ober, who assisted CD in
the collection of the specimens.
ACKNOWLEDGMENTS
We thank Lothar Maitas, Museum fur Naturkunde,
Leibniz Institute for Research on Evolution and
Biodiversity at the Humboldt University Berlin, for
information and images of the syntype lot of Cyclotus
martensi; Yolanda Villacampa (National Museum of
Natural History, Smithsonian Institution) for images of
the ho! o type of Rolleia haitensis Bartsch, 1946; and
Dr. Fred Thompson (UF) and an anonymous reviewer
for commenting on the manuscript.
LITERATURE CITED
Bartsch, P. 1946. The operculate land mollusks of the family
Annulariidae of the island of Hispaniola and the Bahama
Archipelago. Bulletin of the U. S. National Museum 192:
264 pp., 38 pis.
Crosse, H. 1891. Faune malaeologique terrestre et fluviatile de
file de Saint-Domingue. Journal de Conchyliologie 39:
73-210.
Maltzan, II.F. von. 1888. Diagnosen neuer Landschnecken
von Haiti, gesammelt von Hermann Rolle 1887-1888.
Nachrichtsblatt der deutschen Malakozoologischen Gesell-
schaft 20: 177-182.
Wenz, W. 1939. Gastropoda. Handbuch der Palaozoologie.
Pp. 484-720. Allgemeiner Teil und Prosobranchia. 6(3).
Gebriider Borntraeger, Berlin.
THE NAUTILUS 124(4): 188-191, 2010
Page 188
Las Conchas Azules (The Blue Shells):
Father Kino, abalones, and the Island of California
Dedicated to Helen DuShane (1907—2002)
Hans Bertsch1
Departamento de Ingenierfa en Pesquerfas
Universidad Autonoma de Baja California Sur
La Paz, BCS, MEXICO
[email protected]
The First International Conference on the Zoogeography
of N ortheast Pacific Abalones was convened by the Italian
Jesuit, Father Eusebio Francisco Kino, 30 April-1 May
1700. It was held at Bac («32° 06' 20" N; 1110 00' 30" W),
the largest Sobaipuri village on the Rio Santa Cruz, in
the Spanish Gobemacion of Nueva Vizcaya. Also in atten-
dance were members of the Pima (= O'oclham), Opata,
and Cocomaricopa nations, discussing the origin of aba-
lone shells obtained in trade from the Yuma and Cutgane
peoples of the Colorado River. These beautiful items were
called the blue shells (las conchas azules).
Studies of molluscan biogeography are dependent
upon good mapping and correct identification of locali-
ties. Numerous cases in the literature report erroneous
type localities, and misnamed or improperly described
collecting areas. Tenacious beliefs in a mythical place can
replace or suppress topographic evidence. This paper
describes a curious instance of how proper documenta-
tion of the distribution of a mollusk changed the maps of
an area.
“I hold it to be very certain and proven that the whole
kingdom of California, discovered on this voyage, is the
largest island known or which has been discovered up to
the present time” (Father Antonio de la Ascencion, from
his journal written during Vizcaino’s 1602 voyage along
the coasts of the modern three Californias, from Cabo
San Lucas to Monterey, although they never found its
northern terminus). Earlier, Juan Rodriguez Cabrillo
had made the first voyage along the Pacific coast
(1542—1543), reaching Cape Mendocino, seeing land
during the entire journey. But the mythical Calafia
would not disappear. Despite Francisco de Ulloa’s
(1539) sailing the Sea of Cortez entirely to its northern
end, and Juan de Ohate’s 1604—05 descent ol the Colo-
rado River to a view of the Sea of Cortez, in the 1500 and
1600s the commonly held (and mapped) European
belief was in the insular status of California.
1 192 Imperial Beach Blvd. # A. Imperial Beach, CA 91932
USA
Thirty years of explorations, missionary activities and
mapping throughout Lower California and the Pimerfa
Alta by Father Eusebio Kino, S.J., dealt the final and
complete blow to the “island of California.”
Father Kino’s two missionary efforts in California at
La Paz (Spring— Summer 1683) and San Bruno (October
1683— May 1685) were religious failures. However, dur-
ing his 20 months at Mision San Bruno (north of present-
day Loreto), he made several expeditions westward
trying to cross the steep and forbidding barrier of the
Sierra de la Gigante. Having gotten directions from the
regional Cochirm inhabitants, he traversed passes, arroyos
and stream beds drat finally led him to the shores of the
Pacific Ocean on 30 December 1684, his third attempt.
The explorers named the site Bahia Ano Nuevo, but today
it is known as San Gregorio (approximately 26°03' N;
112° 17' W). Meandering along the beach, he chanced
upon some large, beautiful blue shells.
Returning to mainland Mexico, he was assigned to
missionary work in the Alta Pimeria (north-central
Sonora and southwest Arizona). While laboring among
the various Pima peoples for years, he harbored a zeal-
ous concern for the establishment and provisioning of
missions in Lower California.
During 21—23 February 1699, while preaching to the
Pimas and Yumas at San Pedro (near the junction of the
Gila and Colorado Rivers), Kino first saw the blue aba-
lone shells on the mainland, which he had originally seen
14 years earlier on the Pacific coast of Lower California.
He wrote in his journal, “These natives of San Pedro in
the two days when we were with them gave us various
beautiful blue shells, which, so far as I know, are found
only on the opposite or western coast of California.
Afterward it occurred to me that not very far distant
there must be a passage by land to near-by California”
(Bolton, 1919: 195—196; hereafter cited as MPA) which
would provide a possible land route to provision the mis-
sions of Lower California.
He had previously made expeditions to the northern
Gulf, and had seen “plainly that that arm of the sea kept
H. Bertsch, 2010
Page 189
getting narrower,” and even “descried most plainly both
with a telescope and without a telescope the junction of
these lands of New Spain with those of California, the
head of this Sea of California.” When the natives gave
him the blue shells, “still it did not occur to me that those
blue shells must be from the opposite coast of California
and the South Sea, and that by the route by which they
had come thence, from there to here, we could pass from
here thither, and to California” (MPA: 229—230).
A few months later. Kino took 10 Pimas and 53 mules
and horses north from his home mission at Dolores to
found Mision San Xavier del Bac (near present-day Tuc-
son). He dispatched various messengers throughout the
surrounding nations of indigenous people, “to learn with
all possible exactness in regard to the blue shells and the
passage by land to California” (MPA: 234-235).
The participants at this First International Conference
on the Zoogeography of Northeast Pacific Abalones
all asserted that these blue shells “came from the oppo-
site coast of California and from the sea which is ten
or twelve days’ journey farther than this other Sea of
—3 Wu*
| > "
1 JJen Triaxti* Con*/, if S3- {tft •. •A’v-’ j
ji Ef C*" Y, & * U',en.. l,**-f*
-T L Thr W . F*r tmk. S
' TictS fAJi** itUuni ttf./*# *
’ » A SrfSaiMft * iJtei. t 'atM M "Tt/t/t UMf*
-4 i. Mf^y-
; YiCtr" ^ i(b. 'mJ’ tm •*“" ' u .
i ZJOr'JV **«'“> Otug* / >Mrr »/• •**» kj Un.
jj St+*JL **1. J '*1 ;(3+.
r ' EtCjfr U /+-•>
i EJ Grr ' ** CUxlrt- 'latt Celtio Jt CfStt z <*.'/*.
tj utiCZr f-C, e~' It JL'ry. J
J! El AIm1”*0 Dta 1.J— Ci&uli ffn.lfc
, 6. U r •***:’*) **=>. »*. *H*m.
1 it* if ?t*f “ ^ ^
“ Jl Al*'"**1 rnXfwX 1 trmtl L XiuJn/ JtS,
n «- ^ -*'*■«
, >* •
_ riCf TnatHu, tmumA' iff*- ~
i • a '&•*
” - <• i »f» C«t»»
£lti Hit ■•tJtttt
■- *** oT.r,.y^
T'*vr
i «- <J- A».» W- , *
U» II J- *t>T
j) i*
J rt It <*T
4 A if#*- ■*«««. ^ SZtofir,,.
■J} ***— — *4* 2f gU-vt Z,
» /■. f £ /wm »r it An" it-
A L,*,, —'»' «/ ***-}£•«**&*$* 5
Figure 1. Father Eusebio Francisco Kino’s 1695 map, show-
ing Lower California as an island (from Burrus, 1965).
California, on which there are shells of pearl and white,
and many others, but none of those blue ones” (MPA:
237-238).
After several more expeditions to the Gulf of Califor-
nia, he had assembled his evidence of the “peninsularity”
of Lower California: presence on the mainland of the
blue shells from the west coast of the peninsula, sightings
from the junction of the Gila/Colorado Rivers showing
no intervening body of water to separate the two regions,
and statements of the indigenous people living near the
head of the Gulf.
In late 1701, he redrew his earlier 1695 “insular” map
(Figure 1). After it was printed in 1705 (Figure 2), it
became one of the best known maps of northern New
Spain. That Lower California was a peninsula was never
again in doubt.
Joshua L. Baily, Jr. (1935), wrote that “the first collec-
tion of west coast shells was the work of Father Eusebio
Francisco Kino,” predating the conchological efforts
of Cook and Martyn (in 1784), Dixon (1789) and
Eschscholtz (1822), which had been cited by Philip P.
Carpenter as the first collectors. Baily based his com-
ments on Eldridge (1915), apparently unaware of
Bolton’s publication of MPA. Although writing that
“We do not even know what the shells were, for his
description — ‘beautiful blue shells’ — is too meager to be
considered anything but a nomen nudum,” he tried to
“make a pretty good guess” (Baily, 1935: 75). Baily iden-
tified the species as Olivella biplicata (Sowerby, 1825)
for three reasons:
Figure 2. Father Kino’s 1701 map (first published in 1705)
showing Lower California as a peninsula (from Burrus, 1965).
Page 190
THE NAUTILUS, Vol. 124, No. 4
• It is “the most popular shell for wampum purposes
among the Indians of Arizona today”;
• "The lower part of the columella is almost universally
azure tinted”; and
• Its geographic distribution (ranging southward along
the California Pacific coast to Bahia Magdalena;
absent from the Gulf).
However, statues of Kino in Hermosillo, Sonora, Mexico,
and in his hometown of Segna, Italy, depict him on horse-
back, holding an abalone shell (illustrated in Polzer,
1998: 192-194). The plaza mural near his gravesite at
Magdalena de Kino (Figure 3) shows him with an abalone
shell in his hand. I concur with historians, artists, civic
leaders and others that the “beautiful blue shells” were
abalone:
• There are several species of Olivella occurring in
the Gulf of California, which have distinct purple
apertural coloring, e.g., Olivella clama (Wood, 1828) =
Oliva purpurata Swainson, 1831). In the 16th century,
relying on a 14-year-old memory, an untrained ama-
teur shell collector such as Kino could not have dis-
tinguished between different species ol Olivella with
similar whitish or light gray outer coloration, and purple
on the inside.
• Size matters. Abalones are impressive, large shells,
much bigger than the 20—27 mm long Olivella
biplicata. Kino had sent Father Marcos Antonio
Kappus (Rector of the College of Matape) several of
his "blue shells,” for which Kappus wrote him, “I
esteem the blue shells, and especially the large one,
which is a truly rare piece” (MPA: 259—260). The de-
scription in Kino’s (MPA) and Manje’s (Burrus, 1971)
journals of these expeditions clearly emphasize both
their uniqueness (which would not be the case among
similarly colored Olivella congeners) and size.
• Eighteenth Century Accounts. While serving in Baja
California from 1737-1768, Miguel del Barco investi-
gated the plants, animals and minerals of the penin-
sula. He wrote about the blue shells: “On the exterior
coast there are found some shells, proper to it, which
are perhaps the most beautiful in the world. This is
because their luster usually is greater anti finer than
that of the finest mother-of-pearl. These shells are
darkened and covered with a pleasant and extremely
vivid blue. . . These shells are somewhat deeper than
Figure 3. Mural of Father Kino, holding an abalone shell, with depictions of cattle and crops that represent farming skills he
introduced to the Pima nations, and tongues ol flame symbolic ol his linguistic skills and missionary endeavors. Monument at the
Main Plaza in Magdalena de Kino, Sonora, Mexico.
H. Bertsch, 2010
Page 191
ordinary, and on one side only they have five or six
round holes” (Barco, 1980: 249—250).
• Ignacio Tirsch, missionary in Lower California from
1762—1768, made the only eyewitness drawings of
the plants and animals of the peninsula in Jesuit times.
His drawings of California sea shells (Tirsch, 1972)
clearly illustrate an abalone, labeled “ concha azul.”
• Historians have considered these magnificent shells to
be abalone (e.g., Burrus, 1971: 114; Note 5, Barco,
1980: 249; and Polzer, 1998: 66-70).
• The most likely species-level identification of the spec-
imens is Haliotis fulgens Philippi, 1845, which is char-
acterized by an “interior highly iridescent, chiefly blue
with overtones of pink and green” (McLean, 1978).
Abalones are distinct, and are obviously present on the
Pacific Californian coastline, and similarly absent in the
Gulf of California. Father Kino’s training as a cartogra-
pher, mathematician, and scientist served him well. His
studies on Comet Kirch (Kino, 1681), although unabash-
edly Aristotelian in its views, were one of the earliest
scientific works published by an European in the
Americas. Because ol his astute observations and rea-
soned questioning, abalones, the geography of Califor-
nia, and a Jesuit priest are inextricably interwoven.
LITERATURE CITED
Baily, Jr., J.L. 1935. The first Pacific conchologist. The Nautilus
48: 73-75.
Barco, M. del, S.J. 1980. The Natural History of Baja Califor-
nia. Dawson's Book Shop, Los Angeles, 298 pp.
Bolton, H.E. 1919. Kino’s Historical Memoir of Pimerfa Alta:
A Contemporary Account of the Beginning ol Califor-
nia, Sonora, and Arizona, by Father Eusebio Francisco
Kino, S.J., Pioneer Missionary Explorer, Cartographer,
and Ranchman, 1683—1711. The Arthur H. Clark Com-
pany, Cleveland, Volume I: 379 pp.; Volume II: 329 pp.
(Note: This is the Bolton translation of Kino’s journal
and diary.)
Burrus, E.J., S.J. 1965. Kino and the Cartography of North-
western New Spain. Arizona Pioneers’ Historical Society,
Tucson, 104 pp.
Burrus, E.J., S.J., 1971. Kino and Manje: Explorers of Sonora
and Arizona. Their Vision of the Future. A study of their
Expeditions and Plans with an Appendix of Thirty Docu-
ments. Sources and Studies for the History of the
Americas. Volume X. Jesuit Historical Institute, St. Louis,
xi + 793 pp.
Eldridge, Z.S. 1915. History of California: The Rise and Pro-
gress of an American State. New York, The Century His-
tory Company. 5 volumes, [not seen]
Kino, E.F. 1681. Exposition Astronomica de el Cometa, que el
Ano de 1680, por los meses de Noviembre, y Diziembre,
y este Ano de 1681, por los meses de Enero y Febrero, se
ha visto en todo el mundo, y le ha obseivado en la Ciudad
de Cadiz. F. Rodriguez Lupercio, Mexico.
McLean, J. H. 1978. Marine Shells of Southern California. Nat-
ural History Museum of Los Angeles County, Science
Series 24, 104 pp.
Polzer, C.W., S. J. 1998. Kino, A Legacy: His Life, His Works,
His Missions, His Monuments. Jesuit Fathers of Southern
Arizona, Tucson, x + 198 pp.
Tirsch, I., S.J. 1972. The drawings of Ignacio Tirsch, a Jesuit
Missionary in Baja California. Introduced and edited by
Doyee B. Nunis, Jr. Dawson’s Book Shop, Los Angeles,
125 pp.
The date of publication of section 16,
corrigenda quaedam et addenda ,
of Dunker’s Novitates Conchologicae ,
Series II, Marina Mollusca
Although the date 1870 was printed on the title page of
the final section of Dunker’s Novitates Conchologicae,
Series II, Marina Mollusca, (section 16, corrigenda
quaedam et addenda), that section was erroneously
dated 1878 in Johnson’s (1969) collation of the work.
Johnson’s date was based on dated wrappers and other
evidence from copies in the library of the Museum
of Comparative Zoology at Harvard University and
in Johnson’s personal library. Pages 137-144 of the
Novitates were received at the Harvard Library on
February 14, 1879, and Johnson’s 1878 date is based
upon this date of receipt. Prior to Johnson’s published
collation, this section was dated variously as 1871 and
1876. The date of publication is significant because Dun-
ker described a new species, Fasciolaria heynemanni,
in the addenda, and this information fixes its date of
description.
The name heynemanni was immediately used and has
been well known since its publication, but no one associ-
ated a date with the name during its first 100 years
except von Martens (1904: 30), who used 1871. After
that citation no others were made (with a date) until
Kilburn (1974: 206) reiterated the 1871 date. Since that
time at least 1 1 authors have variously used the dates
1871 and 1876.
The 1876 date traces to Kobelt in Kiister and Kobelt
(1876: 139), who cited Dunker’s publication and quoted
Dunker’s description; Snyder (2003) cited that usage as
“Drinker in Krister and Kobelt, 1876,” i.e., a citation of
Dunker’s work prior to its later publication, but Abbott
and Dance (1982: 183), Goto and Poppe (1996: 388), and
Mallard and Robin (2005: 8) simply used “Dunker,
1876.” As a further complication, Kobelt (1875: 363)
also cited the name and a figure in his catalogue, evi-
dently anticipating that his larger (1876) work would
be published prior to the catalogue. Ruhoff (1980) is
unclear on this issue. Although she cited dates of 1858-
1870 for Dunker’s Novitates Conchologicae, she did not
include Fasciolaria heynemanni among new names
introduced between 1850 and 1870.
We discovered a reference to Fasciolaria heynemanni
by Tryon (187T. 36) that prompted us to examine the
copy of Dunker’s work in the library of the Academy of
Natural Sciences of Philadelphia. That copy bears a
donation label indicating that it was a gilt of T.B. Wilson.
All gifts to the Academy library are catalogued with the
date of the gift, so it was straightforward to find that
Wilson made his presentation to the Academy in 1871.
Tryon ’s note was published on 1 August 1871, so Wilson’s
gift must have been received earlier that year. Article 21.2
of the International Code of Zoological Nomenclature,
Fourth Edition (1999) states: “The date of publication
specified in a work is to be adopted as correct in the
absence of evidence to the contrary.” Taking into account
the time for sea travel from Germany to Philadelphia,
we believe that this section could have been published
in 1870, as indicated on its title page. As no clear evidence
has been found to indicate an 1871 publication date, we
advocate adoption of the 1870 date as specified by die
Code.
In other taxonomic actions in this section, Dunker
(1871) reclassified Anomalocardia latruncularia Romer
in the genus Crytogramma; placed Mactra liihdorfi
Dunker in synonomy with Mactra sachalinensis Schrenk;
and reclassified Ricinula speciosa Dunker as a variety of
Ricinula reeveana Crosse.
LITERATURE CITED
Abbott, R.T. and S.P. Dance. 1982. Compendium of Seashells.
E.P. Dutton, Inc., New York, x + 411 pp.
Dunker, W. 1858-1871. Novitates Conchologicae. Abtiieilung II,
Meeres-Conchylien. Abbildung und Besehreibung neuer
Conchylien. 144 pp., 45 pis.
Goto, Y. and G.T. Poppe. 1996. Tools in Malacology: A listing ol
living Mollusca. Part II, Vol. 1. L’Informatore Piceno,
Ancona, 520 pp.
International Commission on Zoological Nomenclature. 1999.
International Code of Zoological Nomenclature, Fourth
Edition. International Trust for Zoological Nomenclature,
London, xxix + 306 pp.
Johnson, R. 1. 1969. Pfeiffers Novitates Conchologicae, Series I,
Land Mollusca, 1854-1879, and Dunker’s Novitates
Conchologicae, Series II, Marine Mollusca, 1862-1882.
A complete collation. The Journal of the Society for Bibli-
ography of Natural History 5: 236-239.
Kilburn, R.N. 1974. Taxonomic notes on South African marine
Mollusca (3). Gastropoda: Prosobranchia, with descrip-
tions of new taxa of Naticidae, Fasciolariidae, Magilidae,
Volutomitridae andTurridae. Annals of the Natal Museum
22: 187-220, figs. 1-23.
Kobelt, W. 1875. Catalog der Gattung Fasciolaria Lam.
Jahrbucher der Deutschen Malakozoologischen Gessellschaft
2: 362-364.
Kobelt, W. 1876. Die gesehwanzten unbewehrten Purpurschncken.
Erste Halfte: TurbineMa und Fasciolaria. In: H.C. Kiister and
W. Kobelt (eds.). 1844-1876. Abbildungen nach der Natur mit
Beschreibungen, angefangen von Dr. II.C. Kiister, fortgsetzt
und vollendet [continued and completed] von Dr. W. Kobelt.
Conchylien-Cabinet von Martini und Chemnitz, Krister
edition, Vol. 3: pp. 89-164, pis. 22—32 (published 1876).
Mallard, D. and A. Robin. 2005. Fasciolariidae. Museum du
Coquillages, Les Sables d'Olonne. 27 pp., 70 pis.
THE0NAUTILUS
Volume 124
2010
AUTHOR INDEX
Alencar, L. M. S 44
Alf, A 93
Amano, K 155
Bardan, S 137
Bezerra, F. S. M 44
Biggs, J. S ]
Bodamer, B. L 100
Bouchet, P. 93
Campbell, L. D 41
Campbell, S. C 41
Can, D. N 20
Chichester, L 25
Cornell P. S 1, 129
Criscione, F 117
Delgado, M 175
Duffy, G 185
Espinosa, F 51
Fernandez, M. A 44
Garcia-Gomez, J. C 51
Gilbertson, L. H 181
Hillyard, D 129
Houart, R 112
Introini, G. 0 151
Jones, J. A 77
Kiel, S 155
Maestrati, P. 93
MacalhAes, C. A 151
Moffett, R 112
Mondal, S 137
Morales, T. H 34
Naranjo-Garcia, E 181
Neves, R. | 77
Olivera, B. M 1, 129
Oliveira, C. D. 0 34
Ostrofsky, M, L 100
Ovaska, K 25
Padula, V. 175
Paniia, S 20
Patti, F, P. 117
Petit, R. E 41
Recco-Pimentel, S. M 151
Rivera-Ingraiiam, G. A 51
Sarkar, D 137
Sellanes, | 107
Skoglund, C 55
Sopuck, L 25
SuTCHARIT, C 20
Thiengo, S. C 44
Valentich-Scott, P, 55
Vilvens, C 107
Watkins, M 1, 129
Watters, G. T 185
NEW TAXA PROPOSED IN VOLUME 124
GASTROPODA
Bolma castelinae Axl, Maestrati, and Bouehet, 2010, new species (Turbinidae) 93
Bolmo kreipli Axl, Maestrati, and Bouehet, 2010, new species (Turbinidae) 95
Bolma mainbaza Axl, Maestrati, and Bouchet, 2010, new species (Turbinidae) 95
Bolma pseudobathijraphis Axl, Maestrati, and Bouchet, 2010, new species (Turbinidae) 94
Bolma tantalea Axl, Maestrati, and Bouchet, 2010, new species (Turbinidae) 98
Buchema nigra Fallon, 2010, new species (Turridae) 170
Calliotropis ceciliae Vilvens and Sellanes, 2010, new species (Chilodontidae) 108
Cerberilla potiguara Padula and Delgado, 2010, new species (Aeolididae) 176
Holospira fergusoni Gilbertson and Naranjo-Garcia, 2010, new species (Urocoptidae) 181
Miraclathurella peggijwilliamsae Fallon, 2010, new species (Turridae) 171
Rolleia oberi Watters and Duffy, 2010, new species (Annulariidae) 185
Scabrotrophon liawaiiensis Houart and Moffitt, 2010, new species (Muricidae) 112
Staala Ovaska, Chichester, and Sopuck, 2010, new genus (Arionidae) 28
Staala gwaii Ovaska, Chichester, and Sopuck, 2010, new species (Arionidae) 29
BIVALVIA
Archivesica kannoi Amano and Kiel, 2010, new species (Vesieomyidae, fossil) 159
Archivesica shikamai Amano and Kiel, 2010, new species (Vesieomyidae, tossil) 158
Clidiophora dorsorectus Valentich-Scott and Skoglund, 2010, new species (Pandoridae) 69
Coania Valentich-Scott and Skoglund, 2010, new genus (Pandoridae) 73
Epioblasma ahlstedti Jones and Neves, 2010, new species (Unionidae) 82
Epioblasma florentina aureola Jones and Neves, 2010, new subspecies (Unionidae) 85
Pandora (Pandora) rachaelae Valentieh-Seott and Skoglund, 2010, new species (Pandoridae) 56
Pandora (Pandorella) sarahae Valentieh-Seott and Skoglund, 2010, new species (Pandoridae) 63
Robert H. Cowie
Juan L, Cervera Currado
Marta DeMaintenon
Robert T. Dillon, Jr.
Gregory P. Dietl
Jeff Garner
Daniel Geiger
Daniel Graf
M. G. Flarasewych
Kenneth A. Hayes
Gregory S. Herbert
REVIEWERS FOR VOLUME 124
Yuri Kantor
Kurt Kreipl
Cathy Marlett
P. Graham Oliver
Marco Oliverio
Jeff Nekola
Guido Pastorino
Timothy A. Pearce
Richard E. Petit
Winston F. Ponder
James F. Quinn, Jr.
Andre Sartori
Takenori Sasaki
John Slapcinsky
Richard Squires
Ellen E. Strong
Fred G. Thompson
Donn E. Tippett
Paul Valentich-Scott
Angel Valdes
Janice Voltzow
John Zardus
Sponsored in part by the State of Florida, Department
of State, Division of Cultural Affairs, the Florida Arts
Council and the National Endowment for the Arts.
NATIONAL
ENDOWMENT
FOR THE ARTS
INSTRUCTIONS TO AUTHORS
THE NAUTILUS publishes articles on all aspects of the
biology, paleontology, and systematies of mollusks.
Manuscripts describing original, unpublished research
and review articles will be considered. Brief articles, not
exceeding 1000 words, will be published as notes and do
not require an abstract. Notices of interest to the mala-
cological community will appear in a notices section.
Manuscripts: Each original manuscript and accompa-
nying illustrations should be submitted to the editor pref-
erably via e-mail or as hardcopy in triplicate.
Text must conform to the dimensions of 8 % x 11-incli
paper, double-spaced, and single-column throughout (in-
cluding literature cited, tables, and figure captions). Au-
thors should follow the general recommendations of Sci-
entific Style and Format — The CSE Manual for Authors,
Editors, and Publishers, available from the Council of
Science Editors at www.councilscienceeditors.org. The
first mention of a scientific name in the text should be
accompanied by the taxonomic authority, including year.
Latinized names and other words to be printed in italics
must be underlined; leave other formatting indications to
the editor. Metric, not English, units are to be used. Geo-
chronologic modifiers should be capitalized only when
units are formally recognized: for instance, use Late Cre-
taceous but early Miocene. Likewise, only modifiers of
formally recognized chronostratigraphic units are capi-
talized: use Lower Jurassic but upper Oligocene.
The sequence of sections should be title page, ab-
stract, introduction, materials and methods, results, dis-
cussion, acknowledgments, literature cited, tables, figure
captions, figures. The title page should include the title,
authors name(s) and address(es). If corresponding au-
thor is not the senior author, please indicate. The ab-
stract should summarize in 250 words or less the scope,
main results, and conclusions of the article. Abstracts
should be followed by a list of additional key words. All
references cited in the text must appear in the Literature
Cited section and vice-versa. Please follow a recent issue
of TLIE NAUTILUS for bibliographic style, noting that
journal titles must be unabbreviated. Information on
plates and figures should be cited only if not included
within the pagination of cited work. Tables must be num-
bered and each placed on a separate page. If in doubt,
please follow a recent issue of the journal for sequence of
sections and other style requirements.
Illustrations: Illustrations are x'endered either at full-
page width (maximum width 17 cm) or column width
(maximum width 8.2 cm). Please take these dimensions
into consideration when preparing illustrations. Page-
width illustrations ideally should span the entire width of
printed page (17 cm). “Tall” page-width illustrations
should be avoided, square or “landscape” formats work
better. Please design plates accordingly, such that there
will be enough space left at the bottom of printed page
for plate caption. (Digital technology has made this task
much easier.)
All line drawings must be in black, clearly detailed,
and completely labeled. Abbreviation definitions must be
included in the caption. Line drawings must be high
resolution files at at least 600 dpi (dots per inch) resolution
at actual size. Standard digital formats for line drawings
include .til, .bmp, .psd, .eps, and .pdf.
Photographs may be submitted in black-and-white or
color, preferably in RGB mode if in color. Standard digi-
tal formats for photographs include .tif, .psd, .jpg, or .pdf.
Photographs must be high resolution files at least 300 dpi
resolution at actual size.
If more than one figure is included in an illustration,
all figures are to be consecutively numbered (Figures 1,
2, 3,' NOT Figures 1A, IB, 1C, . . . , NOR Plate 1,
Figure 1, . . .). In illustrations with more than one figure,
make sure that blank areas between figures is kept to a
minimum, thereby allowing for more area for each indi-
vidual figure.
Compressed files (e.g., .jpg) may be used to facilitate
transmission of files during original submission, but may
not be acceptable at final submission (see below).
Voucher Specimens: Deposition of the holotype in a
recognized institutional, public collection is a require-
ment for publication of articles in which new species-
level taxa are described. Deposition of paratypes in in-
stitutional collections is strongly encouraged, as is the
deposition of representative voucher specimens for all
other types of research work.
The Editorial Process: Upon receipt, till manuscripts are
assigned a number and acknowledged. The editor reserves
the right to return manuscripts that are substandard or
not appropriate in scope for THE NAUTILUS. Manu-
scripts deemed appropriate lor the journal will be sent
for critical review to at least two reviewers. The review-
ers’ recommendations will serve as basis for rejection or
continuation of the editorial process. Reviewed manu-
scripts will be sent back to authors for consideration of
the reviewers’ comments. The revised version of the
manuscript may at this point be considered accepted for
publication by the journal.
Final Submission: Authors of accepted manuscripts are
required to submit a final version via e-mail to the editor
at [email protected]. Please do not send low-resolu-
tion or compressed illustration files at this stage. Send any
files larger than 20 Mb on a CD or DVD to the editor.
Proofs: After typesetting, proofs will be sent to the au-
thor. Author should read proofs carefully arid send cor-
rections to the editor within 48 hours. Changes other than
typesetting errors will be charged to the author at cost.
Offprints: An order form for offprints wall accompany
the proofs. Offprints will be ordered through the editor.
Authors with institutional, grant, or other research sup-
port will be asked to pay for page charges at the rate of
$60 per page.
® This paper meets the requirements of ANSI/NISO Z39. 48-1 992 (Permanence of Paper)
puituchmian INSTITUTION LIBRARIES
3 9088 01566 9492
rHE NAUTILUS
slL ,
40 I
, 0 3 i 4
XAJV2-
Volume 125, Number 1
March 24, 2011
ISSN 0028-1344
A quarterly devoted
to malacology.
EDITOR-IN-CHIEF
Dr. Jose H. Leal
The Bailev- Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
BUSINESS MANACER
Rodger Bunnell
The Bailey-Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
EDITOR EMERITUS
Dr. M. G. Harasewych
Department of Invertebrate Zoology
National Museum of
Natural History
Smithsonian Institution
Washington, DC 20560
CONSULTING EDITORS
Dr. Rudiger Bieler
Department of Invertebrates
Field Museum of
Natural History
Chicago, IL 60605
Dr. Arthur E. Bogan
North Carolina State Museum of
Natural Sciences
Raleigh, NC 27626
Dr. Philippe Bouchet
Laboratoire de Biologie des
Invertebres Marins et Malacologie
Museum National d'llistoire Naturelle
55, rue Buffon
Paris, 75005 France
Dr. Robert H. Cowie
Center for Conservation Research
and Training
University of Hawaii
3050 Maile Way, Gilmore 409
Honolulu, HI 96822
Dr. Robert T. Dillon, Jr.
Department of Biology
College of Charleston
Charleston, SC 29424
Dr. Eileen H. Jokinen
8234 E. North Shore Road
Sault Ste. Marie, MI 49783
Dr. Douglas S. Jones
Florida Museum of Natural Histoiy
University of Florida
Gainesville, FL 32611-2035
Dr. Harry G. Lee
4132 Ortega Forest Drive
Jacksonville. FL 32210
Dr. Charles Lydeard
Biodiversity and Systematics
Department of Biological Sciences
University of Alabama
Tuscaloosa, AL 35487
Bruce A. Marshall
Museum of New Zealand
Te Papa Tongarewa
P.O. Box 467
Wellington, NEW ZEALAND
Dr. James Id. McLean
Department of Malacology
Natural History Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Paula M. Mikkelsen
Paleontological Research
Institution
1259 Trumansburg Road
Ithaca, NY 14850 '
Dr. Diarmaid O Foighil
Museum of Zoology and Department
of Biology
University of Michigan
Ann Arbor, MI 48109-1079
Dr. Gustav Paulay
Florida Museum of Natural History
University of Florida
Gainesville, FL 32611-2035
Mr. Richard E. Petit
P.O. Box 30
North Myrtle Beach, SC 29582
Dr. Gary Rosenberg
Department of Mollusks
The Academy of Natural Sciences
1900 Benjamin Franklin Parkway
Philadelphia, PA 19103
Dr. Angel Valdes
Department of Malacology
Natural History Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Geerat J. Vermeij
Department of Geology
University of California at Davis
Davis, CA 95616
Dr. G. Thomas Watters
Aquatic Ecology Laboratory
1314 Kinnear Road
Columbus, OH 43212-1194
SUBSCRIPTION INFORMATION
The subscription rate for volume
125 (2011) is US $54.00 for
individuals, US $88.00 lor
institutions. Postage outside tire
United States is an additional US
$10.00 for regular mail and US
$28.00 for air delivery. All orders
should be accompanied by payment
and sent to: THE NAUTILUS, P.O.
Box 1580, Sanibel, FL 33957, USA,
(239) 395-2233.
Cha nge of address: Please inform
the publisher of your new address at
least 6 weeks in advance. All
communications should include both
old and new addresses (with zip
codes) and state the effective date.
THE NAUTILUS (ISSN 0028-1344)
is published quarterly by The Bailey-
Matthews Shell Museum, 3075
Sanibel-Captiva Road, Sanibel, FL
33975.
Periodicals postage paid at Sanibel,
FL, and additional mailing offices.
POSTMASTER: Send address
changes to: THE NAUTILUS
P.O. Box 1580
Sanibel, FL 33957
THE
CONTENTS
Anders Waren
Tomoyuki Nakano
Javier Sellanes
Phillip J. Fallon, Jr.
Kazutaka Ainano
Robert G. Jenkins
Thomas Kunze
Researeh Note
Arthur E. Rogan
Jeanette Rowers-Altman
Morgan E. Raley
Errata
N A U T
I L U S
Volume 125, Number 1
March 24, 2011
ISSN 0028-1344
A new species of Iothia (Gastropoda: Lepetidae) from Chilean methane
seeps, with comments on the accompanying gastropod fauna 1
Descriptions and illustrations of some new and poorly known turrids
(Turridae) of the tropical northwestern Atlantic. Part 2. Genus Crassispira
Swainson, 1840 subgenera Monilispira Bartsch and Rehder, 1939 and
Dallspira Bartsch, 1950 15
New fossil Bathymodiolus (sensu lato) (Bivalvia: Mytilidae) from Oligocene
seep-carbonates in eastern Hokkaido, Japan, with remarks on the
evolution of the genus 29
Dillwynella voightae new species, a new skeneimorph gastropod (Turbinidae)
from the western Atlantic and a new record of Dillwynella modesta
(Dali, 1889) ' 36
The first confirmed record of the Chinese Pond Mussel ( Sinanodonta
woodiana ) (Bivalvia: Unionidae) in the United States 41
44
Notice
45
THE NAUTILUS 125(1):1-14, 2011
Page 1
A new species of lothia (Gastropoda: Lepetidae) from Chilean
methane seeps, with comments on the accompanying
gastropod fauna
Anders Waren
Swedish Museum of Natural History
Box 50007
SE- 10405 Stockholm, SWEDEN
[email protected]
Tomoyuki Nakano
Department of Geology and Palaeontology
National Museum of Nature and Science
3-23-1, Hyakunin-cho, Shinjuku-ku
Tokyo 169-0073, JAPAN
to m o @kah aku . go . j p
Javier Sellanes
Departamento de Biologia Marina
Universidad Catolica del Norte
Larrondo 1281
Coquimbo, CHILE
and
Centro de Investigation Oceanografica
en el Pacffico Sur-Oriental (COPAS)
Universidad de Concepcion
Concepcion, CHILE
[email protected]
ABSTRACT
A new species of the limpet genus lothia , I megalodon new
species, is described from a cold-seep locality in central Chile.
It differs from other species of lothia by the enlarged func-
tional radular teeth. lothia megalodon feeds on bacterial film
and sediment as indicated by the gut content. lothia
emarginuloides (Philippi, 1868) is re-instated as the name to
be used for the Antarctic-South American species previously
known as lothia coppingeri (E.A. Smith, 1881). A COI analysis
ol eight species of Lepetidae is included to elucidate the
generic position of the new species. The gastropod fauna of
the type locality, the recently discovered bathyal methane
seeps off Central Chile, is reviewed in order to place lothia
megalodon in its ecological context. Margarites liuloti Vilvens,
2006, Bathijbembix macdonaldi (Dali, 1891), Calliotropis
ceciliae Vilvens and Sellanes, 2010, and Cantrainea panamense
(Dali, 1908) are known to have relatives in seeps or other
chemosynthetie environments. The presence of I megalodon
within this community and its gut content support its inclusion
as a member of the seep fauna.
Additional keywords: Molecular phylogeny, Chile
INTRODUCTION
The interest in chemosynthetie environments, hydro-
thermal vents, and various types of seeps has remained
at a high level, ever since the discovery of vents in 1977
(Ballard, 1977; Lonsdale, 1977; Corliss et ah, 1979).
A few years later, the first sulphide seep locality off
Florida (Pauli, 1984) and methane seeps in the Gulf of
Mexico (Brooks, Kennicut and Fay 1985) were discov-
ered. In less than 30 years, these environments have
become fairly well known, much better known than the
surrounding deep-sea. The Gastropoda is richly
represented in seeps and vents, both in number of spe-
cies and specimens (Waren et ah, 2006).
The fauna of vents and seeps to a high extent consists of
species that have been found only in these environments
(van Dover, 2000), more so in the vents. But there are also
species that live in the adjacent deep-sea and seem to be
attracted by the higher biomass and more complicated
biotope, often with rocks, shells, and soft sediments
mixed. To understand the ecology of these biotopes, it is
therefore important to know which ones are its regular
inhabitants and which are occasional intruders. Recogni-
tion of chemosynthetie biotopes is facilitated if this can be
done simply from the presence of certain common genera
or species when less sophisticated methods of investiga-
tion are used, which is the present case.
Already some time ago, species like Calyptogena
australis Stuardo and Valdovinos, 1988 (Bivalvia, caught
by long-line fishery), Bathijbembix macdonaldi (Dali,
1891), and Cantrainea panamense (Dali, 1908) (Gastro-
poda, from side catches during trawling), started to
become available on the commercial shell market. Their
presence indicated that seep bottoms could occur off the
Chilean coast. This was then confirmed by seismic surveys
and trawling off Concepcion in depths between 650 and
930 m (Sellanes et ak, 2004, 2008). So far, these seeps have
been explored only by trawling and tube-coring.
In this paper, we describe a new patellogastropod
from the methane seeps. The terminology largely follows
Lindbergs (1998) review of the Patellogastropoda
( = Docoglossa). To broaden our base for the systematic
placement of the new species, we add some preliminary
results from ongoing work on the phylogeny of the
patellogastropods in hot vents and cold seeps (Nakano
and Waren, unpublished).
THE NAUTILUS, Vol. 125, No. 1
Page 2
To place Iothia megalodon in its ecological context, we
summarize the gastropod fauna known from the
Concepcion seeps, the type locality of I. megalodon ,
since the species have been described in several not
'easily accessible small papers. We review existing and
new information on these species in order to single out
which species may be considered "seep fauna”.
MATERIALS AND METHODS
Chilean Sampling Sites
The seep specimens originate from several hauls with
an Agassiz trawl with an opening of 1.5 x 0.4 m from
R/V Vidal Gormaz, off Concepcion, central Chile. When
the trawl came up, sediment samples were washed on
board, specimens were picked out and preserved in 70%
ethanol.
Cruise VG-03, 36°21.38' S, 74°43.9L W, 980 m depth,
Nov. 2003 (Iothia megalodon , 2 paratypes, SMNH
type collection 6784 and MNHC 6619)
Cruise VG-04, AGT 06, 36°21.75' S, 73°43.55' S, 800 m,
Oct. 11, 2004. ( Cantrainea panamense - 3 specimens,
SMNH 103188)
Cruise VG-04, AGT 13, 36021.9L S, 73°43.2L S, 843-
728 m, Oct. 20, 2004 ( Bathybembix macdonaldi -
2 specimens - SMNH 103189)
Cruise VG-06, AGT 6, 36°21.67' S, 73°43.52' W, 865 m,
Sep. 01, 2006. (Z etela alphonsi - 2 specimens SMNH
103187)
Cruise VG-06 AGT 7-2, 36°32.19' S, 73°40.65' W, 764-
843 m, Sep. 03, 2006 ( Iothia megalodon , 2 paratypes
SMNH type collection 7932)
Cruise VG-07, AGT 10, 36°22.0L S, 73°43.10' W, 764-
843 m, Oct. 02, 2007, ( Iothia emarginuloides - 1 spec-
imen, SMNH 103936; Iothia megalodon , holotype
6617, 1 paratype MNHC 6618, 2 paratypes SMNH
type collection 7933)
Cruise VG-07, AGT 1 1, 36°21.88' S, 73°42.99/ W, 824-
730 m, Oct. 03, 2007 (Margarites huloti Vilvens,
2006 - 3 specimens SMNH 103190, 103192 [dry]).
Work in the area has indicated several active methane
seep sites with assumed chenroautotrophic communities,
with ehemosymbiotic clams like Cah/ptogena , Lucinoma,
and Thijasira (Sellanes et ah, 2004; Holmes, Oliver and
Sellanes, 2005; Oliver and Sellanes, 2005; Sellanes and
Krylova, 2005; Sellanes, Quiroga, and Neira, 2008). In
addition, the heterotrophic fauna has high population
densities within this area, probably benefiting from the
abundance of food and by the habitat heterogeneity gen-
erated by the carbonate reefs associated with methane
seepage (Sellanes et ah, 2008).
Morphology
For the systematic work, specimens of Iothia , Margarites
huloti , Cantrainea panamense, and Zetela alphonsi were
cleaned, soft parts extracted and critical point dried, and
the gross anatomy examined with SEM. Radulae were
prepared by dissection and cleaning in 1 :50 commercial
bleach ( Iothia megalodon), or by dissolving bodies in
25% KOH at 40°C, cleaned, mounted, and examined
with SEM.
For comparison with the new species of Iothia , DNA
was extracted from pieces of foot tissue of the species
listed in Table 1 where collection data and localities are
listed. In total, 10 individuals were newly sequenced,
and combined with published sequences of 9 individ-
uals from Nakano and Ozawa (2007). Two species of
Emarginula (Fissurellidae) and three species of the
Cocculinidae were used as outgroup taxa.
DNA Methods and Phylogenetic Analysis
The procedures described by Nakano and Ozawa (2007)
and Nakano et al. (2009) were used to extract DNA,
amplify it using PCR, and determine the sequence of
the COI and Histone H3 genes. All new sequences
determined in this study have been deposited in
GenBank (accession numbers in Table 1).
COI and Histone3 sequences were manually aligned
using MacClade 4.03 (Maddison and Maddison, 2002),
with reference to the translated amino acid sequence.
Third-codon positions of both genes were retained in all
phylogenetic analyses. The model of nucleotide substitu-
tion for the Bayesian analyses were selected using
Modeltest (Posada and Crandall 1998), giving GTR+I+G
for COI and Histone3. The partition-homogeneity test
(Swofford 2002; the ILD test Farris et al. 1995) was per-
formed to test whether the COI and Histone H3
sequences contained similar phylogenetic signal and could
thus be analysed as a single data-set. Subsequent phyloge-
netic analyses were performed with PAUP* version 4bl0
(Swofford 2002) for neighbor-joining (NJ) (Saito and Nei,
1987) (Kimura's two-parameter method; Kimura, 1980),
equally weighted maximum parsimony (MP), as well as
their associated bootstrap values (Felsenstein, 1985,
1988) . MrBayes v.3.1.2 (Huelsenbeck and Ronquist, 2001;
Ronquist and Huelsenbeck, 2003) was used to perform
Bayesian analyses and to estimate posterior probabilities.
The N| bootstrap analyses consisted of 10,000 repli-
cates. The MP bootstrap analysis consisted of 1,000 rep-
licates using heuristic search (with 10 random addition
sequence replicates and TBR branch-swapping).
MrBayes was run with the following settings for the
two partitions (i.e., genes), the maximum-likelihood
model employed six substitution types (nst=6), rate
variation across sites was modeled using a gamma distri-
bution, with a proportion of the sites being invariant
(rate=invgamma), the shape, proportion of invariable
sites, state frequency, and substitution rate parame-
ters were estimated for each partition separately. The
Markov-chain Monte-Carlo search was run with four
chains 3,000,000 generations, with trees being sampled
every 100 generations and the first 5,000 trees (i.e.,
500,000 generations) were discarded as burn-in.
A. Waren et al., 2011
Page 3
Table 1. Specimens of Lepetidae sequenced lor this study.
Abbreviations Used in Text:
AGT - Agassiz trawl; MNHNCL - Museo Nacional de
Historia Natural de Chile, Santiago; SEM - scanning
electron microscopy; SMNH - Swedish Museum of
Natural History; ZSM - Zoologisehe Staatssammlung,
Mii uchen
SYSTEMATICS
Family Lepetidae Gray, 1850
Remarks: This family contains species living in deep or
cold waters. They live on pieces of old shells or on rocks,
where they feed on precipitated detritus or, in shallow
water, encrusting diatoms. Shallow water species occur
only in high latitudes. The species of the family are most
safely recognized by the radular morphology with a
central complex of 4-6 sturdily built teeth and two
feather-like ones on each side of the complex. The
absence of etenidium and secondary gills and the pres-
ence of well-developed oral lappets are more noticeable
external characters, but these are not fully diagnostic,
since they are shared with Neolepetopsidae. The shell
usually has a better-defined sculpture of radiating ribs,
often equipped with small scales or spine-like processes,
when compared to other patellogastropods, but this is
also shared with the Neolepetopsidae. Neolepetopsids,
however, have a well-developed, perfectly transparent
inner shell layer.
Page 4
THE NAUTILUS, Vol. 125, No. 1
Species of Lepetidae are generally supposed to lack
eyes, as indicated by their vernacular name “blind lim-
pets”, but this is not correct. Both Iothia emarginuloides
and the type species I. fulva have very small black,
pigmented eyes, situated on the tentacle bases, close to
the head, having a diameter of 50-60 pm. According to
Angerer and Haszprunar (1996: 173), they are supposed
to be non-pigmented, but this is true only for Lepeta
caeca (O.F. Muller, 1776) and Propilidium ancyloides
(Forbes, 1840), among the species they investigated.
The presence of eyes, however visible only in dorsal
view, was confirmed both in I. fidva and in Chilean and
Antarctic specimens of I. emarginuloides.
Generic level names included in Lepetidae: Lepeta
Gray, 1847; Propilidium Forbes and Hanley, 1849; Iothia
Forbes, 1849; Cryptobranchia Middendorff, 1851;
Sagamilepeta Okutani, 1987; Maoricrater Dell, 1956;
Bathylepeta Moskalev, 1977, and Limalepeta Moskalev,
1977. We are not cominced that all these generic names
are needed to reflect the phylogeny of the family, but will
refrain from making changes in their nomenclatural sta-
tus at this point.
Genus Iothia Forbes, 1849
Type Species: Patella fulva O.F. Muller, 1776
Remarks: Species of this genus often have a shell with a
distinctly yellowish or reddish color (Figure 9), but w hite
or colorless shells also occur. The sculpture consists of
distinct, scaly radial ribs, the apex is situated at the poste-
rior third, and they have a distinctly convex posterior
slope. Species have been reported from the North Pacific,
North Atlantic, Antarctica, South America, and New
Zealand (in this latter location as Maoricrater Dell, 1956).
Eight names have been used for species of
Lepetidae in Antarctica and southern South America:
1. Patella albescens Philippi, 1846 was placed in Iothia
by Valdivinos (1999) and Forcelli (2000), but this spe-
cies was described from "the shores in Central Chile”
by Philippi (1846) and the description seems to be
based on a young nacellid (Pilsbry, 1891: 36). The
name has not been in modern use for any nacellids
(Valdovinos and Riith, 2005; Devries, 2008; De
Aranzanmendi et ak, 2009; Gonzalez-Wevar et al.,
2010), and is not discussed below; 2. Patella (?)
emarginuloides Philippi, 1868; 3. Tectura ( Pilidium )
coppingeri (E.A. Smith, 1881); 4. Lepeta antarctica
E.A. Smith, 1907; 5. Propilidium pelseneeri Thiele,
1912: 186, from the “Gauss Station” (68°S, 090°E),
near Drygalski Island, Davis Sea; holotype in the Nat-
ural History Museum, Berlin, Mol 63.050; not seen;
6. Lepeta depressa I ledley 1916: 42, from off the
Schakleton Ice shell in 220 m depth, has not been
identified later. It was based on a single broken shell;
not discussed below; 7. Pilidium fulviformes Egorova,
1972; 8. Iothia coppingeri magellanica Linse, 2002.
Bathylepeta is another lepetid genus with two species
known from abyssal depths off Chile and in the Weddell
Sea (ca. 5000 m). They differ by being quite large (25-30
mm) and having an almost smooth shell with central
apex. One of them, B. linsae Schwabe, 2006 is included
in the phylogenetic analysis.
Iothia emarginuloides (Philippi, 1868)
(Figures 5-6, 16-18, 23-26)
Patella (?) emarginuloides Philippi, 1868: 224. Type locality:
“Magallanes, Potissimum Magellanicum [Magellan Strait],
communicated by G. Acton”. Type material: Museo
Nacional de Historia Natural de Chile. Gueglielmo Acton
was a Captain in the Neapolitanian Navy (Malakozoo-
logisehe Blatter (1856) 3: 197). Transferred to Iothia by
Pilsbry (1891: 72, as Pilidium emarginuloides.
Tectura (Pilidium) coppingeri E.A. Smith, 1881: Type locality:
Eastern part of Magellan Strait, 16-18 m depth. Holotype:
Natural History Museum, London, not examined. Trans-
ferred to Iothia by Pilsbry (1891: 72) as Pilidium
coppingeri.
Lepeta (Pilidium) antarctica E.A. Smith, 1907: 12. Type local-
ity: Hole 10 (McMurdo Sound), 130 fathoms. Holotype:
Natural History Museum, London, not examined. Consid-
ered a synonym by Hain (1990: 37), validity questioned by
Schwabe (2006: 43).
Pilidium fulviformes Egorova 1972: 384. Type locality: Davis
Sea, 15 m depth. Type material: P.P. Shirshov Institute of
Oceanology, Moscow'. Synonymized with Iothia coppingeri
(Moskalev 1977: 62)
Iothia coppingeri magellanica Linse, 2002: 62. Type locality:
Beagle Channel (Chile and Argentina) 55° 07.30' S,
66°52.78' W, 25 m depth. Type material: Zoological
Museum, Berlin.
Material Examined: SMNH 102837, Chile, Golfo de
Ancud, 42°26.4' S, 072°59.0/ W, 250-300 m, 3 specimens
(Lund University Chile Expedition); SMNPI 103289,
Lazarev Sea, 70° 19.0' S, 003° 16.3' W, 191-204 m,
5 specimens; SMNH 103290, Lazarev Sea, 69°59.4' S,
008°00.3' E, 161-161 m, 2 specimens; SMNH 103291,
Lazarev Sea, 69°57.4' S, 005°04.2' E, 210-210 m,
I specimen; SMNH 103292, Lazarev Sea, 70°24.2' S,
006° 08.1' E, 118-126 m, 1 specimen; SMNH 103293,
Lazarev Sea, 70° 19.0'S, 003° 16.3' W, 191-204 m, 1 spec-
imens; SMNH 103561, Chile, Magellan Strait, Punta
Arenas, L3-15 m, 1895-12-04, Swedish Magellans Exp
1895-7#390, 2 specimens; SMNH 103562, Chile, Magel-
lan strait, Romanche Bay, 21-27 m, dead shells on black
clay (smooth, var. radiata Strebel), Swedish Magellans
Exp 1895-7#665, 1 specimen; SMNH 103563, Chile,
Magellan Strait, Punta Arenas, shell gravel, 27 m, Swed-
ish Magellans Exp. 1895 #465, I specimen; SMNH
103564, Chile, Magellan Strait, Romanche Bay, 20 m,
Swedish Magellans Exp. 1895-7#665, 2 specimens;
SMNH 103689, Falkland Islands, Albermarle Harbour,
18-30 m, Swedish Antarctic Expedition 1901#57, 4 spec-
imens;SMNH 103690, Chile, Otway Water, Puerto Toro,
1908-04-15, 20-30 m, Swedish Magellans Exp 1895-
7# 16, 2 specimens (smooth); SMNPI 103936, Chile, oil
Concepcion, 36°22.01' S, 073°43.10' W, 764-843 m, Leg
Sellanes VG-07-AGT10, I specimen; SMNH 103867,
Argentina, Tierra del Fuego, Beagle Channel, Bahia
Lapataia, 54°51.5'S, 068°33.1' W, 15-18 m. Leg. Diego
A. Waren et ah, 201 1
Page 5
Figures 1-9. Gastropoda from Concepcion seeps, unless otherwise stated. 1. Bathijbembix macdonaldi , shell height 44.5 mm.
2. Margarites huloti, shell height 23 mm. 3. Z etela alphonsi, height 10.5 mm. 4. Cantrainea panamense, shell height 21.8 mm.
5-6. lothia emarginuloides , length 5.8 mm. 7-8. Iothia megalodon , holotype #6617, length 8.9 mm. 9. Iothia fidva , Norway,
Raunefjord, 50 m depth, length 5.7 mm.
Zelaya, 5 specimens, DNA extracted; ZSM Mol
20013014, Antarctica, 71°06.27' S, 012°50.46' W, 728-
743 m , 1 specimen; ZSM Mol 20013011, Antarctica,
63°07.52' S, 59°25.43' W, 782 m, 1 shell; ZSM Mol
20013012, Antarctica, 71°06.27' S, 012°50.46' W, 728-
743 m, 1 specimen.
Distribution: Antarctic circumpolar, the Subantarctic
Islands and southern South America, north to
Concepcion (Chile), southernmost Argentina, the
Falkland Islands, Kerguelen and Crozet Island (Dell,
1990; Linse, 2002; Aldea, Olabarria, and Troncoso,
2008), usually in 20-200 m depth.
Remarks: Supported by the fact that type specimens are
veiy similar and were described from nearby localities
(separated by maximum 400 km at the same latitude),
we consider, as did Strebel (1907: 112), that coppingeri
and emarginuloides are synonyms, and the consequence
is that Philippi's name is the one to be used. Strebel
Page 6
THE NAUTILUS, Vol. 125, No. 1
(1908), Egorova (1972), and Dell (1990) recognized this,
but gave no reasons for their continued use of
coppingeri. Philippi (1868) described the species as
being similar to those in the genus Emarginula, but
lacking gills. He also noticed that eyes were present in a
specimen with dried soft parts, soaked in water. Both
Chilean and Antarctic specimens have, contrary to com-
mon belief, small eyes, of 50-60 pm diameter, and visible
only in dorsal view. In alcohol-preserved specimens, the
eyes remain visible also after at least 1 00 years.
Schwabe (2006) reviewed some of the names sup-
posed to be based on southern Lepetids, but did not
change nomenclature.
lothia coppingeri magellanica Linse, 2002 was
described as new because its radula was said to differ
from I Iain’s (1990) pictures of the radula of coppingeri
by having two instead of a single feather-like marginal
tooth. Linse also says there is only a single southern
species ol lothia, viz. I. coppingeri. Lepeta antarctica,
lothia emarginuloid.es, Lepeta depressa, and Pilidium
fidviformes are not mentioned. Linse has compared the
teeth ol her Magellanic specimens and found them to
differ from the “high-Antarctic lothia coppingeri” . How-
ever, lothia coppingeri is no more “high-Antarctic” than
Linse’s magellanica-, if anything, 7. coppingeri is more
northern since it was described from the Strait of Magel-
lan. not from Antarctica. It is obvious from Egorovas
(1972) drawings and Hains (1990) SEM pictures
that Antarctic specimens of lothia have two featherlike
teeth. If there had been differences as assumed by
Linse, the Antarctic specimens would be the ones in
need of a new name, but for them the name antarctica
E.A. Smith, 1907 is available. Linse also stated (2002: 64)
that her specimens could not be distinguished from
coppingeri by shell morphology. Examination ol the rad-
ula of a Chilean specimen and a specimen from Hains
collections in the Weddell Sea (partly kept in SMNH)
did not show any obvious differences. The shells can
usually be distinguished by the Antarctic specimens
having a more vitreous shell but this is probably a result
ol the physical conditions when the shells were formed.
We attempted to solve the problem by sequencing
Antarctic specimens but no specimens available to us
yielded a sequence.
II the Antarctic specimens are considered a distinct
species, lothia antarctica (E.A. Smith, 1907) is available
for them (Zelaya, 2005).
Specimens from shallow water in the Magellan Strait
often have an almost smooth shell (Figure 18), only indi-
cations of the ribs remain. Such specimens look very
different from large Antarctic and deep water spec-
imens, which are invariably sculptured (Figure 16).
lothia megalodon new species
(Figures 7-8, 10-11, 12-14, 19-22)
Description: Shell (Figures 7-8, 14) limpet-shaped,
thin, flat, dirty yellowish white. Protoconch unknown.
Sculpture of 45-50 radiating ridges made more distinct
by a series of low spines, knobs, or blisters on each. Apex
situated at or just behind the anterior 1/3, height of shell
Figures 10-1 1. lothia megalodon, holotype. 10. Ventral; 11. Dorsal view of soft parts. Length of body 7 mm. et, cephalic tentacle;
dg, digestive gland; gp, genital papilla; in, intestine; olp, oral lappet; re, rectum; sm, shell muscle.
A. Waren etal.,2011
Page 7
Figures 12-18. 12-14. Iothia megalodon. 12. Jaw, inside, right side damaged. 13. Body, critical point dried. 14. Shell, paratype
6618, unusually smooth. 15. Iothia fulva, head. 16-17. Iotltia emarginuloides , shell and detail ol sculpture of strongly sculptured
specimen from the type locality of 1. megalodon. 18. Iothia emarginuloides. Almost smooth specimen, SMNH 102837, from Chile,
Golfo de Ancud, 250-300 m depth. Radula of this specimen, see Fig. 25, H. Scale bars in mm.
1/3 of length. Periphery of base maximum breadth ca.
72% of length and situated at posterior 2/5. Maximum
shell length known 9.9 mm.
Soft Parts (Figures 10—11, 13): Pallial furrow and cav-
ity shallow, the latter with conspicuous anal and genital
papillae above right cephalic tentacle. Cephalic tentacles
short, cylindrical, lacking any external trace of eye. Snout
large with ventral mouth, posterior corners drawn out to
small obtuse flaps. Gill absent.
Radula (Figures 19-22): Formula 2-2-0-2-2, not
excessively long, 35 times as long as broad, length cor-
responding to 70% of length of shell. Posterior third
with poorly developed teeth; middle third with normal
lepetid type teeth, anterior third with ca. 25-30 teeth
with very large, “inflated bases”; “median tooth” with a
single large and smooth cusp, obviously formed by
tooth 2 from both sides of the radula, while the original
central tooth is reduced or invisibly incorporated. Sec-
ond lateral tooth with two blunt denticles, possibly
formed by fusion of teeth number 3 and 4 in other
species of Lepetidae. Uncini solt and pliable, difficult
to spread apart; outer one larger than inner one; mar-
gin ol apical part smooth (Figure 22). Jaw veiy sturdily
built (Figure 12).
Page 8
THE NAUTILUS, Vol. 125, No. I
Figures 19-26. Radular morphology. 19-22. Iothia megalodon, holotype, 8.9 mm. 19. 2.5 mm of the transitional zone. 20. Tran-
sition to large teeth. 21. Detail of radula, tilted backwards to show borders between teeth. 22. Tips of feather-like marginals.
2.3-24. Iothia e margin til aides, Concepcion, figured in Fig. 16 (shell 5.5 mm). 23. Two rows in vertical view. 24. Teeth tilted
backwards to show demarcation. 25-26. Iothia emarginuloides, Golfo di Ancud, SMNH 102837, (figured in Fig. 18, 4.5 mm).
25. Two transverse rows in vertical view. 26. Teeth tilted forwards to better show the feather-like structure of the two pairs of
marginal teeth. Numbers on teeth or parts of teeth are counted with a hypothetical rhachidian as number 1. Scale bars in pm.
A. Waren et al., 201 1
Page 9
Type Material: Holotype, #6617 and 2 paratypes # 6618
and 6619 in MNHNCL; 5 paratypes SMNH type collec-
tion 6784, 7932, 7933 (for details see Materials and
Methods).
Type Locality: Chile, methane seep off Concepcion,
36°22.01/ S, 73°43.10' VV, 764-843 m.
Etymology: From Carcharocles megalodon (Agassiz,
1843), a fossil shark known from its large teeth.
Remarks: Differences in soft parts separate megalodon
from emarginuloides: absence of eyes, abnormally large
radular teeth in megalodon and the edge of the marginal
teeth (uncini) being almost smooth in megalodon , not
featherlike as in emarginuloides (Figures 23, 26). Addi-
tionally, the shell of the new species differs by being
more depressed, having a less overhanging apex, and a
pear-shaped circumference instead of elongate and reg-
ularly ovate. The presence of normal specimens of Iothia
emarginuloides in the same trawl catch suggests that
megalodon is not a local form.
The radular type, with enlarged, shield-like teeth on
the anterior third (Figure 19) is unique. The mineralized
part of the normal lepetid radula can be recognized in
Figures 23 and 24 (Z. emarginuloides ), and is marked
2-4. These parts are assumed to correspond to three
lateral teeth, whereas the rachidian tooth has been lost.
They are attached to the radular membrane and are
easily detached. The corresponding parts in
I. megalodon (Figures 20-21, numbered 2-4) are also
easily detached, but leave intact the whole shield-like
area they are attached to. We consider this as an indica-
tion that the “shield” is formed by the basal membrane.
The slender marginal teeth (or uncini, if one wants to
refrain from homologizing) reach from the basal mem-
brane to the tip of tooth 2 in lepetids in general; so they
do also in I. megalodon , both before and after the devel-
opment of the shield.
The loss of the rachidian tooth and fusion of the first
lateral tooth from the two sides is obvious when the teeth
are tilted backwards (Figures 21, 24). So is also the
fusion of teeth number 3 and 4 in Iothia emarginuloides
(Figure 24), while this is not obvious in I. megalodon
(Figure 21).
Iothia megalodon usually had the gut full of white
calcareous matter, sometimes with sections of the gut
filled with grey sediment and mineral particles, and is
evidently scraping off sediment from the shells and car-
bonate rocks where it lives. As in patellogastropods in
other seep localities, the gut content occasionally was
unexpectedly rich in radiolarian fragments.
DISCUSSION
Biotope and Fauna
A limited number of mollusk species regularly show up
in vent or seep localities, often in high numbers and
concentrated around the source(s) of effluents. They are
usually distributed along or within a certain geologic
structure, like a mid-ocean ridge, a coastline, or a series
of seamounts. Their numbers invariably drop drastically
to zero only a short distance from the source of the
effluents. Among the bivalves, many have symbiotic bac-
teria (reviewed by Sibuet and Olu, 1998). Among gastro-
pods, only a few have such associations but those that
have are large and conspicuous (Waren and Bouchet,
2001) and are only known from vents. For the symbiotic
species, it is not difficult to understand that they are
vent/seep dependent, or favored by the presence of the
effluents needed by the symbionts.
The vast majority of the vent/seep gastropods are
grazers that utilize the rich bacterial growth on all sur-
faces, as well as material precipitated from the water
(Waren and Bouchet, 1993, 2001, 2009). Among the seep
gastropods, a few buccinids are scavengers and several
species of the Conoidea, mainly belonging to the genus
Phymorhynchus, are active predators. They can be
assumed to profit from the much elevated biomasses
(e.g.. Levin and Michener, 2002).
The genera containing species favored by seeps are
often distributed all over the world and their number is
quite limited, about 25-30 “seep gastropod genera”
(Waren and Bouchet, 1993, 2001, 2009; Sasaki et al.,
2010). The proportion of these that is present at a given
seep site is a good indication if it is a rich or poor seep
fauna. More than half of them are present in the veiy
rich seeps off the Pacific coast of Costa Rica (Waren
unpublished).
Most of the vent/seep gastropod species are adapted
to their environment by having different forms of
haemoglobin as oxygen carrier or in simplification of the
shell. Vent/seep species are rarely found outside the
vent-seep sites, although Johnson et al. (2007) found a
couple of species believed to be vent endemics on,
sunken drift wood 2000 km north of the nearest vent
where it is known to occur. The vent/seep species are
often called “vent/seep-dependent” (Sibuet and Olu,
1998) even if the degree of dependency has not been
quantified, and perhaps they should better be termed
“favored by vents and seeps”.
The main reason for our difficulty in recognizing the
vent-seep components of the fauna is probably lack of
knowledge of the fauna outside the seeps, which is more
diverse, albeit poorer in specimens. As a rule of thumb,
when visually directed collecting (manned submersibles,
Video-monitored-grabs, or ROVs) is used in vents or
seeps, the vast majority of the recovered specimens
belong to the vent-seep fauna.
About 22 species of gastropods have been considered
characteristic of the seep biota off Concepcion (Sellanes,
Quiroda and Gallardo, 2004; Sellanes et al., 2008, and
listed below), which so far only have been explored
by trawling and recently by TV-directed tube-coring
(L. Levin, pers. comm).
Several genera of gastropods known to be common in
seeps have not been found in the Chilean seeps, some of
them perhaps because of their small size (species of
Hyalogyrina , Cinia , Xylodiscula ~ 1-2.5 mm). Others
Page 10
THE NAUTILUS, Vol. 125, No. 1
are of sizes similar to those of the known fauna (species
of Provanna , Paralepetopsis , Phymorhynchus, and
Lepetodrilus ~ 6-20 mm), and are more likely to have
been collected also with the limited resources at hand, if
they were present. However, they may still be present
since the site may not have been completely collected
although a total of 13 trawls are believed to have passed
across the seeps or their immediate neighborhood. Dur-
ing the F reneh exploration of the seeps off West Africa
(Waren and Bouchet, 2009), six hauls with a 5 m beam
trawl and intensive sieving and search of the catch (von
Cosel, pers. comm.), recovered only 4 out of 8 seep gas-
tropod genera present at the site. The mesh of a trawl, in
this case 10 mm, does not exclude smaller species; sedi-
ment is almost always caught and clogging the net, which
then retains also small organisms.
Accompanying Gastropod Fauna
Margarites huloti Vilvens, 2006 (Family Trochidae)
(Figures 2, 27-28) is not easily classified on shell
characters alone and its radula is therefore figured
(Figures 27-28). It is similar to that of species of
Gazini (Trochidae). Few Gazini radulae have been fig-
ured but Hickman and McLean (1990: fig. 53) figured
an unidentified species and Gaza superba (Dali, 1881),
and Simone and Cunha (2006) reviewed the group.
Species of Margarites and the Antarctic sister group
Margarella have 4-6 lateral teeth, species of Gazinae
have more, 7-8 laterals. Species of Gaza are sometimes
common around carbohydrate seeps in the Gulf of
Mexico (Waren and Bouchet, 1993, 2001). At present,
there seems to be no generic name published for a
genus where M. huloti fits, so we leave it in Marga-
rites. The gut contained sediment in two specimens
which were examined. Similar species are known from
Japanese seeps and vents ( Margarites ryukyuensis
Okutani et ah, 2000 and M. shinkai Okutani et ah,
1992) and from the Manus Basin (Waren, unpublished)
and we feel confident that this is a species adapted to
and favoured by the seep environment.
lothia emarginuloides (Philippi, 1868), l. megalodon
new species (Lepetidae). Very similar, undescribed
species are known from seeps in the Gulf of Mexico,
off western Costa Rica, and off Oregon (Waren,
unpublished). Therefore, we group L. megalodon as a
seep species, while /. emarginuloides, which is mainly
Figures 27-28. Margarites lmloti , radular morphology. 27. Central Field. 28. Whole width of radula. Scale bars in |im.
A. Waren et al., 2011
Page 11
known from non-seep environments, probably is an
occasionally occurring intruder.
Puncturella, (Family Fissurellidae). Two species
found (Sellanes, unpublished) at Concepcion. Species of
Fissurellidae seem to be regularly occurring in tlie
outskirts of vents and in seeps, but they seem to be
local species and no biotope specific radiation has been
recognised, from seeps, vents or wood (Waren and
Bouchet, 2009).
Cantrainea panamense (Dali, 1908) (Family
Turbinidae (Colloniinae)) (Figure 4). May be a sister
species to Cantrainea macleani Waren and Bouchet,
1993 described from Caribbean seeps (see also Garcia
and Lee, 2002), since they are more similar to each other
than to any other known Colloniinae. Species of
Cantrainea are also known from Japanese hydrothermal
vents ( Cantrainea jamsteci (Okutani and Fujiknra, 1990)
and C. nuda Okutani, 2001) and fossil seeps in Japan
(Kaim, pers. comm.). Several species of Colloniinae,
including C. panamense, are also common on woodfalls
(Waren, unpublished). From phylogeny and records, we
consider this as a species with seep affinity.
Z etela alphonsi Vilvens, 2002 (Family Solariellidae)
(Figure 3). Species of Solariellidae are occasionally
found in cold seeps, sometimes more than single spec-
imens, but no biotope specific radiation has been recog-
nized and there is no indication of a solariellid species to
be endemic to seeps. Therefore we believe tbis to be an
occasional intruder.
Calliostoma chilena Rebder, 1971; Calliostoma
crustulum (Vilvens, 2006) (Family Calliostomatidae).
Species of Calliostomatidae are usually associated with
sponges or hydroids and their occurrence may be related
to occurrences of these. No radiation of calliostomatids
has taken place in vents and seeps and no species of
Calliostomatidae is known to be vent or seep dependent
or even regularly occurring there.
Bathybembix macdonaldi (Dali, 1890) (Family
Calliotropidae) (Figure 1). The distribution of the more
northern relative Bathybembix bairdii (Dali, 1889) was
reviewed by Hendrickx and Lopez (2006). Species of
Bathybembix occur regularly in cold seeps, often in con-
siderable quantities (Waren and Bouchet, 2001, 2009).
The overview of these large calliotropids is obscured by
the multiplication of generic names like Ginebis Noda,
1975, Lischkeia Fischer, 1880, Bathybembix Crosse,
1892, and Bembix Watson, 1879. These are all quite
similar in shell and radular morphology and most likely
closely related. This seems also to be the case with the
fossil genus Amberleya Morris and Lycett, 1850, which
comes close to Lischkeia, at least species like A. dilleri
Stanton, 1895 and A. morganensis (Stanton, 1895),
which occurred in a Late Jurassic to Lower Cretaceous
seep environment along the North American West
Coast. Kiel et al. (2008) drew the attention to this simi-
larity, as well as to Eucycloscala Cossmann, 1895 and
Eucyclus Eudes-Deslongehamps, 1860, and Janssen
(1993) used the name Bathybembix for German
Oligocene specimens. A careful comparison, based on
molecular methods where possible, is needed to better
understand the relations among these groups.
Calliotropis ceciliae Vilvens and Sellanes, 2010 (Fam-
ily Calliotropidae). One species of Calliotropis was
reported from West African methane seeps (Waren and
Bouchet, 2009) and AW has seen other species of
Calliotropis from seeps in the Philippines and off Taiwan
(unpublished). Species of Calliotropis invariably have
their gut filled with sediment (Waren, unpublished),
and are likely to gain from the rich bacterial growth. We
therefore consider their presence indicative of seep envi-
ronment and that they should be called “seep species’’
(althogh most species of the genus inhabit the normal
deep-sea).
Caenogastropoda. The large species of predatory and
scavenging Caenogastropoda are probably attracted
by the increased biomasses and occurrence of possible
prey. Here belong; Naticidae (“ Natica sp.”) Ranellidae
( Fusitriton magellanicus (Roding, 1798)), Muricidae
( Trophon ceciliae Houart, 2003; Trophon condei Houart,
2003; Trophon sp.; and Pagodula concepcionensis
Houart and Sellanes, 2006), Buccinidae ( Kryptos
explorator Fraussen and Sellanes, 2008), Volutidae
( Miomelon philippiana (Dali, 1890)), and the Conoidea
( Aforia ef. g oniodes (Watson, 1881) and two unidentified
species of Conoidea).
Systematic Position of Iothia
The family Lepetidae is thought to be a sister group of the
Aemaeidae and Lottiidae (Lindberg, 1988; Lindberg and
Iledegaard, 1996), but anatomical characters such as the
presence of a gill in Acnraeidae-Lottidae and the widely
different radular morphology, separate Lepetidae from
these families (Sasaki, 1998). Recent molecular work sug-
gests that Lepetidae is closely related to Pectinodontidae
and Nacellidae (Nakano and Ozawa 2007).
Moskalev (1977) reviewed the family Lepetidae world-
wide and classified the species based on their radular
characters. Later, Okutani (1987) proposed a new genus
Sagamilepeta primarily on radular features. Angerer and
Haszprunar (1996) summarized the anatomy of Lepeta,
Iothia, and Propilidium. According to Sasaki (1998), eight
genera are currently recognized within Lepetidae, but
their relations are poorly understood. Only a few repre-
sentatives of Lepetidae have been analysed using molecu-
lar data until now (Harasewych and McArthur, 2000;
Nakano and Ozawa, 2007).
To stabilize our generic concept, we used some
sequences from an ongoing project on the phylogeny of
the Patellogastropods in seeps and vents (Nakano and
Waren, unpublished) for a preliminary and simplified anal-
ysis (Figure 29). Our study includes the species belonging
to six named genera, including the type species, Lepeta
caeca, Limalepeta lima, Sagamilepeta sagamiensis, and
Iothia fulva. Unfortunately, we were not able to include
the type species of Propilidium and Maoricrater but the
letter is very similar to and probably a synonym of Iothia.
Page 12
THE NAUTILUS, Vol. 125, No. 1
NJ
COl + Histon3
96/91/1.00 100/100/1 00
L503Lepeta caeca pacifica
L504 Lepeta caeca pacifica
L7 SILimalepeta lima
L163Limalepeta litna
Japan, and Shigeo Higuchi, Sendai, Japan contributed
important specimens for the taxonomical work. Support
to JS was provided by FONDECYT projects 1061217
and 110066.
r L505 Cryptobranchia kuragiensis
100/100/0.94
100/100/ 1 00
L L506C ryptobranchia kuragiensis
- \JlA9Lepeta caeca
■ L152Sagamilepeia sagamiensis
■ L7 53Sagamilepeta sagamiensis
L19Alothia megalodon n. sp.
L952 Iothia coppingeri
LI \AAIothia fiilva
Lepetidae
Pectinodontidae
L915Bathylepeta linseae
- \A2SPectinodonta rhyssa
Bathyacmaea nipponica
L266 Coccopigya punctoradiata
L617Coccw/ma sp.
■ L429 Cocculina sp.
- L277 Emarginula foveolata fujitai
- LMSEmarginula variegata
- 0.05 substitutions/site
Figure 29. NJ phylograiu generated from the 986 bp com-
bined COI and Histone H3 data, showing NJ bootstrap, equally
weighted MP bootstrap and Bayesian posterior probabilities.
Tire monophyly of Lepetidae is strongly supported
(NJ = 100%, MP=100%, PP=0.94) in the phylogenetic
trees, as the results of Nakano and Ozawa (2007) suggest.
This is also in agreement with the highly aponror-
phic radula which is quite uniform throughout the fam-
ily. Two main clades are identified in the family
Lepetidae corresponding to Iothia plus Bathi/lepeta and
the renraing the Lepetidae ( Lepeta , Cryptobranchia,
Limalepeta, and Sagamilepeta ) (Figure 29).
The monophyly of the genus Iothia, as used here was
supported by NJ=92, MP=85, and PP=0.95, and the
position of the new species in Iothia thus seems well
supported.
Further work will be needed to evaluate the subdivi-
sion of Lepetidae.
ACKNOWLEDGMENTS
AW thanks the “Magnus Bergvall Foundation” for
economic support. We all thank the Captain and crew
of R/V Vidal Gormaz, who made this project possible.
Diego Zelaya, Museo de La Plata, Argentina; Enrico
Schwabe, Zoologische Staatssammlung, Miinchen,
Germany; Fredrik Pleijel, Stromstad, Sweden, Takuma
llaga. National Museum of Nature and Science, Tokyo,
REFERENCES
Aldea, C., C. Olabarria, and J.S. Troncoso. 2008. Bathymetric
zonation and diversity gradient of gastropods and bivalves
in West Antarctica from the South Shetland Islands to the
Bellingshausen Sea. Deep-Sea Research 1 55: 350-368.
doi: 10. 1016/j.dsr. 2007. 12.002
Angerer, G. and G. Haszprunar. 1996. Anatomy and affinities
of lepetid limpets (Patellogastropoda = Doeoglossa). In:
Taylor, J.D. (ed.) Origin and evolutionary radiation of the
Mollusea. Oxford University Press, Oxford, pp. 171-175.
Ballard, R.D. 1977. Notes on a major oceanographic find.
Oceanus 20: 35-44.
Brooks, J. M., M.C. Kennicut II, and R.R. Fay. 1985. Hydrates,
oil seepage and chemosynthetic ecosystems on the Gulf
of Mexico slope. EOS, Transactions of the American
Geophysical Union 66: 105.
Corliss, J.B., J. Dymond, L.I. Gordon, J.M. Edmond, R.P. von
Herzen, R.D. Ballard, K.G. Green, D. Williams, A.
Bainbridge, K. Crane, and T. H. van Andel. 1979. Subma-
rine Thermal Springs on the Galapagos Rift. Science 203:
1073-1083.
Dali, W. II. 1908. Reports on the dredging operations on the
West Coast of Mexico and in the Gulf of California. Bulle-
tin of the Museum of Comparative Zoology, Harvard Uni-
versity 43(6): 205-487.
Dell, R.K. 1990. Antarctic Mollusea with special reference to
the Fauna of the Ross Sea. Royal Society of New Zealand
Bulletin 27: 1-311.
De Aranzamendi, M.C., C.N. Gardenal, J.P. Martin, and
R. Bastida. 2009. Limpets of the genus Nacella
(Patellogastropoda) from the southwestern Atlantic: Spe-
cies identification based on molecular data. Journal of
Molluscan Studies 75: 241-251.
Devries, T.J. 2008. Cenozoie Nacella (Patellogastropoda:
Nacellidae) from Peru and Chile: Filling in the Gaps. The
Veliger 50: 274-291.
Egorova, A.N. 1972. New species of Gastropoda (Proso-
branchia) from Davis Sea. Issledovaniya Fauny Morei 11
(19): 383-394.
Farris, J.S., M. Kallersjo, A.G. Kluge, and C. Bult. 1995.
Constructing a significance test for incongruence. System-
atic Biology 137: 887-892.
Felsenstein, J. 1985. Confidence limits on phytogenies: an
approach using the bootstrap. Evolution 39: 783-791.
Felsenstein, J. 1988. Phytogenies from molecular sequences:
inference and reliability. Annual Review of Genetics 22:
521-565.
Forcelli, D.O. 2000. Moluseos Magallanicos guia de moluscos de
Patagonia y Sur de Chile. Vazquez Mazzini Editores 200 pp.
Fraussen, K. and J. Sellanes. 2008. Three new bueeinid species
(Gastropoda: Neogastropoda) from Chilean deep-water,
including one from a methane seep. Veliger 50: 97-106.
Garcia, E.F. 2002. Unexpected molluscan finds from the
hydrocarbon vents off the Louisiana Coast. American
Conchologist 30(4): 28.
Gonzalez- Wevar, C.A., T. Nakano, J. I. Canete, and E. Poulin.
2010. Molecular phylogeny and historical biogeography of
Nacella (Patellogastropoda: Nacellidae) in the southern
A. Waren et al., 201 1
Page 13
Ocean. Molecular Phylogenetics and Evolution 56: 1 15—
124. Doi: 1 0 . 1 0 1 6/j .ympev. 20 1 0 . 02 . 00 1
Hain, S. 1990. Die beschalten benthischen Mollusken
(Gastropoda und Bivalvia) des Weddellmeeres, Antarlctis.
Berichte zur Polarforschung 70: 1-181.
Harasewych, M.G. and A.G. McArthur. 2000. A molecular
phylogeny of the Patellogastropoda (Mollusca:
Gastropoda). Marine Biology 137: 183-194.
Hendrickx, M.E. and J. Lopez. 2006. Geographic and depth
distribution of Bathijbembix ( Bathybembix ) bairdii (Dali,
1889) (Mollusca, Gastropoda, Trochidae) in the East
Pacific. Cicimar Oceanides 21: 93- 99.
Hickman, C. and J.H. McLean. 1990. Systematic revision and
suprageneric classification of trochacean gastropods. Nat-
ural History Museum of Los Angeles Country Science
Series 35: 1-169.
Holmes, A., PC. Oliver, and ]. Sellanes. 2005. A new species of
Lucinoma (Bivalvia: Lucinoidea) from a methane gas seep
off the southwest coast of Chile. Journal of Conchology 38:
673-682.
Houart, R. and J. Sellanes. 2006. New data on recently described
Chilean trophonines (Gastropoda: Muricidae), with the de-
scription of a new species and notes of their occurrence at a
cold-seep site. Zootaxa 1222: 5.3-68.
Huelsenbeek, J.P and F. Ronquist. 2001. MrBayes: Bayesian
inference of pylogenetic trees. Bioinformatics 17:
754-755.
Janssen, R. 1993. Zur Taxonomie und Nomenldatur Europaischer
Tertiar- Mollusken. 2. Die Gattung Bathybembix im eutschen
Oligozan (Gastropoda: Prosobranchia: Trochidae). Archiv fur
Molluskenkunde 123: 151-158.
Kiel, S., K.A. Campbell, W. -P. Elder, and C.T. S. Little.
2008. Jurassic and Cretaceous gastropods from hydrocar-
bon seeps in fore-arc basins and accretionary prism
settings, California. Acta Palaeontologica Polonica 53:
679-703.
Kimura, M. 1980. A simple method for estimating evolutionary
rates of base substitutions through comparative studies ol
nucleotide sequences. Journal of Molecular Evolution 16:
111-120.
Levin, L.A. and R. Michener. 2002. Isotopic evidence of
chemosynthesis-based nutrition of macrobenthos: the
lightness of being at Pacific methane seeps. Limnology
and Oceanography 47: 1336-1345.
Lindberg, D.R. 1998. Order Patellogastropoda. in Beesley, PL.
Ross, G.J.B. and Wells, A. (eds) Mollusca: The Southern
Synthesis. Fauna of Australia. 5. CSIRO Publishing,
Melbourne, Part B: 639-652 (i-viii + pp 565-1234).
Lindberg, D.R. and C. Hedegaard. 1996. A deep-water
patellogastropod from Oligoeene water-logged wood of
Washington State, USA (Acmaeoidea: Pectinodonta). Jour-
nal of Molluscan Studies 62: 299-314.
Linse, K. 2002. The shelled Magellanic Mollusca with special
reference to Biogeographic relations in the Southern
Ocean. A.R.A. Gantner Verlag, 252 pp.
Lonsdale, P. 1977. Clustering of suspension feeding macro-
benthos near abyssal hydrothermal vents at oceanic
spreading centres. Deep-Sea Research 24: 857-863.
Maddison, D.R. and W.P Maddison. 2002. MacClade4: analy-
sis of phylogeny and character evolution, version 4.03.
Sinauer Associates, Sunderland, Massachusetts.
Moskalev, L.I. 1977. To the revision Lepetidae (Gastropoda,
Prosobranchia) of World Ocean. Trudy Instituta
Okeanologia 108: 52-78.
Nakano, T. and T. Ozawa. 2007. Worldwide phylogeography of
limpets of the order Patellogastropoda: molecular, mor-
phological and palaeontological evidence. Journal ol Mol-
luscan Studies 73: 79-99.
Nakano, T., I. Yazaki, M. Kurokawa, K. Yamaguchi, and
K. Kuwasawa. 2009. The origin of the endemic patello-
gastropod limpets of the Ogasawara Islands in the north-
western Pacific. Journal ol Molluscan Studies 75: 87—90.
Okutani, T. 1987. Sagamilepeta, a new genus for “Lepeta"
sagamiensis Kuroda and Habe 1971 (Gastropoda:
Lepetidae). Venus 46: 127-130.
Oliver, P. G. and J. Sellanes. 2005. New species of Thyasiridae
from a methane seepage area off Concepcion, Chile.
Zootaxa 1092: 1-20.
Parra, M., | Sellanes, E. Dupre, and E. Krylova. 2009.
Reproductive characteristics of Cah/ptogena gallardoi
(Bivalvia: Vesicomyidae) from a methane seep area off
Concepcion Chile. Journal of the Marine Biological Asso-
ciation of the UK 89: 161-169. doi: 10.1017/
S 00253 1 5408002397 .
Pauli, C.K., B. Hecker, A.C. Neumann, J. Hook, W. Corso,
R. Freeman-Lynde, R. Commeau, S. Golubie, and J.
Curray. 1984. Biological communities at the Florida
Escarpment resemble hydrothermal vent taxa. Science
226: 965-967.
Pilsbry, H.A. 1891. Manual of Conchology. Vol. XIII.
Acmaeidae, Lepetidae, Patellidae, Titiscaniidae. Academy
of Natural Sciences, 195 pp, 75 pis.
Philippi, R.A. 1846. Diagnosen neuer Conchylien-Arten.
Zeitsehrift fur Malakozoologie 3: 49-55.
Philippi, R.A. 1848 (1847-51). Abbildungen und Besch-
reibungen neuer oder wenig gekannter Conchylien, 3, 5.
Th. Fischer, Cassel, 138 pp. (For dates of publication see.
Catalogue of the Library of the British Museum (N.H.) 4:
1565).
Philippi, R.A. 1868. Conchylia nova potissimum magallanica.
Malakozoologische Blatter 15: 222-226.
Posada, D. and K.A. Crandall. 1998. Modeltest: testing the
model of DNA substitution. Bioinformatics 14: 817-818.
Ronquist, F. and J.P. Huelsenbeek. 2003. MrBayes 3: Bayesian
phylogenetic inference under mixed models. Bioinformat-
ics 19: 1572-1574.
Saito, N. and M. Nei. 1987. The neighbor-joining method:
a new method for reconstructed phylogenetic trees.
Molecular Biology and Evolution 4: 406-425.
Sasaki, T. 1998. Comparative anatomy and phylogeny of the
recent Archaeogastropoda (Mollusca: Gastropoda). Uni-
versity Museum, University of Tokyo, Bulletin 38: 1-223.
Sasaki, T., A. Waren, Y. Kano, T. Okutani, and K. Fujikura.
2010. Gastropods from Recent hot vents and cold seeps:
systematic^, diversity and life strategies. Topics in
Geobiology, Springer.
Schwabe, E. 2006. A new species of Bathylepeta Moskalev,
1977 (Mollusca: Gastropoda) from the Weddell Sea,
Antarctica. Zootaxa 1297: 37-45.
Sellanes, J., E. Quiroga, and C. Neira. 2008. Megafauna com-
munity structure and trophic relationships at the recently
discovered Concepcion methane seep area, Chile ~36°S.
ICES Journal of marine Sciences 65: 1102-1111.
Sellanes, J. and E. Krylova. 2005. A new species of Calyptogena
(Bivalvia, Vesicomyidae) from a recently discovered meth-
ane seepage area off Concepcion Bay, Chile (~36°S).
Journal of the Marine Biological Association UK 85:
969-976.
Page 14
THE NAUTILUS, Vol. 125, No. 1
Sellanes. | E. Quiroga, and V.A. Gallardo. 2004. First direct
evidence of methane seepage and associated
ehemosynthetic communities in the bathyal zone off
Chile. Journal of the Marine Biological Association UK,
84: 1065-1066.
Sibuet, M. and K. Olu. 1998. Biogeography, biodiversity and
fluid dependence of deep-sea cold-seep communities at
active and passive margins. Deep-Sea Research II 45:
517-567.
Simone, L. R.L. and C.M. Cunha. 2006. Revision of Gaza and
Callogaza (Vetigastropoda, Trochidae), with description of
a new Brazilian species. Zootaxa 1318: 1-40.
Smith, E.A. 1881. Zoological collections made during the sur-
vey of H.M.S. Alert IV. Mollusca and Molluscoidea. Pro-
ceedings of the Zoological Society of London 1881: 22—44.
Smith, E.A. 1907. Gastropoda. National Antarctic Expedition,
1901-1904, Natural History 2: 1-12.
Strebel, IT 1908. Die Gastropoden. Wissenschaftliche
Ergebnisse der Schwedischen Siidpolar-Expedition
1901-1903 6(1): 1-111.
Swofford, D.L. 2002. PAUP*: Phylogenetic Analysis Using Par-
simony (*and other Methods), version 4. Sinauer Associ-
ates, Sunderland, MA.
Thiele. J. 1912. Die antarktischen Schnecken und Muscheln.
Wissenschaftliche Ergebnisse der Deutschen Siidpolarex-
pedibon 1901-1903 13: 183-285.
Valdovinos, C. and M. Riith. 2005. Lapas Naeellidae del
extreme sur de Sudamerica: taxonomia y distribucion.
Revista Chilena de Historia Natural 78: 497-517.
Valdovinos, C. 1999. Biodiviersidad de moluscos chilenos: base
de datos taxonomica y distribucional. Gayana Zoologica
63: 111-164.
van Dover, C. L. 2000. The ecology of deep-sea hydro-
thermnal vents. Princeton University Press, Princeton,
N.J. 424 pp.
Vilvens, C. and [. Sellanes. 2006. Description of Otukaia
crustulum new species (Gastropoda: Calliostomatidae)
and Margarites huloti new species (Gastropoda:
Trochidae: Margaritinae) from a methane seep area off
Chile. Nautilus 120 (1): 15-20.
Vilvens, C. 2002. Description of Z etela alphonsi n.sp. (Gastro-
pod: Trochidae: Solariellinae) from Chile. Novapex 3:
61-64.
Vilvens, C. and J. Sellanes. 2010 Description of Callio-
tropis eeciliae new species (Gastropoda: Chilodontidae:
Calliotropinae) from off Chile. Nautilus 124: 107-111.
Waren, A. and P. Bouchet. 1993. New, records, species,
genera, and a new family of gastropods from hydro-
thermal vents and hydrocarbon seeps. Zoologica Scripta
22: 1-90.
Waren, A. and P. Bouchet. 2001. Gastropoda and Mono-
placophora from hydrothermal vents and seeps; new taxa
and records. Veliger44: 116-231.
Waren, A., P. Bouchet, and R. von Cosel. 2006. Gastropoda.
IN: Desbruyeres, D., Segonzac, M. and Bright, M. (eds)
Handbook of deep-sea hydrothermal vent fauna (544 pp).
Denisia 18: 82-140.
Waren, A. and P. Bouchet. 2009. New gastropods from
deep-sea hydrocarbon seeps off West Africa. Deep-Sea
Research Part II. 56: 2377-2349. DOI: 10.1016/).
dsr2. 2009. 04.013.
Zelaya, D.G. 2005. Systematics and biogeography of marine
gastropod molluscs from South Georgia. Spixiana 28:
109-139.
THE NAUTILUS 125(1): 15-28, 201 1
Page 15
Descriptions and illustrations of some new and poorly known
turrids (Turridae) of the tropical northwestern Atlantic.
Part 2. Genus Crassispira Swainson, 1840 subgenera Monilispira
Bartsch and Rehder, 1939 and Dallspira Bartsch, 1950
Phillip J. Fallon, Jr.
77 Cedar Drive
Farmingdale, NY 11735 USA
O
[email protected]
ABSTRACT
Notes, supplemental or new descriptions, and illustrations
are provided for nine small, less than 10 mm in height
crassispirine turrids in the genus Crassispira Swainson, 1840,
subgenera Monilispira Bartsch and Rehder, 1939 and
Dallspira Bartsch, 1950 ol the tropical northwestern Atlantic.
Most are relatively unknown because of the unavailability of
quality figures and adequate descriptions; one is previously
undescribed. This group has been a source of confusion to
workers attempting to identify material collected in recent
decades. Each is treated systematically, including syno-
nyms, description, variability in form, distinguishing charac-
teristics, and geographic range. Species in the subgenus
Monilispira include Crassispira maijaguanaensis, new species,
C. latizonata (E.A. Smith, 1882), C. nigrescens (C.B. Adams,
1845), C. elatior (C.B. Adams, 1845), C. verbernei de Jong
and Coomans, 1988, C. pellisphocae (Reeve, 1845), and
C. gaildingii (Reeve, 1845). Species in the subgenus Dallspira
include C. flavocincta (C.B. Adams, 1850), C. fuscocincta
(C.B. Adams, 1850), and C. bandata (Usticke, 1969). A few
notes are made regarding C. fuscocincta ; however, this species
is still an enigma because no specimen has been acquired for
comparative study.
Additional keywords: Gastropoda, Neogastropoda, leetotype
designation
INTRODUCTION
This is the second in a series of papers covering rela-
tively unknown or confusing small crassispirine turrids
of the tropical northwestern Atlantic (TNWA). In this
part, seven species in the subgenus Monilispira
Bartsch and Rehder, 1939 are discussed. These taxa
share spiral sculpture, mostly tightly beaded, and nu-
merous narrow axial ribs as the dominant sculptural
element. Three species in the subgenus Dallspira
Bartsch 1950 are also treated, each possessing low
broad ribs with peripheral nodules. My intention is to
re-describe some poorly known species in these
subgenera, to update their synonymies, and to elabo-
rate on their zoogeography. Although most of these
were described over 150 years ago, their obscurity at
present is due to a number of factors: (1) deposition
ol types in the Natural History Museum (London),
making them relatively inaccessible to American
workers; (2) scarcity of specimens in museum collec-
tions; (3) relative inaccessibility of their habitats, which
are principally in the shallows near the islands of the
southeastern Caribbean; and (4) small size (less than
10 mm). Progress in bringing these species to the
attention of the malacological community lias been
slow Clench and Turner (1950) published previously
un-illustrated photographs of C.B. Adams’ types
( Pleurotoma nigrescens, P. elatior, P. flavocincta, and
P. fuscocincta). Maes (1983) visited the Natural His-
tory Museum (London) in the early 1980s for the
purpose of examining type material and later
expanded on the understanding of a turrid community
in the British Virgin Islands. Among the taxa she
treated that are also in this work are Crassispira
nigrescens (C.B. Adams, 1845) and C. pellisphocae
(Reeve, 1845). Shortly afterward, Kaieher (1984)
published photographs of type material but of only
one species treated here, C. nigrescens. In addition,
mid- to late-twentieth century authors added new spe-
cies from geographically restricted areas. Nowell-
Ustieke (1969) described C. bandata from St. Croix,
and de Jong and Coomans (1988) described C. mennoi
and C. verbernei from the Netherlands Antilles. Photo-
graphs of a great many turrid types have only recently
been made available (Williams 2005, 2006, 2009),
including some types in the Natural History Museum
(London) not previously published. These include the
type of C. latizonata (E.A. Smith, 1882). Crassispira
maijaguanaensis, new species, present in museum trays
for decades is formally described for the first time. By
presenting as many of the Monilispira and Dallspira as
is possible at this time, the differential diagnoses can
be better demonstrated.
Page 16
THE NAUTILUS, Vol. 125, No. 1
MATERIALS AND METHODS
The methods and materials appearing in the first part of
this series (Fallon, 2010) apply to this work. Specimens
and types were examined at the National Museum of
Natural History, Smithsonian Institution, Washington,
DC (USNM), the Academy of Natural Sciences of
Philadelphia (ANSP), and the Natural Histoiy Museum
(London) (NHMUK) for this work. St. Vincent and the
Grenadines is herein abbreviated SVG.
SYSTEMATICS
Subfamily Crassispirinae Morrison, 1966, sensu McLean,
1971a, b '
Genus Crassispira Swainson, 1840
Type species: Pleurotomo bottae Kiener, 1839, a junior
synonym of Crassispira incrassata (G.B. Sowerby I,
1834), by subsequent designation (ICZN, 1965).
Remarks: This genus has the largest number ot spe-
cies of all erassispirine genera. As a group they are het-
erogeneous for characters other than those that define
the Crassispirinae and consistent in that they lack the
combination of characters that narrowly define each of
the other genera in the subfamily. Numerous subgenera
have been erected to impose some order, and some have
argued for the elevation of the subgenera to genus level
(e.g., Kantor et ah, 1997). The more traditional practice
of including them all in Crassispira is followed here
because subgeneric assignment is still provisional for
many species. More research is needed on most mem-
bers of this diverse group, and until the differences
among the subgenera are more clearly defined, and per-
haps new ones erected where necessary, it is felt more
appropriate to keep them all under Crassispira.
Subgenus Monilispira Bartsch and Rehder, 1939
Type species: Drillia monilifera Carpenter, 1857 by
original designation .
Remarks: Bartsch and Rehders description of
Monilispira originally included Pilsbryspira monilis
(Bartsch and Rehder, 1939), which has a toxoglossate
radula, unlike the erassispirine one (two marginal teeth
only) of the type species (McLean, 1971a: 120-121).
While their description of Monilispira could fit some
Pilsbryspira , it is restricted in the TNWA to generally
smaller, more tightly beaded crassispirines. According to
Bartsch and Rehder (1939: 137), members of this subge-
nus have 2 smooth protoconch whorls, followed by a
whorl of axial riblets. The teleoconch whorls have a
strong subsutural cord and a row of nodules just above
the whorls periphery. The base of the shell has three
nodulose spiral threads, and two more on the posterior
portion of the columella. The entire surface of the shell
has growth lines and spiral threads. The anal sinus is
deep and lies on the shoulder between the suture and
first row of nodules. Inner lip is reflected and appressed
to the columella with a parietal callus at the junction of
the inner and outer lips.
The Monilispira are distinguished, in most cases, by
the dominance of spiral over radial sculpture, including a
subsutural cord, peripheral beaded cords, additional
beaded cords on the shell’s base, and spiral threads in
between. The type species, M. monilifera from the east-
ern Pacific, has a single peripheral row of beads, but
TNWA species usually have multiple rows of beads
on the whorls’ periphery, and on the shell’s base. How-
ever, the degree of beading is variable, even absent in
C. guiklingii (Reeve, 1845), which is provisionally placed
in Monilispira. Also, TNWA species typically have only
two protoconch whorls, the last one-quarter to one-half
with axial riblets; anal sinus deep, U-shaped and in
mature specimens may be partially constricted at its
opening by the parietal callus.
Crassispira ( Monilispira ) mayaguanaensis new species
(Figures 1-4)
Crassispira latizonata auct. non (E.A. Smith, 1882): Williams
(2005, 2006, and 2009: number 3105, right side photo-
graphs only) is likely this species. It was collected at 30 ft
[9.1 m]. Start Bay, Mayaguana I., Bahama Is. (Williams,
pers. comm., 20 Jul 2009).
Description: Shell with 7 rectilinear whorls, stoutly
fusiform, anterior half truncated. Whorls give shell a
somewhat turreted appearance (Figure I). Largest spec-
imen examined 8.6 x 3.6 mm (Holotype 6.6 x 3.0 mm).
Protoconch with 2 whorls, dome-shaped, smooth except
for last one-third, which has 7 distinct, curved riblets
(Figure 2). First teleoconch whorl with abrupt appear-
ance of sutural cord and numerous white riblets with a
central nodule, second whorl with fine threads that
divide ribs into 2 rows of beads, and by third, 4 rows of
round white beads that continue to last whorl. Shell base
with 4 more beaded rows, last only weakly so; anterior
canal with 5 plain spiral cords. Subsutural cord small,
only a few diameters greater than spiral threads, lies very
close to suture, and undulates with ribs beneath
appressed suture. Sulcus (this feature just anterior to
suture) with variably-spaced spiral threads made finely
nodulous by curved intersecting growth striae, which
mirror outline of anal sinus. Beaded rows separated by
variable number of fine threads throughout. Closely
spaced ribs number 19 on penultimate and 21 on body
whorl, where they evanesce on shell’s base. Outer lip
thin, without a noticeable stromboid notch (a shallow
one present on some in type series). Anal sinus lies
just below subsutural cord, deep and U-shaped, slightly
constricted by a projection ol uppermost part of outer lip
and parietal callus, causing sinus to appear diagonally
oriented. Varix behind anal sinus composed of 3 swollen
ribs; 2 additional ribs lie between varix and edge of outer
lip. Inner lip thick, opaque, with a parietal callus at its
junction with outer lip. Aperture narrow, but bowed out
at its midpoint, ending in a short, open siphonal canal
P.J. Fallon, Jr., 2011
Page 17
Figures 1-28. Crassispira species. 1-5. Crassispira (. Monilispira ) maijaguanaensis new species. 1. Holotype, USNM 1150455,
Abraham’s Bay, Mayaguana I., Bahama Is., 6.6 x 3.0 mm. Ventral, lateral, dorsal views. 2. Same specimen, two views of the
protoconch. 3. Paratype, ANSP 355561, Gold Rock, 20 mi [32.2 km] E of Freeport, Grand Bahama I., Bahama Is., 8.6 x 3.6 mm.
4. Paratype, USNM 902238, Start Bay, Mayaguana I., Bahama Is. 5. ANSP 368463, McLeans Town, Grand Bahama I., Bahama Is.,
4.5 mm. Figures 6-10. Crassispira ( Monilispira ) elatior (C.B. Adams, 1845). 6. USNM 502365, Pelican I. Barbados, 5.5 x 2.5. 7.
Same lot, 7.2 x 3.0 mm specimen. 8. Enlarged view of protoconchs of two previous specimens. 9. USNM 502364, Barbados, 6.9 x
2.8 mm. The light color of this beach-collected specimen may be due to exposure. 10. ANSP 200027, E. Colon 1., Bocas del Toro I.,
Panama, 4.4 x 1.9 mm. Figures 11-15. Crassispira ( Monilispira ) nigrescens (C.B. Adams, 1850). 11. USNM 1150457, Limekiln
Bay, Carriacou I., Grenada, 7.2 x 2.7 mm. 12. Authors coll., Clifton Harbor, Union I., SVG, 7.8 x 3.0 mm. 13. ANSP 349135,
Oranjestad, Aruba, Netherlands Antilles, 7.4 x 2.7 mm. 14. ANSP 350161, Fernando de Noronha Is., Brazil, 7.4 x 2.6 mm. 15.
Authors coll., San Bias Is., Panama, 7.1 x 2.6 mm. Figures 16-20. Crassispira ( Monilispira ) latizonata (E.A. Smith, 1882). 16.
Holotype, NHMUK 1874.5.26.88, locality unknown, 8.9 x 3,5 mm. 17. USNM 1150458, Falmouth Bay, Antigua, 6.3 x 2.4 mm. 18.
Same specimen, enlarged view of protoconch. 19. Author’s coll., Falmouth Bay, Antigua, 6.4 x 2.5 mm. 20. ANSP 350160, Fernando
de Noronha Is., Brazil, 6.5 mm. Figures 21-23. Crassispira ( Monilispira ) verbernei De Jong and Coomans, 1988. 21. ANSP
349132, Oranjestad, Aruba, ea. 4.8 x 2.1 mm. 22. ANSP 349133, Oranjestad, Aruba, 4.7 x 2.1 mm. 23. USNM 1150459, La
Blanquilla I., Venezuela, 5.1 x 2.1 mm. Figures 24-28. Crassispira ( Monilispira ) pellisphocae (Reeve, 1845). 24. Type, NHMUK
1879.2.26.43, locality unknown, 9.2 x 3.7 mm. 25. Author’s coll., Union L, St. Vincent and the Grenadines, 7.5 x 3.1 mm.
26. Author’s coll.. Union I., SVG, 7.7 x 3.2 mm. 27. Author’s coll.. Union I., SVG, protoconch of a 6.8 x 2.6 mm specimen. Lines
indicate position of the two spiral cords. 28. Author’s coll., Cabo de La Vela, Columbia, 10.8 x 4.3 mm.
Page 18
THE NAUTILUS, Vol. 125, No. 1
very slightly twisted to right. Shell color white, the 4 rows
of closely-packed white beads most apparent, with a
brown anterior that begins just below anterior-most
beaded cord such that a thin brown line shows at suture
of spire whorls. Color visible on interior ol shell. Shell
apex a lighter, golden brown.
Type Material: Holotype: USNM 1150455 (Fig-
ures 1-2). Paratypes: 2 spec., 8.6 x 3.6 (Figure 3) and
8.2 x 3.2 mm. Gold Rock, 32.2 km [20 mi] E of Free-
port, Grand Bahama I., Bahama Is. (ANSP 355561);
1 spec. (Figure 4), at 9.1 m [30 ft], Start Bay, Maya-
guana I., Bahama Is., G. Mackintosh! 24 Mar 1996
(USNM 902238); and 2 spec., 6.1 x 2,5 and 4,5 x
2.1 mm, Marina Bay, Providenciales, Turks and Caicos
Is., M. Williams! 16 Aug 1981 (ANSP 357847).
Type Locality: Abraham’s Bay, Mayaguana I., Bahama
Is., in 12 m.
Material Examined: 5 spec., 3.6, 4.2 (tip broken), 4.5
(Figure 5), 4.9 (tip broken), and 5.8 mm, at 0 ft,
McLeans Town, Grand Bahama I., Bahama Is., J.
Worsfold! (ANSP 368463); 1 spec. 5.9 x 2,5 mm, from
24.7 m [81 ft]. Gold Rock, Grand Bahama Is., Bahama Is.
(ANSP 369725).
Distribution: All specimens examined are from the
Bahama and Turks and Caicos Islands. The specimen
figured in Williams (2005, 2006, 2009: number 3105,
right side photographs only), which is this species, was
taken at 9.1 m [30 ft]. Start Bay, Mayaguana I., Bahama
Is. (Williams, pers. comm., 20 Jul 2009). A specimen in
USNM 935957 from Ascension Bay, Quintana Roo, Mex-
ico has been identified as this species (Tippett, pers.
comm., 19 Aug 2009). Its presence in the western Carib-
bean indicates a broader range.
Remarks: Crassispira maijaguanaensis has the typical
characteristics ol Monilispira : spiral sculpture dominant,
beaded peripheral cords, lesser beaded cords on the
shell base, and spiral threads (or grooves) present
between the cords. From Buchema primula (Melvill,
1923) it differs in having round beads on its shoulder
that are crowded together, not elongate spiral cord swell-
ings as in B. primula. (Buchema primula is re-described
in Fallon, 2010: 170.) There are more ribs, about 19 on
the penultimate whorl, than on the equivalent whorl ol
B. primula , which has about I I . The whorl shoulders are
squarish, not rounded as in B. primula. Although super-
ficially similar to C. latizonata (E.A. Smith, 1882), this
species has a smooth, domed-shaped protoconch, not the
ridged, squarish one ol C. latizonata. From C. nigrescens
it differs principally in having a larger, more dome-
shaped protoconch, square shoulders, not rounded ones,
and in lacking a heavy subsutural cord.
Etymology: Mayaguana Island Crassispira. The spe-
cies is named for Mayaguana I., Bahama Is. where it is
found, and which is also centrally located in relation to
the other localities from which examined specimens
derive.
Crassispira ( Monilispira ) elatior (C.B. Adams, 1845)
(Figures 6-10)
Pleurotoma elatior C.B. Adams, 1845: 4: Krebs (1864: 9); Tryon
(1884: 319); Clench and Turner (1950: 276, pi. 29, fig. 7);
Robinson and Montoya (1987: 391).
Drillia elatior (C.B. Adams, 1845): Olsson and McGinty (1958:
18); Nowell-Usticke (1959: 81).
Crassispira aclanisi de Jong and Coomans, 1988: 111 is an
unnecessary replacement name. A homonym, Pleurotoma
elatior d’Orbigny, was believed by these authors to have been
published in 1842, but research by Rosenberg (2009) found
1847 to be the true publication date of the plate with name
and drawing of this homonym [now = Nanodiella elatior
(d'Orbigny, 1847)]. This replacement name has been used
by Williams (2005, 2006, and 2009: number 3100) and Kirsh
(2006: 17, fig. 21).
Crassispira elatior (C.B. Adams, 1845): Garcia (2010: 12).
Description: Adams’ original description was a small
ornate shell, subconieal, white, with an encircling dark
band split by the suture. Spire elongate with 6 slightly
convex whorls having 12 weak individual ribs; striae on
shell base; anal sinus shallow; anterior canal short. Spire
angle 22°, 3.2 mm; shell overall 4.8 x 1.9 mm.
Type Material: Holotype: MCZ 155923, a photograph
of which appears in Clench and Turner (1950: pi. 29,
fig. 7) and in Williams (2006 and 2009: number 3100,
left photograph).
Type Locality: Jamaica.
Material Examined: 2 spec., 5.5 x 2.5 and 7.2 x
3.0 mm (Figures 6-8), from coral in shallow water. Peli-
can I., Barbados (USNM 502365); 1 spec., 6.9 x 2.8 mm
(Figure 9), beach collected, Barbados (USNM 502364);
1 spec., 4.4 x 1.9 mm (Figure 10), E Colon I., Bocas del
Toro, Panama, McGinty and Olsson! (ANSP 200027).
Distribution: SE Florida (Palm Beach Co.); Lesser
Antilles (St. Martin; St. Croix; Barbados); and western
Caribbean (Costa Rica; Panama).
Remarks: Adams did not describe the protoconch but
his description of the teleoeonch is consistent with photo-
graphs of the holotype and with the specimens examined
lor this project. De Jong and Coomans (1988: 111) report,
for a 5.0 x 2.0 mm specimen from St. Martin, about 19
ribs on the penultimate. Adam’s count must be a misprint
because the holotype though worn appears in the photo-
graph in Clench and Turner to have more than 12 ribs.
Fresh specimens have a spirally ridged protoconch, not
the dome-shaped, “ribbed” one reported by de Jong and
Coomans (1988: 111). The protoconch whorls are low,
smooth, with a single keel at the whorl summits (enlarged
views of the protoconchs ol specimens in Figures 6 and 7
are shown in Figure 8). De Jong and Coomans’ St. Martin
P.J. Fallon, Jr., 201 I
Page 19
specimen may have been worn, in which case the
protoconch might appear dome shaped.
This is another ol C.B. Adams’ briefly described and
un-illustrated species. The first appearance of a photo-
graph of the holotype was in Clench and Turner (1950).
It showed the rather unique sculpture and color pattern,
and not long after their publication investigators began
reporting its occurrence from a v\hde area: Costa Rica
(Robinson and Montoya, 1987); Panama (Olsson and
McGinty, 1958); St. Martin (de Jong and Coomans,
1988); St. Croix ( Nowell- Usticke, 1959); and Palm Beach
Co., E Florida (Kirsh, 2006).
A ridged protoconch, or one with spirals, and a
teleoconeh with beaded or reticulated surface are
features shared by C. nigrescens, C. latizonata ,
C. verbemei, and C. pellisphocae . Crassispira elatior is
easily recognized by its uniformly small-beaded surface
(appearing reticulated in worn specimens), except in the
sulcus where only the axial ribs show, and by its small
size. Crassispira elatior can be further distinguished
from C. latizonata by its lower, less exserted protoconch,
smoother, rounder (not squarish) outline of the whorls,
and rounder shell base. From C. nigrescens it can be
distinguished by the absence of a smooth, heavy
subsutural cord, and a smoother, rounder (not squarish)
outline of the whorls. From C. verbemei , it can be dis-
tinguished by a more slender profile and proportionally
larger aperture, and from C. pellisphocae it differs in
having a beaded surface, a peripheral white band, not
uniformly brown or black, and a smaller size.
Crassispira ( Monilispira ) nigrescens (C.B. Adams, 1845)
(Figures 1 1-15)
Pleurotoma nigrescens C.B. Adams, 1845: 3 [Jan.]: d’Orbigny
(1847: 170); C.B. Adams (1850a: 54); Krebs (1864: 10); Dali
(1885: 237); Paetel (1888); Clench and Turner (1950:315,
pi. 29. fig. 11).
Not Pleurotoma nigrescens Reeve, 1845: pi. 26, no. 235 [Nov.],
a junior homonym, = Strictispira paxillus (Reeve, 1845).
Drillia ( Crassispira ) nigrescens (C.B. Adams, 1845): H. and
A. Adams (1853: 91); Tryon (1884: 173).
Crassispira nigrescens (C.B. Adams, 1845): Abbott (1958: 95);
Nowell-Usticke (1959: 81); Work (1969: 679); Ekdale (1974:
650); Cubit and Williams (1983: 29): Maes (1983: 323);
Kaicher (1984: card 3984); 15. Lamy et al. (1984); de Jong
and Coomans (1988: 109); Leal (1991: 189, pi. 24, fig. F [of
protoconeh only]); Espinosa et al. (1995: 43); Pointier and
Lamy (1998: 59, text photo); Williams (2005, 2006, and
2009: number 3134); Fallon (2008: figs. 17a, b).
Crassispira ( Crassispirella ) nigrescens (C.B. Adams, 1845):
Warmke and Abbott (1961: 135, pi. 25, fig. m); Powell
(1966: 76); Abbott (1974: 273); Vokes and Vokes (1984: 30);
Rios (1994: 167, pi. 55, fig. 760); Redfern (2001: 126, pi. 57,
fig. 523A-C; pi. 112, fig. 523D). See under Remarks below
about the possible misidentification of Abaco I. specimens.
Not Vokes and Vokes (1984: pi. 21, fig. 8 only): mislabeled
photograph of Agathotoma trilineata as C. (C.) nigrescens-
not Rios (1985: 141, pi. 48, fig. 653), which is Agathotoma
trilineata (Tippett, pers. comm., 21 Apr 2009).
Crassispira ( Monilispira ) nigrescens (C.B. Adams, 1845): Rios
(1983).
Ithijcythara lanceolata auct. non (C.B. Adams, 1850): mis-
captioning of C. (C.) nigrescens in Vokes and Vokes (1984:
pi. 29, fig. 10).
Pyrgospira flavocincta auct. non (C.B. Adams, 1850):
misidentification by Faber (2007: 124, figs. 30, 31) that may
be this species.
Drillia ponciana Dali and Simpson, 1901: 386, pi. 57, tig. 19: a
junior synonym according to Kaicher (1984: card 3984). The
type locality is Playa de Ponce, Porto Rico; the holotype is in
USNM 159684.
Drillia ( Clatlirodrillia ) ponciana (Dali and Simpson, 1901):
Abbott (1974: 270, fig. 3000).
Description: A specimen from Limekiln Bay, Carriaeou
I., Grenada, very close in appearance to the lectotype
depicted by Clench and Turner (1950), has been selected
for description here.
Shell 7.2 x 2.7 mm, of S slightly convex whorls, fusi-
form, anterior truncated; whorls patterned with heavy
subsutural cord followed by rows ol tightly packed beads
(Figure 11). Protoconch paucispiral with ~2 whorls,
smooth except last 0.5 whorl has 6 riblets; whorls not
immersed, tip lies above level of second whorl.
Teleoconeh with 6 whorls, first 2 with a single row of
round beads, changing to 2, then to 3 by penultimate
whorl. Beads are formed at intersection of spiral and
axial cords. Body whorl with 4 additional beaded rows,
followed by 4-5 rows of slightly granulose to smooth
cords that encircle siphonal canal. Spiral threads, 0-3 in
number, he between spiral cords. Subsutural cord,
located near suture, sharply ridged. Sulcus narrow, about
one-quarter width of spire whorls, concave, with re-
duced but thin lamellae-like curved rib extensions and
growth striae, overridden by fine spiral threads. Ribs
number 23 on penultimate, 19 on body whorl to varix.
Varix comprised of 3 swollen ribs. Aperture 31% of over-
all length of shell, narrowly oval ending anteriorly in a
short, open, slightly notched siphonal canal. Outer lip
thin but reinforced by two ribs; stromboid notch weak.
Anal sinus deep, lies below sutural cord, and U-shaped,
being partially closed at its entrance at edge of lip by
parietal callus and upward turn of outer lip. Inner lip
thin, appressed along its length, ending in a parietal
callus that bridges space between parietal wall and upper
side of anal sinus. Shell color brown, with spiral cords
and siphonal canal paler; crests of beads and sutural cord
lighter still.
Type Material: The lectotype (selected by Clench and
Turner, 1950: pi. 29, fig. 11) is in MCZ 177354.
Type Locality: Jamaica.
Material Examined: 1 spec,, 5.8 mm, at 2-3 m, in
drifted sand on rocks. White Bay, Guana I., British Vir-
gin Is., V.O. Maes!, 15-28 Feb 1975 (ANSP 338612);
I spec. 6.9 x 2.8 mm at 4.6 m. Young I., SVG, G. Mack-
intosh!, 24 )ul 1998 (authors coll.); 1 spec. 6.6 x 2.7 nun,
at 7.6 m. Petit Nevis, SVG, G. Mackintosh! 14 Jul 1996
(author’s coll.); 14 spec., up to 7.8 x 3.0 mm (Figure 12),
crabbed, intertidal, Clifton Harbor, Union I., SVG,
Page 20
THE NAUTILUS, Vol. 125, No. 1
P. Fallon!, 16 Jun 2007 (authors coll.); 1 spec., at 0.9-1 .5 m
[3-5 ft] in weed, sand, some rock, 4.8 km [3 mi] NE of
Ragged Pt., Barbados, R. and V.O. Maes! Dee 1963
(ANSP 291265); 3 spec., 5.9 x 2.3, 5.7 x 2.3, and 5.8 x
2.3 mm, at 6.7 m, S side of Molinere Pt., Grenada, G.
Mackintosh! 18 Apr 2004 (USNM 1 150456); 1 spec.,
6.5 x 2.4 mm, at 7.3 m on silted reef, S side of Molinere
Pt., Grenada, G. Mackintosh! 17 Jan 2007 (authors coll.);
1 spec., 6.5 x 2.5 mm, E side of Prickly Pt., SW Grenada,
R. Ostheimer!, Jan-Feb 1964 (ANSP 296632); 6 spec.
(4 veiy worn), N end of Grand Anse Beach, W Grenada
(ANSP 297466); 2 spec., 7.2 x 2.7 (Figure 11) and 6.6 x
2.7 mm (broken apex), at 12.8 m, in rubble. Limekiln Bay,
Carriacou I„ Grenada, (USNM 1150457); 1 spec., 7.4 x
2.7 mm (Figure 13), harbor dredgings, Oranjestad, Aruba,
Netherlands Antilles (ANSP 349135); 4 spec., best is
7.4 x 2.6 mm (Figure 14), Fernando de Noronha Is.,
Brazil, Jan 1979 (ANSP 350161); and 2 spec., 7.1 x 2.6
(Figure 15) and 7.6 x 2.7 mm, at 8-10 m on line sand,
San Bias Is., Panama (author’s coll.).
Distribution: Greater Antilles: Cuba, Jamaica, Cay-
man Is., and Puerto Rico; Lesser Antilles: U. S. Virgin
Is. to the Netherlands Antilles; Western Caribbean: Pan-
ama (San Bias Is.); and South America: Venezuela (Los
Roques Is.), Trinidad and Tobago (Tobago I.), and Brazil
(Fernando de Noronha Is., Pernambuco). Although not
examined for confirmation (and no corresponding pho-
tographs were published in the sources) specimens have
been reported from the Gulf of Mexico: Mexico (Vokes
and Vokes, 1984: Areas Cays, Campeche Bank); Western
Caribbean: Mexico (Ekdale, 1974: between Caneun and
Contoy Is.), and Panama (Cubit and Williams, 1983:
Galeta Reef).
Remarks: Crassispira nigrescens is widely distrib-
uted and not uncommon, based on the number of
publications in which it has appeared and localities
reported. Although relatively well known, some confu-
sion about its true identity persists. Crassispira
nigrescens reported by Redfern (2001: 126, pi. 57, figs.
523A-C; pi. 1 12, fig. 523D) from Abaco 1., Bahama Is.,
may be C. mayaguanaensis , a similar species but with
distinctive difterenees (see comparison above under that
species). No other published report of C. nigrescens
from the Bahama Is. has been found. Some confusion in
identity may be due to the geographic variability of the
species. Although a fairly consistent pattern of surface
sculpture occurs in specimens throughout its range
(strong, sharply delineated subsutural cord, narrow sul-
cus, 3 beaded spiral cords), noticeable differences in the
relative size of various elements of this pattern are evi-
dent among geographically separate populations. Geo-
graphic variability is not unexpected given the species'
apparent confinement to island habitats and its attendant
isolation into small populations. Photographs of simi-
larly-sized specimens from several different localities
are shown in Figures 1 1 — 15. The relative size of the
beads and number of beaded cords on the spire whorls
are variable characters, as is color. The extremes in bead
size are exhibited by the Grenadian specimen will i the
largest (Figure 11), and the Fernando de Noronha Is.
specimen with the smallest beads (Figure 14). This latter
specimen also has finer cords and more rows of beaded
cords on the spire whorls than the typical form. It may
eventually prove to be a separate species when a suffi-
cient number of specimens has been examined. Color
also appears to vary with populations, though the small
sample size precludes any general statement about spe-
cific populations. Specimens examined from Aruba and
Fernando de Noronha Is. shown in Figures 13 and 14 are
lighter colored than the ones shown from other localities.
Crassispira ( Monilispira ) latizonata (E.A. Smith, 1882)
(Figures 16-20)
Pleurotoma ( Crassispira ) latizonata E.A. Smith, 1882: 212-213.
Crassispira latizonata (E.A. Smith, 1882): Rios and Bareellos
(1979: 164); Leal (1991: 188-189, pi. 24, fig. E); Williams
(2005: number 3105, left photograph only); Barros et al.
(2005: 147, fig. c); Williams (2006 and 2009: number 3105,
left photographs only).
Crassispira ( Crassispirella ) latizonata (E.A. Smith, 1882): Rios
(1985: 141, pi. 48, fig. 652); Rios (1994: 167, pi. 55, fig. 759);
Kantor et al. ( 1997: 56, 61-62, fig. 7 [subgenus with question
mark on p. 56, but not on p. 61]); Rios (2009: 324, fig. 828).
Drillia ponciana var. virgata Usticke, 1969. Nowell-Ustieke,
1969: 27, pi. 5, fig. 1098: a synonym according to Rosenberg
(2009). The type locality is Barbados; the lectotype is in
AMNH 195457 (designated as "holotype" by Nowell-
Usticke, 1971: 22, but corrected to lectotype by Boyko and
Cordeiro, 2001: 60).
Drillia bandata Usticke, 1971: 22, pi. 4, fig. 1088: is not
Crassispira bandata (Usticke 1969). D. bandata was an
unnecessary replacement name for Drillia virgata (Usticke,
1969), as Nowell-Ustieke incorrectly assumed his Drillia
ponciana var. virgata was preoccupied (see Faber, 1988:
72). Nowell-Ustieke intended to elevate the taxon to spe-
cies-group level.
Description: The specimen described here, from Fal-
mouth Bay, Antigua, matches Smith’s description of the
type shown in Figure 16, allowing for differences
exhibited by a less mature shell (Figure 17). The holo-
type is believed to be an exceptionally large specimen
(8.9 x 3.5 mm). The type of Drillia virgata (from Barba-
dos) is comparably sized at 8.5 mm in length.
Shell narrowly fusiform with truncated anterior, 6.3 x
2.4 mm, of 6.75 slightly convex whorls, aperture 36%
of overall shell height (holotype with 8+ whorls). Sur-
face covered, except in a narrow sulcus, with closely-
packed rows of beads (Figure 17). Protoconch with 1.75
whorls, first 1.25 smooth, with cord on summit creating
square shoulder (Figure 18). Protoconch identical to that
figured for Brazilian C. latizonata by Leal (1991: pi. 24,
fig. E). (Although worn, cord still visible on holotype.)
Cord absent on last 0.5 turn but instead there are ~10
angled riblets, forming a slight shoulder below summit
of whorl. Teleoconch begins with abrupt appearance ot
a spiral cord mid-whorl, with narrow axial s angled at
intersection of mid-whorl cord, beaded at angle, and
P.J. Fallon, Jr., 2011
Page 21
with appearance of a subsutural cord, here beaded, not
smooth. A third spiral cord appears below central one
on third whorl, and a fourth on fourth whorl. Five,
including subsutural cord, are on penultimate whorl.
Body whorl with 1 1 spiral cords: 5 above suture line
followed by 3 beaded cords on shell base and 3 granu-
lose cords on siphonal canal. Body whorl with 18 axials,
last 3 forming a varix, and 19 on penultimate whorl.
Sulcus narrow, with a few faint spiral threads visible on
last whorl that undulate over ribs and with fine incre-
mental growth lines of same open curvature as sinus.
Ribs present but reduced in sulcus. Subsutural cord
slightly thinner than peripheral cords, and lies at or just
below suture. Outer lip plain, without a stromboid
notch. A shallow notch present in holotype. Anal sinus
anterior to sutural cord, shallow and broad, possibly
because of immature condition of examined specimen.
Holotype, a mature shell, witha U-shaped sinus con-
stricted at opening above by parietal callus. Inner lip
appressed to columella and parietal wall, a very slight
lobe at juncture of outer lip, not the heavy tubercle in
type specimen. Anterior canal is very short. Shell color a
light golden brown with a band consisting of 3 rows of
white spiral beads on shells periphery, and another with
2 rows of white beads on shell’s base, below suture line.
Apex also white.
Type Material: Holotype: NHMUK 1874.5.26.88.
Type Locality: Unknown to E.A. Smith.
Material Examined: Holotype, 8.9 x 3.5 mm (Fig-
ure 16), no locality; 2 spec., 6.3 x 2.4 (Figures 17-18)
and 6.4 x 2.5 mm (Figure 19), from under rocks at
2-3 m, Falmouth Bay, Antigua, VI. Coltro! (USNM
1 150458); 4 spec., 5.4, 6,5 (Figure 20), 6.8 and 6.8 mm,
Fernando de Noronha Is., Brazil (ANSP 350160).
Distribution: Lesser Antilles (Antigua, Barbados) and
Brazil (Fernando de Noronha Is.), in intertidal to 3 m
depths (as reported for the Antigua and Brazil localities).
Remarks: Smith’s taxon was published without illus-
tration and without locality; it remained largely unknown
for almost a century. Specimens Irorn Fernando de
Noronha Island were first recognized by Brazilian
workers as C. latizonata (Rios and Barcellos, 1979; Rios
1985; Leal, 1991; Rios 1994). Somewhat earlier, in his
1969 publication, and probably unaware that this species
had already been described, Nowell-Usticke published a
new description of a specimen from Barbados, naming it
Drillia ponciana var. virgata Usticke, 1969. He described
it as having 1,5 swirled nuclear whorls, 7 whorls with
packed rows of white beads, without a strong subsutural
cord, and a brown sutural band. He further noted that
the shell base has brown beading, which turns into
brown spiral cords. Like the type of C. latizonata , his
specimen from Barbados is quite mature, 8,5 x 3.2 mm
(see Williams, 2006: number 3105, second photograph
from the left). In his 1971 publication, Nowell-Usticke
emended his description to include “1 Vz swirled, keeled
nuclear whorls” (emphasis added). The keeled
protoconch (and less prominent sutural cord) clearly
distinguishes this species from C. nigrescens and from
C. mayaguanaensis , which have smooth protoeonehs.
A photograph of the protoconch ol C. latizonata appears
in Leal (1991: pi. 24, fig. E), and is described as
“paucispiral, with 114 whorl and has a squarish profile to
its shoulder.”
Rios (1985: 141) described this species as 6 x 2 mm,
6 whorls, pale-yellow with light-brown spiral bands, and
with a sculpture ol “beaded spiral rows (22 to 23 beads
on the two last whorls). Base with 6 to 7 spiral threads.”
It is not clear from Rios’ description how many beaded
cords are present on the shell base, but the photograph
provided in pi. 42, figure 652, appears to be this species,
smaller and narrower than the type, but like the speci-
men described herein.
Crassispira ( Monilispira ) verbeniei de Jong and
Coomans, 1988
(Figures 21-23)
Crassispira verbeniei de Jong and Coomans (1988: 111, pi. 17,
figs. 589A, B; pi. 43, 'fig.' 589); Williams (2005, 2006, and
2009: number 3108).
Monilispira verbernei (de Jong and Coomans, 1988): Faber
(2007: 124).
Description: According to de Jong and Coomans,
holotype is 4.8 x 2.2 mm, of 6 whorls with 1 nuclear
whorl; shell moderately convex. Protoconch shows
3 weak spirals. Outer lip sharp, thickened behind, con-
tinued around top of aperture as a thick callous pad.
Colour greyish- or orange-brown, with a broad white
(anal) band below suture; lower half of base also white.
Lower halves of whorls with dark brown lines (6 on
body whorl), coinciding with spiral grooves. An all-
brown color form exists, a few of which are paler below
suture.
Type Material: Holotype: ZMA 3.87.097; several
paratypes are in ZMA 3.87.169 and ZMA 3.87.170
(Williams, 2005: number 3108). A photograph of the
holotype is in de Jong and Coomans (1988: pi. 43,
fig. 589).
Type Locality: Aruba, west coast.
Material Examined: 1 spec., 4.8 x 2.1 mm (Fig-
ure 21), harbor dredgings, Oranjestad, Aruba, Nether-
lands Antilles, Frere Fredericus! (ANSP 349132); 1 spec.,
4.7 x 2.1 mm (Figure 22), harbor dredgings, Oranjestad,
Aruba, Frere Fredericus! (ANSP 349133); 1 spec., 5.1 x
2.1 mm (Figure 23), at 7.6 m. La Blanquilla I., Venezuela,
G. Mackintosh!, 4 Jan 2000 (USNM 1150459); 1 spec.,
4.6 x 2.1 mm (protoconch missing), Aruba, locality not
specified, M. Beernran! (authors coll.).
Distribution: The only published occurrence is on
Aruba’s west coast. A specimen in USNM 902239 from
Los Roques, Venezuela, (5.4 x 2.2 mm, under rocks at
Page 22
THE NAUTILUS, Vol. 125, No. I
3 ft [0.9 m], G. Duffy!, 24 Mar 1996) is this species
(Tippett, pers. comm., 19 Aug 2009). This specimen and
the one from La Blanquilla I. indicate that this species is
not endemic to Aruba but also occurs near other islands
off Venezuela. A specimen in the Llorida Museum ot
Natural Histoiy (LLMNH 231607) from Bocas del Toro
Prov., Panama (L. McGinty!, 1951) catalogued as this
species needs to be confirmed.
Remarks: The typical color pattern described by de
Jong and Coomans, brown with a broad white band
below the suture, is shown in Figure 21. An all-brown
color form shown in Figure 22 agrees well with their
description, but the protoconch is worn smooth so its
3 weak spirals are absent. Other color forms are depicted
in Williams (2006: number 3108, paratypes in ZMA
3.87.170). There are 3 other species in Monilispira with
spiral cords present on the protoconch but the form
of the protoconch is quite different for each: C. elatior ,
C. latizonata , and C. pellisphocae . The protoconchs of
C. pellisphocae and C. verbemei are depicted in
SEiVls by de Jong and Coomans (1988: pi. 17, figs. 588
and 589A). Protoconchs of C. elatior , C. latizonata, and
C. pellisphocae are illustrated in Figures 8, 18 and 27,
respectively. C. elatior has a single keel, C. verbemei 3
fine spirals, C. pellisphocae a keel and basal cord, and
C. latizonata a single keel, with the protoconch more
“telescoped” than that of C. elatior. There are other
differences too. Crassispira verbemei is most similar
to C. pellisphocae , which is about twice its height
(to 8.5 mm according to de Jong and Coomans, but up
to 11 mm for specimens from St. Croix according to
Nowell-Ustieke, 1959: 81), and has cancellation over-
all except in the sulcus versus limited to the base in
C. verbenei.
A specimen from La Blanquilla I. (Figure 23) may be
indicative of regional variation. It lias a more streamlined
profile, a narrower sulcus, and a more pinched anterior.
M ore material needs to be examined to asses whether
this population has consistent differences from that on
Aruba.
Crassispira ( Monilispira ) pellisphocae (Reeve, 1845)
(Figures 24-28)
Pleurotoma pellis-phocae Reeve, 1845: pi. 29, fig. 263; Dali
(1885:238).
Pleurotoma pellisphocae Reeve, 1845: Paetel (1888).
Defrancia pellisphocae (Reeve, 1845): H. and A. Adams (1853:
96); Paetel (1888).
Lachesis pellisphocae (Reeve, 1845): Tryon (1884: 225, pi. 27,
fig. 3).
Crassispira pellisphocae (Reeve, 1845): de Jong and Coomans
(1988: 110, pi. 17, figs. 588A, B; pi. 43, fig. 588); Williams
(2005, 2006, and 2009: number 3133); Fallon (2008: 12, 13,
figs. 19a, 1), erroneously captioned as Strictispira
pellisphocae) .
Crassispira ( Monilispira ) pellisphocae (Reeve, 1845): Maes
(1983: 322, figs. 16, 25, 32).
Monilispira pellisphocae (Reeve, 1845): Faber (2007: 124, figs.
27-29).
Pleurotoma cancellata Reeve, 1846, non Eichwald, 1833: Syn-
onymized here by Tomlin (1934: 40). St. Vincents [sic],
W. Indies is written on the original mounting board and so
is taken as the type locality'. Two syn types are in NHMUK
1875.4.26.17. These were verified as C. pellisphocae for this
work.
Chauvetia pellis-phocae (Reeve, 1846): erroneous reassign-
ment to a buccinid genus by Tomlin (1934: 39).
Drillia cancellata (Reeve, 1846): Nowell-Ustieke (1959: 81).
Clathrodrillia limans Dali, 1919: 14, pi. 13, fig. 3: a junior
synonym according to Maes (1983: 322). The type locality'
is "Gulf of California", which is in error according to
McLean (1971b: 907). The holotype is in USNM 56218.
Crassispira ? Gibson-Smith, 1972: 475 is this species according
to Maes (1983: 322).
Description: Reeve’s type is a worn specimen
(Figure 24), so a 7.5 x 3.1 mm specimen from Union I.,
SVG is described (Figure 25).
Shell fusiform, truncated on anterior end, 8 slightly
convex whorls; aperture about 41% of shell height.
Shells attain at least 10.8 mm in height. Protoconch
is worn smooth, but in a young specimen has ~1.5
whorls bearing 2 spiral cords, 1 at crest of whorl, other
at bottom, next to suture with succeeding whorl;
last 0.25 whorl with riblets in addition to the 2 cords
(Figure 27). Upper cord gives protoconch a ridged,
flat-top appearance, but sloped, as nuclear whorl rises
from center axis of protoconch. Both cords move to
center of post-nuclear whorls, subsutural cord arising
above them on first teleoeoneh whorl. Teleoconch with
~6 convex whorls with peripheries slightly below mid-
whorl. Axial and spiral cords subequal, evenly spaced,
giving surface reticulated appearance. Spirals override
axials, and are lighter in color. Subsutural cord of same
size as spirals, in narrow sulcus a little wider than space
between succeeding spiral cords; close-packed threads
between each of spiral cords and in sulcus. In some
specimens, sulcus is wider (Figure 28). Sulcus has traces
of axials, which are hooked to left, marked with heavy
arcuate growth striae. On body whorl, axials evanesce
on shell base where spiral cords then become dominant.
Up to 4 spiral cords on spire whorls, exclusive of
subsutural cord (early whorls have fewer), and 5 more
on shell base, where tiny beads form at the intersection
of radial cords in some. Additionally, 5 cords encircle
siphonal canal. Axials ~22 on body whorl to varix, 30 on
penultimate whorl. Varix a low, broad swelling behind
anal sinus. Outer lip thin, without stromboid notch.
Anal sinus deep and U-shaped, bordered by parietal
callus, and acutely angled toward shell axis, without an
appreciable constriction of opening. Two small ribs pre-
sent near edge of outer lip. Inner lip thin, appressed to
parietal wall. Aperture narrow, ending in short, open
siphonal canal.
Type: Holotype: NHMUK 1879.2.26.43, a single spec-
imen lot (identified as the holotype by Maes, 1983: 322).
It is illustrated in Faber (2007: 124, fig. 27, captioned
“syntype 1”). In the same paper, Fabers figures 28
PJ. Fallon, Jr., 2011
Page 23
and 29 (syntypes in NHMUK 1875.4.26. 1 7) are the types
of P. cancellata Reeve, 1846, a junior synonym.
Type Locality: Unknown to Reeve. It is here desig-
nated as Union I., St. Vincent and the Grenadines.
Material Examined: Type in NHMUK 1879.2.26.43,
9.2 x 3.7 mm, type locality not stated; 1 spec., at 8-10 ft
[2. 4-3.0 in], off Fowey Rock, Miami-Dade Co., E Flor-
ida (USNM 902234); 1 spec., 8.1 x 3.5 mm, on coral
rubble at 0.3-0. 9 m [1-3 ft], Media la Luna, off La
Parguera, Puerto Rico, T. Watters!, 27 Apr 2009
(T. Watters coll.); 10 spec., 7.4 x 3.0, 7.8 x 2.9, 7.5 x
2.9, 8.4 x 3.2, 7.8 x 3.0, 7.7 x 3.0, 7.5 x 2.8, 7.3 x 2.6,
6.5 x 2.5, and 5.7 x 2.5 mm, at 4.6 m on large rocks
at night. Young I., SVG, G. Mackintosh! 24 Jul 1998
(authors coll.); 306 spec., up to 9.9 x 3.9 mm (Fig-
ures 25, 26, 27), crabbed, intertidal, Clifton Harbor,
Union I., SVG (authors coll.); 5 spec., 6.9 x 2.7, 6.8 x
2.7, 6.4 x 2.3, 6.6 x 2.5 and 7.0 x 2.7 mm, at 6.7 m,
S side of Molinere Pt., Grenada, G. Mackintosh! 18 Apr
2004 (author’s coll.); 25 spec., to 7.4 x 2.9 mm, 7.3 m,
S side of Molinere Pt., Grenada, G. Mackintosh! 17 Jan
2007 (authors coll.); 1 spec., 6.8 x 2.7 mm, on coral
sand/rubble, Carriacou I., Grenada, T. McCleery! May
2004 (author’s coll.); 1 spec., 8.5 x 3.2 mm, at 6.1 m,
Ronde I., Grenada, G. Mackintosh!, 6 fun 1998 (author’s
coll.); 3 spec., 8.2 x 3.0, 7.2 x 2.8, and 7.4 x 2.7 mm, at
11 m, Man of War Ray, Tobago I ., Trinidad and Tobago,
G. Mackintosh!, 6 Jun 1998 (author’s coll.); 1 spec.,
10.7 x 4.2 mm, Malmok, Aruba, in 2-9 m, A. Bodart
and L. Couto!, Nov 1996 (USNM 902237); 5 spec.,
10.8 x 4.3 (Figure 28). 10.8 x 4.0, 10.6 x 4.1, 10.1 x 4.2,
and 9.0 x 3.3 mm, at 4-10 m, Cabo de La Vela, Colom-
bia, A. Jorio and L. Couto! (author’s coll.).
Distribution: Florida: E Florida (Miami-Dade Co.);
Bahama Is., (Eleuthera I.); Greater Antilles: Dominican
Republic, Puerto Rico; Lesser Antilles; U. S. Virgin Is.
(St. Thomas, St. Croix), Br. Virgin Is. (Guana I., Antigua 1.,
Barbuda I.), SVG (St. Vincent I., Union I.), Grenada
(Grenada I. Calivigny I., Carriacou I., Ronde 1.), Neth-
erlands Antilles (Curasao, Aruba, Bonaire); and South
America: Trinidad and Tobago (Tobago I.), Colombia,
and Venezuela (Falcon: offshore Is.).
Remarks: Onlv incomplete descriptions have been
published in the literature (Reeve, 1845: pi. 29, fig. 263;
Maes, 1983: 322, figs. 16, 25, 32; and de Jong and
Coomans, 1988: pis. 17, 43, figs. 588A, B). Photographs
are of generally poor quality because C. pellisphocae is
uniformly black, resulting in poor definition of the fine
detail of the shell’s sculpture. The distinctive protoconch
is nicely illustrated by Maes (1983: fig. 25), and also by
de Jong and Coomans (1988: pi. 17, fig. 588). The whole
shell illustrated by Maes (1983: fig. 16) is subadult, and
the structure of the mature lip is lacking.
This species is distinctive with its axials and spirals
nearly the same size, and equally spaced giving it a fine,
cancellate appearance. The closest species is C.
v erbemei, de Jong and Coomans, 1988, which is smaller,
nodulous, not cancellate, and usually more colorful, not
the uniform black or dark brown ol C. pellisphocae. It
differs from C. nigrescens in being broader, in lacking
the beaded spirals, in having a finer subsutural cord, and
in having a ridged protoconch.
Figures 29-33. Crassispira species. 29-30. Crassispira ( Monilispira ) guildingii (Reeve, 1845). 29. Lectotype in NHMUK
1875.4.26.18, St. Vincent, 8.3 x 3.3 mm. 30. USNM 1150460, Young I SVG, 8.5 x 3.5 mm. Figure 31. Crassispira ( Dallspira )
flavocincta (C.B. Adams, 1850), ANSP 371999, Port Royal, Jamaica, 5.1 x 2.1 mm. Dorsal and ventral views. Figures 32-33.
Crassispira (Dallspira) handata (Usticke, 1969). 32. ANSP 298618, off E coast, N end Elbow (Little Guana) Cay, Great Abaco,
Bahama Is., 4.4 x 1.9 mm. The two rows of nodules on the penultimate whorl are indicated by lines. 33. ANSP 291177, 1 mi N of
Holetown, Barbados, 4.2 x 1.7 mm. This specimen has only a single row of large peripheral nodules.
THE NAUTILUS, Vol. 125, No. 1
Page 24
Crassispira ( Monilispira ) guildingii (Reeve, 1845)
(Figures 29-30)
Pleurotoma guildingii Reeve, 1845: pi. 30, fig. 268: Reeve
(1846: 116); d’Orbigny (1847: 170, no. 365); Gray (1854:
30, number 365); Beau (1858: 7); Krebs (1864: 9); Arango y
Molina (1878: 219); Dali (1885: 236); Paetel (1888).
Defrancia guildingii (Reeve, 1845): H. and A. Adams (1853:
96); Paetel (1888).
Clathurella guildingii (Reeve, 1845): Gould (1862); Tryon
(1884: 279. pi. 18, fig. 44).
Crassispira guildingii (Reeve, 1845): Williams (2005, 2006, and
2009: number 3132).
Description: The specimen described here is almost
identical to the best of Reeve’s 3 leetotypes, and depicted
in Figure 29.
Shell with 8 convex whorls, is 8.5 x 3.5 mm, biconic,
truncated anteriorly, and aperture, including canal
about 44% of total height of shell (Figure 30). Pro-
toconch 2 smooth whorls, black in color, ending where
incised spiral lines begin, marking beginning of adult
sculpture. No riblets visible on protoconch, possi-
bly because of its slightly worn condition. Teleoconeh
whorls all about the same, with vide, flat sulcus about a
third of height of spire whorls. Suture appressed and
undulating over the ribs. Below, round, broad ribs run
to the succeeding suture, numbering 11 to varix, 13 on
penultimate; on body whorl they evanesce on shell base.
A few narrower, shorter ribs present adjoining larger
ribs on body whorl. Varix a swollen rib, ~0.25 turn
behind outer lip. Entire surface of teleoconeh covered
with fine spiral cords, most separated by 1-2 fine
threads; cords slightly larger on ribs shoulder and in
sulcus posterior-most 2-3, just below the suture, which
form subsutural fold. Spiral cords a dirty, slightly trans-
lucent white; threads black, giving shell a dusky color.
Outer lip thin but reinforced by 2 small ribs behind, in
front of varix; no stromboid notch. Inner lip thin and
narrow, appressed to columella and parietal wall. Parie-
tal callus present at junction of inner and outer lips.
Anal sinus deep and u-shaped, positioned between
subsutural fold and callus, and shoulder formed by ribs,
its opening slightly constricted by parietal callus. Ante-
rior canal short, open and not otherwise distinguished
from aperture, covered with ~10 spiral cords that are
the same as on shell proper.
Type Material: Three syntypes: NI1MUK 1875.4.26.18.
The one in better condition, as suggested by Tippett
(pers. comm., 19 Aug 2009), is here designated the lec-
totype. The two paralectotypes are in poor condition and
not illustrated.
Type Locality: St. Vincent, West Indies.
Material Examined: Leetotype in NIIMUK
1875.4.26.18, 8.3 x 3.3 mm (Figure 29), and 2
paralectotypes also in NIIMUK 1875.4.26.18, 9.3 x 3.7
and 8.1 x 3.3 mm; 1 spec., 8.5 x 3.5 mm (Figure 30), in
4.6 m, Young 1., SVG, G. Mackintosh!, 3 Sep 2000
(USNM 1150460).
Distribution: Reported in mid-nineteenth Century
literature from Cuba (d’Orbigny, 1847, Gray, 1854, and
Arango y Molina, 1878), Guadeloupe (Beau, 1858 and
Krebs, 1864), and “St. Vincent ”. The only recent reports
are from St. Vincent I. (Williams, 2005, 2006, and 2009;
Coltro and Coltro, 1999: Photo Gallery).
Remarks: This taxon was first combined in Crassispira
in an early version of the online database Malacolog
(Rosenberg, 2009), and followed by Williams (2005) in
publication. Its unique sculpture of broad ribs, a wide
flat sulcus, and the lack of spirally beaded cords, set it
apart from the rest of the Crassiclava.
This species has not been reported in the literature for
over 120 years. Photographs of the specimen in Williams
(2005: number 3132) and on the Femorale, Inc. web site
(Coltro and Coltro, 1999) from St. Vincent appear to
be this species. Its scarcity in published reports is likely
explained by its very limited natural range, as well as by
its inconspicuous black color and small size (8-9 mm).
The occurrence of this species in Cuba, as reported by
d’Orbigny, might Ire verifiable since the inventory of his
specimens in the British Museum is listed in Gray (1854)
and thus available for verilication.
Subgenus Dallspira Bartsch, 1950
Type Species: Dallspira dalli Bartsch, 1950, by origi-
nal designation.
Remarks: This is a small, obscure group of rare
crassispi lines about which little is known. The genus
was erected to accommodate two eastern Pacific species
that may have little in common with the western Atlantic
species other than some similar sculptural elements.
According to Bartsch (1950: 92-93): shell with 2 smooth
protoconch whorls, and a third of small axial riblets;
sulcus moderately broad and moderately concave;
subsutural cord feeble or lacking altogether; anal sinus
deep and round, partially constricted, and adjoining a
thick parietal knob; varix thickened, lying a short dis-
tance from the edge of the outer lip, edge protracted,
sinuous; axial ribs or just nodules present, and nodulous
spiral cords on the base of the shell; anterior canal short,
broad; and inner lip reflected over and appressed to
columella.
Western Atlantic species are typically much smaller
(4-7 mm) than the eastern Pacific species (14-17 mm).
Characteristics of both groups of species, which also set
this subgenus apart from the others in Crassispira, are
the presence of nodulous ribs or just nodules, and
nodulous spiral cords on the base of the shell. Unlike
the eastern Pacific species, the three TNWA species
discussed here have a distinctive spiral cord. More work
is necessaiy to determine whether a close phylogenetic
relationship between the eastern Pacific and TNWA spe-
cies to justify their grouping.
P. J. Fallon, Jr., 2011
Page 25
Crassispira (Dallspira) flavocincta (C.B. Adams, 1850)
(Figure 31)
Pleurotoma flavocincta C.B. Adams, 1850b: 63-64: Clench and
Turner (1950: 281, pi. 29, fig. 1); Olsson and MeGinty
(1958: 18).
Crassispira flavocincta (C.B. Adams, 1850): de Jong and
Coomans (1988: 110); Williams (2005, 2006, and 2009:
number 3102).
Not Pyrgospira flavocincta (C.B. Adams, 1850): Faber (2007:
124, figs. 30, 31) =? Crassispira nigrescens (C.B. Adams,
1845).
Description: According to Adams (1850b: 63-64):
shell ~4.8 x 1.8 mm, elongated, ovate-conic, ~7 nearly
rectilinear whorls, slightly convex, with an indistinct
suture. Protoconch moderately pointed. Whorls with a
row of nodules around the middle, a subsutural cord
above, and a third cord of intermediate size below.
(Adams does not refer to the mid-whorl sculptural ele-
ments as nodules, but rather as a “very broad moderately
elevated spiral ridge” that is "plicately and transversely
ribbed”, which has been interpreted here as simply
“nodules”.) Color white, with spiral bands of yellowish
brown above and below the cords, and yellowish brown
in between the nodules. Aperture small, wide, anal sinus
near the upper end of the outer lip, anterior canal very
short.
Type Material: Holotype: MCZ 155917. A photo-
graph of the holotype is in Clench and Turner (1950:
pi. 29, fig. 1), and also in Williams (2006 and 2009:
number 3102).
Type Locality: Jamaica.
Material Examined: 1 spec., 5.1 x 2.1 mm (Figure 31),
Port Royal, Jamaica (ANSP 371999).
Distribution: The only confirmed specimens are from
Jamaica; unconfirmed reports of this species are from
Panama (E. Colon !.), and the Netherlands Antilles
(Curasao, Aruba).
Remarks: No fresh specimens have been examined to
add to Adams’ description. The holotype is beach worn
judging from its appearance in the photograph in Clench
and Turner (1950: pi. 29, fig. 1), and as a consequence
there is still some uncertainty about its true identity and
the validity of specimens identified as this by some. The
identification of specimens reported by Olsson and
MeGinty (1958) and de Jong and Coomans (1988) has
not been confirmed. The specimen in ANSP 371999 is
slightly larger than the type (5.1 versus 4.8 mm), but
agrees well with Adams’ description, and Clench and
Turner’s photograph, so is illustrated here in Figure 31,
but it too, is a worn, polished shell.
Two shells from Aruba illustrated in Faber (2007:
figs. 30, 31) are labeled as this species but are more likely
C. nigrescens (C.B. Adams, 1845). They closely resemble
the specimen of C. nigrescens from Aruba depicted in
Figure 13. The approximately 8.4 and 10.0 mm heights
given for specimens in Faber’s figs. 30 and 31 are much
larger than the 5. 1 mm for confirmed specimens
of C. flavocincta . (The length of an unconfirmed speci-
men is given as 6.6 mm by de |ong and Coomans,
1988.) Crassispira nigrescens has been reported to reach
8.5 mm (Nowell-Usticke, 1959, for Drillia ponciana ,
a junior synonym). Faber attributes placement in
Pyrgospira to Maes (1983), which could not be verified.
Photographs of C. flavocincta do not show the pinched
body whorl characteristic of Pyrgospira.
After about 108 years ot anonymity, C . flavocincta was
“rediscovered” by Olsson and MeGinty (1958) and
reported in their Panamanian samples, and then again
30 years later by de Jong and Coomans (1988) in samples
from the Netherlands Antilles. The use of this taxon may
have been precipitated by the publication of photo-
graphs of Adams’ types by Clench and Turner in 1950 as
no reports of this species could be found in the literature
before that time. Adams’ descriptions were preliminary,
and on account of his untimely passing at age 39 they
were never followed by the more complete monograph
he had intended (Clench and Turner, 1950: 234). As a
consequence, many of his names went unused until after
the appearance of Clench and Turner’s publication.
Crassispira (Dallspira) fuscocincta (C.B. Adams, 1850)
(Not figured)
Pleurotoma fuscocincta C.B. Adams, 1850b: 62: Krebs (1864:
9); Tryon (1884: 319); Dali (1885: 235-236); Clench and
Turner (1950: 285, pi. 30, fig. 6).
Cerodrillia fuscocincta (C.B. Adams, 1850): de Jong and
Coomans (1988: 112).
Crassispira fuscocincta (C.B. Adams, 1850): Williams (2005,
2006, and 2009: number 3103, photograph of type only).
Description: According to Adams (1850b) for a shell
measuring 6.9 x 3.3 mm: "Shell clavate pyramidal: pale
yellowish white, with a sutural line of brown, anteriorly
wax yellow with revolving lines of yellowish white: with a
spiral series of large smooth well rounded nodules, on
slightly elevated wide ridges on the lower half of the
whorls; anteriorly with a few spiral raised lines: apex
acute: spire with the outlines rectilinear: whorls seven
or eight, not convex, with the suture not impressed:
aperture rather wide: canal very short.” Note that Adams
uses the term nodules in this instance, but not in the
description of C. flavocincta , where they are smaller, not
so obviously round, more numerous, and thus presum-
ably not meeting Adams’ definition thereof .
Type Material: Holotype: MCZ 155958, a photograph
of which is in Clench and Turner (1950: pi. 30, fig. 6).
Type Locality: Jamaica.
Distribution: Other than the type specimen collected
by Adams in Jamaica, it has only been reported from
Curasao, Netherlands Antilles, by de Jong and Coomans
(1988: 112).
Page 26
O
THE NAUTILUS, Vol. 125, No. 1
Remarks: Little is known about this species because
the type is a much-worn specimen. Its placement in
Dallspira is based on Adams’ description. No confirmed
representative of this taxon, other than the single worn
type, is available to expand its description. The name had
not been used for over 140 years before de }ong and
Coomans (1988: 112) applied it to an un-figured speci-
men from Curasao. Attempts to locate these authors’
specimen have so far been unsuccessful. The holotype
appears similar to, and it has been suggested (Williams,
2006) that Crassispira bandata (Usticke, 1969) might be
the same. C. bandata is a fairly distinctive species; pho-
tographs of a fresh specimens have been published
(Redfern 2001; Williams, 2005), there is little doubt as
to the identity of this taxon, discussed next in this work.
The two species have some striking similarities: a white
shell with a contrasting brown subsutural cord and a row
of large rounded mid-whorl nodules (as best that can
be made out in the photograph of the worn holotype of
C. fuscocincta) . The disparity in Adams’ C. fuscocincta
and Nowell-Usticke’s C. bandata is one of size. The latter
has been reported to be a maximum of 4.5 mm, while the
former holotype is 6.9 mm. De Jong and Coomans gave
the size of the only other reported specimen as 10.5 mm.
These size differences make it unlikely that all three are
the same species. A full understanding of this taxon will
remain in doubt until specimens matching the type can
be found.
Crassispira (Dallspira) bandata (Usticke, 1969)
(Ligures 32-33)
Psarostola bandata Usticke, 1969: 17, pi. 3, fig. 766.
Monilispira bandata (Usticke, 1969): new combination used by
Nowell-Usticke (1971: 22).
Crassispira bandata (Nowell-Usticke [sic], 1969): Redfem
(2001: 126, pi. 57, fig. 524). Note that Nowell-Usticke used
only “Usticke” in species authorship; but he used ‘ Nowell-
Usticke” in the authorship of his publications.
Crassispira bandata (Usticke, 1969): Williams (2005, 2006, and
2009: number 3101, right photograph only).
Description: Nowell-Usticke (1971: 22-23) described
the holotype as having 6.5 rough and knobby whorls with
slightly pointed nodules, and 1.5 smooth rounded
protoconch whorls. The early whorls of the teleoconeh
have 1 and later ones 2 rows of nodules below the
subsutural cord. The otherwise creamy white shell is set
off by a thin shiny orange-brown sutural band, which
includes the subsutural cord, and another close to the
anterior end of the shell, visible on the body whorl. The
narrow base of the shell has 4 granular spiral cords and
ends in a short canal. The outer lip has a small anal sinus,
and a varieal hump behind. One of the 2 ANSP spec-
imens (ANSP 298618, Figure 32) has 6 ribs to the varix
on the body whorl, which are formed by the longitudinal
alignment of the knobs; the penultimate has 8. The outer
lip is thin and has a stromboid notch. The inner lip has a
small callus at the junction of the inner and outer lips.
The anal sinus is deep and open, and acutely angled to
the shell’s axis.
Type Material: Holotype: AMNH 195459 and mea-
sures 4.25 x 2.1 mm. According to Boyko and Cordeiro
(2001: 105), it is a single specimen lot. A photograph of
the holotype is in Nowell-Usticke (1969: pi. 3, fig. 766,
and 1971': pi. 4, fig. 1103).
Type Locality: Christiansted Harbor, St. Croix.
Material Examined: 2 spec., 4.4 x 1.9 (Figure 32)
and 4.3 x 1.8 mm (much worn), off E coast, N end
Ell low (Little Guana) Cay, Great Abaco, Bahama
Islands, Robert Robertson! (ANSP 298618); 1 spec.,
4.2 x 1.7 mm (Figure 33) in 3-20 ft [0.9-6. 1 nr] on reef,
1 mi [1.6 km] N of Holetown, Barbados, R. and VO.
Maes! Dec 1963 (ANSP 291177); 1 spec., 3.9 x 1.7 mm,
beach-collected. Loblolly Bay, Anegada I., British Virgin
Islands, A. J. and J. C. Ostheimer! 13 Mar 1960 (ANSP
249486).
Distribution: Bahama Islands: Abaco Is.; and Lesser
Antilles: U. S. Virgin Is. (St. Croix), Br. Virgin Is.
(Anegada I.), and Barbados.
Remarks: This species is quite unmistakable because
ol its small size (~4 mm), white with brown sutural band,
and knobby sculpture. There is no other species that
resemble it except C. fuscocincta (see above). Its small
size probably accounts for its scarcity in collections.
The sculpture varies among specimens examined. A
single row of beading (instead of two), is seen in one of
the ANSP specimens; the beads become vertically elon-
gate on the body whorl, appearing like the two rows have
not been split by an incised line (Figure 33). The orange-
brown sutural band varies in width, as can be seen in the
photographs of two ANSP specimens (Figures 24, 25).
The band is almost entirely confined to the subsutural
cord on the holotype, as is most clearly seen in the pho-
tograph in Williams (2005: number 3101).
ACKNOWLEDGMENTS
1 am indebted to Drs. Donn Tippett and Jon Greenlaw
for their helpful comments on the manuscript; and to
Dr. Jerry Harasewych and Paul Callomon, Curator at the
National Museum of Natural History and Collections
Manager of the ANSP malacology collections, respec-
tively, for allowing access to their valuable material.
I also wish to thank Peggy Williams for providing some
ol the specimens critical to this work.
LITERATURE CITED
Abbott, R.T. 1958. The marine mollusks of Grand Cayman
Island, British West Indies. Monograph of the Academy
of Natural Sciences of Philadelphia II: 138 pp. + 5 pis.
Abbott, R.T. 1974. American seashells, Second Edition. Van
Nostrand Reinhold Co., New York, 663 pp. + 24 pis.
Adams, C.B. 1845. Specierum novarum conchyliorum, in
Jamaica repertorum, synopsis. Proceedings of the Boston
Society ol Natural History 2: 1-17.
P.J. Fallon, Jr., 2011
Page 27
Adams, C. B. 1850a. Notes on the synonymy of certain marine
shells. Contributions to Conehology 4: 54-55.
Adams, C.B. 1850b. Descriptions of supposed new species of
marine shells, which inhabit Jamaica. Contributions to
Conehology 4: 56-68.
Adams, H. and A. Adams. 1853. The Genera of Recent
Mollusca; Arranged According to Their Organization.
John van Voorst, London, vol. 1: 1-256 4- 32 pis.
Arango y Molina, R. 1878. Contribueion a la fauna
malaeologica Cubana. G. Montiel y Comp., Havana, 280
pp. + 35 pis.
Barros, J.C.N., de Lima, S.F.B., da Silva, S.V., Santos, M.C.F.
and Cabrel, E. 2005. Sobre familia Turridae Swainson,
1840 enr deposito no Laboratorio de Malacologia da
UFRPE e os tipos Brasileiros presentes na coleyao
malaeologica do National Museum of Natural History -
Smithsonian Institution. Boletim Teenico Cientifico do
Cepene 13: 143-149.
Bartsch, P. 1950. New West American turrids. The Nautilus
63(3): 87-97, pi. 6.
Bartsch, P. and PI. A. Rehder. 1939. New turritid mollusks from
Florida. Proceedings of the United States National
Museum 87(3070): 127-138, pi. 17.
Beau, M. 1858. Catalog de coquilles recueillies a la Guadaloupe
et ses dependances. Precede d une introduction par M. P
[aul] Fischer. Paul Dupont, Paris, 27 pp.
Boyko, C.B. and J.R. Cordeiro. 2001. Catalog of Recent type
specimens in the division of invertebrate zoology, Ameri-
can Museum of Natural History. V. Mollusca, Part 2.
Bulletin of the American Museum of Natural History
262: 170 pp.
Clench, W.J. and R.D. Turner. 1950. The Western Atlantic
marine Mollusca described by C.B. Adams. Occasional
Papers on Mollusks 1(15): 233^403.
Coltro, M. and | Coltro. 1999. [Internet] Photo Gallery, 2009.
U RL http :// www. femorale .com . hr/.
Cubit, J. and S. Williams. 1983. The invertebrates of Galeta
Reef (Caribbean Panama): a species list and bibliography.
Atoll Research Bulletin 269: 1—45.
Drill, W. PI. 1885. List of marine mollusca comprising the quater-
nary fossils and recent forms from American localities
between Cape Platteras and Cape Roque including the
Bermudas. United States Geological Survey 24: 336 pp.
Dali, W. II. 1919. Descriptions of new species of mollusks of
the family Turritidae from the west coast of America and
adjacent regions. Proceedings of the United States
National Museum 56(2288): 86 pp. + 24 pis.
Dali, W. IP and C.T. Simpson. 1901. The Mollusca of Porto
Rico. U. S. Fisheries Commission Bulletin for 1900 20(1):
351-524, pis. 53-58.
de Jong, K.M. and IPE. Coomans. 1988. Marine gastropods
from Curayao, Aruba and Bonaire. E. | Brill, Leiden,
New York, Kobenhavn, Koln, 261 pp. + 47 pis.
Ekdale, A. A. 1974. Marine molluscs from shallow-water envi-
ronments (0 to 60 meters) off the northeast Yucatan coast,
Mexico. Bulletin of Marine Science 24: 638-668.
Espinosa, J., IP Fernandez-Garees, and E. Rolan. 1995.
Catalogo actualizado de los moluscos marinos aetuales tie
Cuba. Resenas Malacologicas 9: 1-90.
Faber, M.J. 1988. Studies on West Indian marine molluscs 13.
The malaeologica] taxa of Gordon W. Nowell-Usticke. De
Kreukel 24: 67-102.
Faber, M.|. 2007. Marine gastropods from the ABC-islands
and other localities. 24. The subfamily Crassispirinae,
including the Strictispirinae, with the description of
Crassispira asthenes n. sp. (Gastropoda: Turridae) from
Aruba. Miscellanea Malacologia 2(6): 119-129.
Fallon, P.J., Jr. 2008. Hermit crab swarm. American Concholo-
gist 36(1): 9-13.
Fallon, P. J., Jr. 2010. Descriptions and illustrations of some
new and poorly known turrids of the tropical northwestern
Atlantic. Part 1. Genera Buchema Corea, 1934 and
Miraclathurella Woodring, 1928 (Gastropoda: Turridae:
Crassispirinae). The Nautilus 124(4): 166-174.
Garcia, E.F. 2010. Bocas del Toro revisited. A follow-up of
Olsson and McGinty’s report on the Panamanian Archi-
pelago. American Conchologist 38(2): 4-12.
Gould, A. A. 1862. Descriptions of new genera and species
of shells. Proceedings of the Boston Society of Natural
History 8: 280-284.
Gray, J.E. 1854. List of the shells of Cuba in the collection of
the British Museum, Collected by M. Ramon de la Sagra,
described by Prof. Alcide D’Orbigny, iir the "Ilistoire d
Llle de Cuba". British Museum, London, 48 pp.
ICZN (International Commission for Zoological Nomencla-
ture), 1965. Opinion 754 Crassispira Swainson, 1840
(Gastropoda): Designation of a type -species under the
Plenary Powers. Bulletin of Zoological Nomenclature 22:
228-229.
Kaicher, S.D. 1984. Card catalogue of world-wide shells.
Pack 39 - Turridae. S.D. Kaicher, St. Petersburg, Florida,
cards [i-ii], 3882-3987.
Kantor, Y. I., A. Medinskaya, and J.D. Taylor. 1997. Foregut
anatomy and relationships of the Crassispirinae
(Gastropoda: Conoidea). Bulletin of the Natural History
Museum, London (Zoology) 63(1): 55-92.
Kirsh, D. 2006. New Shell Records for Florida. American
Conchologist 34(3): 17-19.
Krebs, H. 1864. The West Indian marine shells with some
remarks. W. Laubs Widow and Chr. Jorgensen, Copenha-
gen, 137 pp.
Lamy, D.. J.P. Pointier, and M.J. Eraville. 1984. La faune
malacologique marine de la Martinique. Xenophora 23:
9-17.
Leal, J.H. 1991. Marine prosobraneh gastropods from oceanic
islands off Brazil: Species composition and biogeography.
W. Backhuys, Universal Book Services, Oegstgeest, The
Netherlands, 419 pp.
Maes, V.O. 1983. Olrservations on the systematics and biol-
ogy of a turrid gastropod assemblage in the British
Virgin Islands. Bulletin of Marine Science 33(2):
305-335.
McLean, J.H. 1971a. A revised classification of the family
Turridae, with the proposal of new subfamilies, genera,
and subgenera from the eastern Pacific. The Veliger
14(1): 114-130. July 1.
McLean, J.H. 1971b. Pages 686-766 in: A. M. Keen, Sea Shells
of Tropical West America. Stanford University Press,
Stanford, California, xvi, 1064 pp. Sept. 1.
Nowell-Usticke, G.W. 1959. A check list of the marine shells of
St. Croix, U. S. Virgin Islands, with random annotations.
The Lane Press, Burlington, Vermont, vi, 90 pp.
Nowell-Usticke, G.W. 1969. A supplementary listing of new
shells (illustrated), to be added to the check list of the
marine shells of St. Croix. Published by the author, St.
Croix, 32 pp.
Nowell-Usticke, G.W. 1971. A supplementary listing of new
shells (illustrated), revised edition, to be added to the
Page 28
THE NAUTILUS, Vol. 125, No. 1
check list of the marine shells of St. Croix. Published by
the author, St. Croix, 32 pp.
Olsson, A. A. and T. L. McGinty. 1958. Recent marine mollusks
from the Caribbean coast of Panama with the description
of some new genera and species. Bulletins of American
Paleontology 39: 1-58.
d’Orbigny, A.D. 1847. Mollusques. Histoire physique, politique
et naturelle de Pile de Cuba 2: 129-224; pis. 22-25.
Paetel, F. 1888. Catalog der Conehylien-Sammlung. Erste
Abtheilung: Die Cephalopoden, Pteropoden und Meers-
Gastropoden. Gebriider Paetel, Berlin, i, 639 pp.
Pointier, J.-P. and D. Lamy. 1998. Guide des Coquillages des
Antilles. Groupo M&G, Spain, 225 pp.
Powell, A.W. B. 1966. The molluscan families Speightiidae and
Turridae: an evaluation of the valid taxa, both Recent and
fossil, with lists of characteristics species. Bulletin of the
Auckland Institute and Museum 5: 184 pp. + 23 pis.
Redfern, C. 2001. Bahamian Seashells, A Thousand Species
from Abaeo, Bahamas. Bahamianseashells.com, Boca
Raton, Florida, x, 280 pp. + 124 pis.
Reeve, L.A. 1845. Monograph of the genus Pleurotoma.
Conchologia Iconica 1: pis. 19-33.
Reeve, L.A. 1846. Descriptions of new species of shells.
Proceedings of the Zoological Society of London 1845:
108-119.
Rios, E.C. 1983. Nuevos hallazgos de turrideos para el Brasil.
Comunicaciones de la Sociedad Malaeologiea del Uruguay
6(44): 113-116.
Rios, E.C. 1985. Seashells of Brazil. Fun day ao Universidade
do Rio Grande, Rio Grande, Brazil, [i-xii], 328 pp. + 102
pis.
Rios, E.C. 1994. Seashells of Brazil. 2nd ed. Fundayao
Universidade do Rio Grande, Rio Grande, Brazil, 368
pp. + 113 pis.
Rios, E.C. 2009. Compendium of Brazilian Sea Shells.
Evangraf, Rio Grande, Brazil, viii, 668 pp.
Rios, E.C. and L.J. Barcellos. 1979. Nuevas oeurrencias de
moluscos marinos para el Archipelago de Fernando de
Noronha, Brazil. Comunicaciones de la Sociedad
Malaeologiea del Uruguay 5(37): 163-166.
Robinson, D.G. and M. Montoya. 1987. Los moluscos marinos
de la Costa Atlantica de Costa Rica. Revista de Biologia
Tropical 35(2): 375-400.
Rosenberg, G. 2009. Malaeolog 4.1.1: A Database of Western
Atlantic marine Mollusca [WWW database (version
4.1.1)]. URL http://www.malacolog.org/.
Smith, E.A. 1882. Diagnoses of new' species of Pleurotomidae
in the British Museum. Annals and Magazine of Natural
History Series 5 10: 206-218.
Tomlin, J.R. le B. 1934. Notes from the British Museum.
V. Reeve’s "Monograph of Pleurotoma” . Proceedings of
the Malacological Society of London 21: 37-40.
Tryon, G.W., Jr. 1884. Conidae, Pleurotomidae. Manual of
Conehology, Structural and Systematic, with Illustrations
of the Species. Tryon, Philadelphia, 413 pp. + 34 pis.
Vokes, H.E. and E.H. Vokes “1983” [1984], Distribution
of shallow-water marine Mollusca, Yucatan Peninsula,
Mexico. Middle American Research Institute Publication
54: 183 pp.
Warmke, G.L. and R.T. Abbott. 1962. Caribbean Seashells
A Guide to the Marine Mollusks of Puerto Rico and
Other West Indian Islands, Bermuda and the Lower
Florida Keys. Dover Publications, Inc., New York,
348 pp.
Williams, M.A.S. 2005. Shallow- Water Turridae of Florida and
the Caribbean. Published by the author, Tallevast, Florida,
223 pp.
Williams, M.A.S. 2006. Shallow- Water Turridae of Florida and
the Caribbean, version 3. Published by the author,
Tallevast, Florida, 233 pp.
Williams, M. A. S. 2009. Shallow- Water Turridae of Florida and
the Caribbean, version 4. Published by the author,
Tallevast, Florida, 230 pp.
Work, R.C. 1969. Systematics, ecology, and distribution of the
mollusks of Los Roques, Venezuela. Bulletin of Marine
Science 19(3): 614-711.
THE NAUTILUS 125(l):29-35, 2011
Page 29
New fossil Bathymodiolus (sensu lato) (Bivalvia: Mytilidae) from
Oligocene seep-carbonates in eastern Hokkaido, Japan, with
remarks on the evolution of the genus
Kazutaka Amano
Department of Geoscience
Joetsu University of Education
Joetsu 943-8512, JAPAN
[email protected]
Robert G. Jenkins
JSPS Research Fellow
Faculty of Education and Human Sciences
Yokohama National University
Yokohama 240-8501, JAPAN '
ABSTRACT
A new species of the genus Bathymodiolus (sensu lato) is
herein described from the lower Oligocene Nuibetsu Forma-
tion in eastern Hokkaido, Japan. This is the oldest species of
this genus in Japan and the second oldest world wide. Based on
occurrence and distribution of fossil Bathymodiolus (sensu
lato), we suggest that the “genus” spread to the whole world
by the late Miocene. This dispersal pattern is supported by
molecular studies and similar to that of the large vesieomyids.
Additional keywords: Oligocene, fossil, biogeography,
Mytiloidea
INTRODUCTION
Bathymodiolus (sensu lato) is one of the representative
members of chemosynthetic communities frequently
found at hydrothermal vents and cold seeps. Phylogenetic
relationships between Bathymodiolus (sensu lato) and
other modioline mussels are of considerable interest, since
Distel et al. (2000) hypothesized that Bathymodiolus
(sensu lato) in the seep and vent sites originated from
small wood- or bone-associated modiolines. The recent
description of Vulcanidas from a shallow vent site by
Cosel and Marshall (2010) suggests that pathways
of adaptation occurred at least three times in the
bathymodiolines. It is necessary to examine such pathways
of adaptation from the view point of the fossil record.
Six Recent species of this genus are known around
Japan (Sasaki et ah, 2005). Morphologically, the genus
can be classified into the four groups Bathymodiolus
thermophilus, B. hrevior , B.heckerae, and B. childressi
(see Cosel, 2002). Most molecular studies, however, indi-
cate that the genus is not a monophyletic group but
includes instead several distinct clusters (e.g., Miyazaki
et al., 2004; Jones et ah, 2006; Iwasaki et ah, 2006;
Samadi et ah, 2007; Fujita et ah, 2009). Based on these
studies and their morphological data, Cosel and Janssen
(2008) recognized the following three clades, the
B. thermophilus , B. aduloides, and B. childressi clades.
Moreover, the B. childressi clade was subdivided
into six groups, including the genus Gigantidas Cosel
and Marshall, 2003 as one group. Among them, the
B. thermophilus clade includes B. thermophilus ,
B. hrevior , B.heckerae groups of Cosel (2002). Recently,
Miyazaki et ah (2010) examined COI and ND4 genes
and divided Bathymodiolus into four groups that corre-
spond to three clades of Cosel and Janssen (2008) and
one clade of the genus Tamil Gustafson, Turner, Lutz,
and Vrijenhoek, 1998. Veiy recently, Lorion et ah
(in press) also suggested that Bathymodiolinae should
be split into the B. thermophilus and B. childressi
groups, based on the studies of COI mtDNA and 28S
rRNA. As a conclusion, the genus Bathymodiolus is not a
monophyletic group, but consists of two or three clades.
Strictly speaking, the genus Bathymodiolus should be
used only for the molecular clade including the type
species, B thermophilus Kenk and Wilson, 1985. How-
ever, some authors used Bathymodiolus (sensu lato) to
the clades other than B. thermophilus clade (e.g., Cosel
and Janssen, 2008; Kiel et ah, 2010). In this paper, we
use Bathymodiolus (sensu lato) for all species hitherto
described as Bathymodiolus.
Tl le fossil record of Bathymodiolus (sensu lato) can be
traced back to B. willapaensis, which dates from the
middle Eocene (Kiel, 2006). In Japan, only three certain
and two doubtful fossil records of Bathymodiolus (sensu
lato) are known from cold-seep sites. One of these
records is from the middle Miocene Akanuda Limestone
of the Bessho Formation in central Nagano Prefecture.
Kuroda (1931) described Tama rind iformis akanudaensis
as a new species from Akanuda, Matsumoto City. Then,
Tanaka (1959) illustrated this species as Volsella,
Recently, Nobuhara et ah (2008) mentioned that the
species possibly belongs to the bathymodiolines, based
on the morphology of its juvenile shell. This species has
been also illustrated from a large seep carbonate of the
uppermost middle Miocene Ogaya Formation in Niigata
Prefecture (Amano et ah, 2010). “ Bathymodiolus " sp.
has been obtained and illustrated from siltstone of the
Page 30
THE NAUTILUS, Vol. 125, No. 1
Pliocene Tamari Formation in Shizuoka Prefecture by
Nobuhara (2003). In addition to these records, Katto
and Masuda (1978) illustrated one specimen from the
carbonate of the Oligocene(P) Muro Group in Wakayama
Prefecture as Modiolus sp. This species occurred in asso-
ciation with Conchocele cl. nipponica (Yabe and
Nomura, 1925) and Callista ef. hanzawai (Nagao, 1928)
(= probably not Callista , but a vesicomyid). Moreover,
Amano et al. (2004) found several specimens of
Bathymodiolus? sp. in mudstone of the middle Miocene
Higashibessho Formation in Toyama Prefecture.
Fortunately, we could collect many bathymodioline
specimens of a new species from an Oligocene deposit
in Urahoro-cho, eastern Hokkaido. This is the oldest
record in Japan at the moment. In this paper, we
describe it and discuss its biogeographic significance
and evolutionary trend of Batlu/modiolus (sensu lato).
MATERIALS
The new species described herein is from limestones
of the lower Oligocene Nuibetsu Formation which
crops out along the Atsunai River, 1 .5 km east of Kami-
Atsunai railway station in Urahoro-cho, eastern Hok-
kaido (Figure 1). The limestone can be subdivided into
three parts from bottom to top; limestone yielding many
fossils and mudstone breccias (10m thick), laminated
limestone without fossils (2 m thick) and limestone
yielding pebbles of slate, plant debris and fossils (4 m
thick). Carbonate minerals of the lower limestone pre-
cipitated in an early diagenetic stage are depleted in 1 3C
(5 3C values as low as -49%o vs. PDB; Pee Dee Belem-
nite standard), which indicates methane seep activity
(Peckmann and Thiel, 2004). Although both lower and
upper parts yield chemosynthetic bivalves, and carni-
vore or scavenging gastropods, Batlu/modiolus (sensu
lato) was collected only from the parts, in association
with the thyasirid Conchocele bisecta (Conrad, 1849),
the vesicomyid Hubertschenckia ezoensis (Yokoyama,
1890), the solemyids Acharax aff. gigas (Kanno, 1960),
A. sp., the naticid Euspira meisensis (Makiyama, 1926)
and the buccinid Coins cf. fujimotoi Hirayama, 1955.
Terminology of description follows Gustafson et al.
(1998). All specimens are stored at the Joetsu University
of Education (JUE).
SYSTEMATIC S
Family Mytilidae
Genus Batlu/modiolus Kenk and Wilson, 1985
Type Species: Batlu/modiolus thermophilus Kenk and
Wilson, 1985 from hydrothermal vent fields on the
Galapagos Rift.
Bathymodiolus (sensu lato) inouei new species
(Figures 2-6, 9, 11, 12)
Diagnosis: A small-sized Batlu/modiolus (sensu lato)
with elongate shell, beak near anterior end, nearly
straight dorsal and ventral margin; blunt ridge running
from umbo to posterior corner.
Description: Shell of small size for genus, up to
45.4 mm long, modioliform, elongate (height/length
ratio = 0.30-0.59; length/height ratio = 1.71-3.31),
equivalve and inequilateral, moderately inflated, sculp-
tured by growth lines only. Blunt ridge running from
beak to posteroventral corner. Beak prosogyrate, situated
near anterior end (position of umbo; 2. 3-6. 9 % of shell
length from anterior end). Anterior margin broadly
Figure 1.
Locality map.
K. Amano and R. G. Jenkins, 2011
Page 31
Figures 2-6, 9, 11, 12. Bathymodiolus (sensu lato) inouei new species. All specimens from type locality. 2, 3, 5. Holotype, length
28.7 mm, JUE no. 15873. 2. Right valve. 3. Left valve. 5. Dorsal view. 4. Paratype, length 8.7 mm, JUE no. 15874-5, right valve
(juvenile). 6. Paratype, length 28.4 mm, JUE no. 15874-4. left valve; AA, anterior adductor scar; PA, posterior adductor scar; PBR,
posterior byssal retractor scar. 9. Paratype, length 30.5 mm, JUE no. 15874-3, left valve. 11. Paratype, length 30.8 mm, JUE no.
15874-1, right valve. 12. Paratype, length 31.1 mm, JUE no. 15874-2, left valve. Figures 7, 10. Bathymodiolus (sensu lato)
willapaensis (Squires and Goedert). Topotype from Bear River deposit, Washington State, USA, collected by RJ. 7. Length
11.8 mm, JUE no. 15876-1, left valve. 10. Length 13.8 mm, JUE no. 15876-2, right valve. Figures 8, 13-15. Bathymodiolus (sensu
lato) akanudaensis (Kuroda). 8, 14, 15. Topotype specimens. 8. Length 29.6 mm, JUE no. 15882-1, dorsal view; 14. Length
22.4 mm, JUE no. 15882-3, right valve. 15. Length 24.2 mm, JUE no. 15882-2, left valve. 13. Length 15.4 mm, JUE no. 15883, left
valve, loc. Kita-Kuroiwa, Joetsu City.
Page 32
THE NAUTILUS, Vol. 125, No. 1
arched; ventral margin nearly straight; posterodorsal
margin very broadly arched, continuing into steeply slop-
ing posterior margin. Hinge edentulous. Nymph
extending from beak and occupying 55% of dorsal mar-
gin. Anterior adductor muscle scar distinct, small and
semicircular; posterior adductor scar large and ovate;
posterior byssal retractor scar long, thin, united with
posterior adductor scar.
Holotype: JUE no. 15873.
Paratypes: JUE no. 15874-1 to JUE no. 15874-5; all
from the type locality.
Type Locality: Outcrop along the Atsunai River,
1.5km east of Kami-Atsunai Railway Station in Urahoro-
cho, eastern Hokkaido.
Material Examined: Eighty specimens were exam-
ined. Among these, forty-six are articulated.
Measurements: See Table I .
Remarks: The new species can be identified as
Bathymodiolus (sensu lato) because of its modioliform
shape and the occurrence from the cold seep site. Owing
to its terminal umbo and its continuous posterior retrac-
tor scar united posterior muscle scar, the new species
may be assigned to the B. childressi clade by Cosel and
Janssen (2008).
Comparison: The Eocene species Bathymodiolus
willapaensis (Squires and Goedert, 1991) (Figures 7, 10)
has veiy similar outline to juvenile form of the present
species, but has much smaller (27 mm long) and higher
shell than B. (sensu lato) inouei new species (figure 16).
Also, B. akanudaensis (Kuroda, 1931) from the Miocene
Bessho and Ogaya Formations (Figures 13-15) can
be discriminated by having distinctly higher and more
inflated shell than the new species (Figures 16, 17).
Bathymodiolus (sensu lato) inouei resembles Bathym-
odiolus (sensu lato) palmarensis Kiel, Campbell and Gail-
lard, 2010, from the “Oligocene” deposit of Colombia,
in its elongated shell and its beak located near anterior
end, but differs from it by having less distinct ridge and
less expanded posterior part. Volsella yokoyamai Hatai
and Nisiyama, 1952 described from the upper Eocene
Iwald Formation in Fukushima Prefecture resembles
B. (sensu lato) inouei in having an elongate shell, but
differs by its well inflated shell, more posteriorly located
beak and more distinct ridge. One specimen illustrated by
Table 1. Measurements of Bathymodiolus (sensu lato) inouei new species.
K. Amano and R. G. Jenkins, 2011
Page 33
Figure 16. Ontogenetic changes in shell length and height of
Bathymodiolus (sensu lato) inouei, B. (sensu lato) willapaensis
and B. (sensu lato) akanudaensis .
14
2 — i — 1 i — i — i — < -n ■ - > ■ > ' ■ ' ■
5 10 15 20 25 30 35
Length (mm)
Figure 17. Ontogenetic changes in shell length and width of
Bathymodiolus (sensu lato) inouei, B. (sensu lato) willapaensis
and B. (sensu lato) akanudaensis.
Katto and Masuda (1978) as Modiolus sp. from the Oligo-
cene? Muro Group in Wakayama Prefecture may be
inferred as Bathymodiolus (sensu lato) by the occurrence
from the carbonate in association with chemosynthetic
species. This specimen is similar to the new species in its
shell outline. However, owing to a few data on its speci-
men, it is necessary to collect additional specimens for
comparing with this new species in detail.
Distribution: Known only from ripe locality. Lower
Oligoeene Nuibetsu Formation in Hokkaido.
Etymology: Named after Mr. Kiyokazu Inoue,
Obihiro City, an amateur collector of molluscan fossils,
who found the locality of this new species.
DISCUSSION
Only four Paleogene species of Bathymodiolus (sensu
lato) are presently known. Among them, B. willapaensis
is the oltlest species, having been reported from middle
Eocene to late Oligoeene seep carbonates in Washington
State, USA (Goedert and Squires, 1990; Squires and
Goedert, 1991; Goedert and Squires, 1993; Goedert and
Campbell 1995; Kiel, 2006). Probably, the next oldest
record is the present new species from the lower Oligo-
cene. Kiel et al. (2010) described B. palmarensis from
the “Oligoeene” in Colombia, but its precise age is uncer-
tain. Moreover, one specimen was illustrated as
Modiolus sp. from the Oligoeene? Muro Group in Waka-
yama Prefecture, central Honshu by Katto and Masuda
(1978). All Paleogene species are small (less than 50 mm)
and have their beak located near the anterior end which
is one of the diagnostic features of Bathymodiolus
childressi clade.
In contrast, many records of Bathymodiolus (sensu
lato) are known from the Neogene deposits around the
world. Bathymodiolus akanudaensis and B. ? sp. occur
in a middle Miocene deposit in central Honshu
(Kuroda, 1931; Tanaka, 1959; Nobuhara et ah, 2009;
Amano et ah, 2004, 2010). In the Caribbean area, two
bathymodioline species have been described from the
Miocene Freeman’s Bay Limestone of the late middle
Miocene Lengua Formation in Trinidad and from the
lower to middle Miocene Husto Clay Member of the
Pozon Formation in Venezuela (Gill et ah, 2005).
Modiolus (Modiolus) exbrochii exhrochii Sacco and an
elongate Bathymodiolus- like fossil were reported from
the upper Miocene “Carcari a Lucina" at Montepetra,
Italy (Moroni, 1965; Taviani, 1994, 2001). Recently,
Saether et al. (2010) described Bathymodiolus (sensu
lato) heretaunga and Gigantidas coseli as new species
from the Plate early to the earliest late Miocene in the
North Island of New Zealand. Ol Pliocene age is
“ Bathymodiolus ” sp. reported by Nobuhara (2003) from
siltstone of the Tamari Formation in the forearc basin
of Honshu.
Considering the geographic distribution ol these
records, we suggest that the worldwide spread of
Bathymodiolus (sensu lato) might occur by the late Mio-
cene (Figure 18). This trend of geographic spread is the
same to that of the large vesicomyids which is another
characteristic taxa of chemosynthetic fauna (Taviani,
2001; Gill et al., 2005; Lucentte and Taviani, 2005;
Amano and Kiel, 2007; Amano and Kiel, in press; Kiel
and Peckmann, 2007; Campbell et ah, 2008; Kiel and
Amano, 2010). Moreover, this pattern is consistent with
the molecular study of Miyazaki et al. (2008), who esti-
mated that the worldwide spread of Bathymodiolus
(sensu lato) took place during the middle Miocene.
Page 34
THE NAUTILUS, Vol. 125, No. 1
Figure 18. Distribution of the fossil Bathymodiolus (sensu lato). 1. B willapaensis (Goedert and Squires, 1990; Squires and
Goedert. 1991; Goedert and Squires 1993; Goedert and Campbell 1995; Kiel, 2006); 2. B. inouei (this study); 3. Modiolus sp. (Katto
and Masuda, 1978); 4. B. palmarensis (Kiel et ah, 2010); 5. B. akanudaensis (Kuroda, 1931 ; Tanaka, 1959; Nobuhara et ah, 2009);
6. B. akanudaensis (Amano et ah, 2010); 7. B.? sp. (Amano et ah, 2004); 8. Bathymodiolus (sensu lato) heretaunga and Gigantidas
coseli (Saether et ah, 2010); 9. Venezuela bathymodioline (Gill et ah, 2005); 10. Trinidad bathyodiolin (Gill et ah, 2005); 11. Modiolus
(Modiolus) exbrochii exbrochii Sacco (Moroni, 1965; Taviani, 1994, 2001); 12. “ Bathymodiolus ” sp. (Nobuhara, 2003).
ACKNOWLEDGMENTS
We are grateful to Steffen Kiel (University of Gottingen)
for his review and useful comments to this paper. We
thank Kiyokazu Inoue (Obihiro City) for his information
on the fossil locality and two anonymous reviewers for
their critical reading of this manuscript and useful
advices. We also thank Tsuzumi Miyaji (University of
Tokyo) for her help on isotope analysis. This study was
partly supported by a Grant-in-aid for Scientific
Research from the Japan Society for Promotion of
Science (C, 20540456, 2008-2010) and the Nippon
Foundation-HADal Environmental Science Education
Program (HADEEP).
LITERATURE CITED
Amano, K., T. Hamuro, and M. Hamuro. 2004. Latest early-
early middle Miocene deep-sea mollusks in the Japan Sea
borderland - the warm-water Higashibessho fauna in
Toyama Prefecture. Paleontological Research 8: 29- 42.
Amano, K., R.G. Jenkins, M. Aikawa, and T. Nobuhara. 2010.
A Miocene chemosynthetic community from the Ogaya
Formation in Joetsu: Evidence for depth-related eeologie
control among fossil seep communities in the Japan
Sea back-arc basin. Palaeogeography, Palaeoclimatology,
Palaeoecology 286: 164-170.
Amano, K and S. Kiel. 2007. Fossil vesieomyid bivalves from
the North Pacific region. The Veliger 49: 270- 293.
Amano, K and S. Kiel, in press. Fossil Adulonuya (Vesicomyidae,
Bivalvia) from Japan. The Veliger 51.
Cosel, R. von. 2002. A new species of bathymodioline mussel
(Mollusca, Bivalvia, Mytilidae) from Mauritania (West
Africa), with comments on the genus Bathymodiolus
Kenk & Wilson, 1985. Zoosytema 24: 259-271 .
Cosel, R. von and R. Janssen. 2008. Bathymodioline mussels of
the Bathymodiolus (s. 1.) childressi clade from methane
seeps near Edison Seamount, New Ireland, Papua New
Guinea. Archiv fur Molluskenkunde, 137: 195-224.
Cosel, R. von and B.A. Marshall, 2010. A new genus and spe-
cies of large mussel (Mollusca: Bivalvia: Mytilidae) from the
Kermadee Ridge. Tuhinga 21: 59-73.
Distel, D.L., A. R. Baco, E. Chuang, W. Morril, C. Cavanaugh,
and C.R. Smith. 2000. Do mussels take wooden steps to
deep-sea vents? Nature 403: 725-726.
Fujita, Y., H. Matsumoto, Y. Fujiwara, |. Hashimoto, S.V.
Galkin, Ueshima, R., and J.-I. Miyazaki. 2009. Phyloge-
netic relationships of deep-sea Bathymodiolus mussels to
their mytilid relatives from sunken whale carcasses and
wood. Venus 67: 123-134.
Gill, F.L., I.C. Harding, C.T.S. Little, and J.A. Todd
2005. Palaeogene and Neogene cold seep communities
in Barbados, Trinidad and Venezuela: An overview.
Palaeogeography, Palaeoclimatology, Palaeoecology 227:
191-209.
Goedert, J.L. and R.L. Squires. 1990. Eocene deep-sea com-
munities in localized limestones formed by subduction-
related methane seeps, southwestern Washington. Geology
18: 1182-1185.
Goedert, J.L., Squires, R.L., 1993. First Oligocene record of
Calyptogena (Bivalvia: Vesicomyidae). The Veliger 36: 72-77.
Goedert, J.L., K.A. Campbell. 1995. An Early Oligocene che-
mosynthetic community from the Makah Formation,
northwestern Olympic Peninsula, Washington. The Veli-
ger 38: 22-29.
Gustafson, R.G., R. D. Turner, R. A. Lutz, and R.C. Vrijenhoek.
1998. A new genus and five new species of mussels
(Bivalvia, Mytilidae) from deep-sea sulfide/hydrocarbon
seeps in the Gulf of Mexico. Malacologia 40: 63-112.
Hatai, K. and S. Nisiyama. 1952. New Tertiary Mollusca from
Japan. Journal of Paleontology 23: 87-94.
Iwasaki, H., A. Kyuno, M. Shintaku, Y. Fujita, Y. Fujiwara,
K. Fujikura, J. Hashimoto, L.O. Martins, A. Gebruk, and
J.-I. Miyazaki. 2006. Evolutionary relationships ol deep-
sea mussels inferred by mitochondrial DNA sequences.
Marine Biology 149: 1111-1 122.
K. Amano and R. G. Jenkins, 2011
Page 35
Jones, W.J., Y-J. Won, P.A.Y. Maas, P.J. Smith, R.A. Lutz, and
R.C. Vrijenhoek. 2006. Evolution of habitat use by deep-
sea mussels. Marine Biology 148: 841- 851.
Katto, |. and K. Masuda. 1978. Tertiary Mollusca from the
southern part of Kii Peninsula, Wakayama Prefecture,
Southwest Japan. Research Reports of the Kochi Univer-
sity, Natural Science 27: 97-105.
Kenk, V. C. and B.R. Wilson. 1985. A new mussel (Bivalvia,
Mytilidae) from hydrothermal vents in the Galapagos Rift
Zone. Malaeologia 26: 253-271 .
Kiel, S. 2006. New records and species of mollusks from the
Tertiary cold-seep carbonates in Washington State, USA.
Journal of Paleontology 80: 121-137.
Kiel, S. and K. Amano. 2010. Oligoeene and Miocene
vesieomyid bivalves from the Katalla district in southern
Alaska, USA. The Veliger 51: 76-84.
Kiel, S., K.A. Campbell, and C. Gaillard. 2010. New and little
known mollusks from ancient chemosynthetie environ-
ments. Zootaxa 2390: 26-48.
Kiel, S. and J. Peckmann 2007. Chemosymbiotic bivalves and
stable carbon isotopes indicate hydrocarbon seepage at
four unusual Cenozoic fossil localities. Lethaia 40: 345-357.
Kuroda, T. 1931. Fossil Mollusca. In: Homma, F. (ed. ). Geol-
ogy of the central part of Shinano, part 4. Kokon Shoin,
Tokyo: 1-90 [in Japanese]
Lorion, J., B. Buge, C. Cruaud, and S. Samacli. 2010. New insights
into diversity and evolution of deep-sea Mytilidae (Mollusca:
Bivalvia). Molecular Phylogenetics and Evolution 57: 71-83.
Lueentte, C.C. and M. Taviani. 2005. Chemosynthetie commu-
nities as fingerprints of submarine slide-linked hydrocarbon
seepage, Miocene deep-sea strata of the Tuscan-Romagna
Appennines, Italy. Palaeogeography, Palaeoclimatology,
Palaeoecology 227: 176-190.
Miyazaki, J.-I., L. O. Martins, Y. Fujiwara, H. Matsumoto, and
Y. Fujiwara. 2010. Evolutionary process of deep-sea
bathymodiolus mussels. PLoS ONE 5: 1-1 1.
Miyazaki, J.-I., II. Matsumoto, and Y. Fujita. 2008. Evolution
and phylogeny of bathymodiolin mussels. In: Fujikura, K.,
T. Okutani and T. Maruyama (eds.) Deep-sea life -
Biological observations using research submersibles. Tokai
University Press, Hatano: 126-127. [in Japanese, title
translated by KA]
Miyazaki, J.-I.. M. Shintaku, A. Kyuno, Y. Fujiwara, J. Hashimoto
and H. Iwasaki. 2004. Phylogenetic relationships of
deep-sea mussels of the genus Bathijmodiolus (Bivalvia:
Mytilidae). Marine Biology 144: 527-535.
Moroni, M. A. 1965. Malacofauna del -Calcare a Lucine- di
S. Sofia - Forli. Palaeontographica Italica 60: 69-87.
[in Italian]
Nobuhara, T. 2003. Cold see carbonate mounds with Vesicomya
(Cah/ptogena) kawamurai (Bivalvia: Vesicomyidae) in
slope-mud facies of the Pliocene forearc basin of Sagara-
Kakegawa area, central Japan. Paleontological Research 7:
313-328.
Nobuhara, T., I. Imaizumi, T. Kaneko, H. Koike, K. Narita, and
K. Amano. 2008. Mode of fossil occurrence and taxonom-
ical re-examination of modioliform bivalves from the lower
Middle Miocene cold-seep carbonates in the Bessho For-
mation, Nagano Prefecture, central Japan. Venus 67: 102.
[in Japanese]
Peckmann, J., and V. Thiel. 2004. Carbon cycling at ancient
methane-seeps. Chemical Geology 205: 443—467.
Saether, K. P, C.T. S. Little, K.A. Campbell. B.A. Marshall,
M. Collins, and A.C. Alfaro. 2010. New fossil mussels
(Bivalvia: Mytilidae) from Miocene hydrocarbon seep de-
posits, North Island, New Zealand, with general remarks
on vent and seep mussels. Zootaxa 2577: 1—45.
Samadi, S., E. Quemere, | Lorion, A. Tiller, R. von. Cosel,
P. Lopez, C. Cruaud, A. Clouloux, and M.-C. Boisselier-
Bubayle. 2007. Molecular phylogeny in mytilids supports
the wooden steps to deep-sea vents hypothesis. C. R. Biol-
ogies 330: 446—456.
Sasaki, T., T. Okutani, and K. Fujikura. 2005. Molluscs from
hydrothermal vents and cold seeps in Japan: A review of
taxa recorded in twenty recent years (1984—2004). Venus
64: 87-133.
Squires, R.L. and J.L. Goedert. 1991. New late Eocene
mollusks from localized limestone deposits formed
by subduction-related methane seeps, southwestern
Washington. Journal of Paleontology 65: 412—416.
Tanaka, K. 1959. Molluscan fossils from central Shinano,
Nagano Prefecture, Japan (Part 1) - Fossils from Akanuda
Limestone. Journal of Shinshu University, Faculty of
Education 8:' 115-133.
Taviani, M. 1994. The “ealcari a Lucina” macrofauna
reconsidered: Deep-sea faunal oases from Miocene-age
cold vents in the Romagna Apennine, Italy. Geo-Marine
Letters 14: 185-191.
Taviani, M. 2001. Fluid venting and associated processes. In:
Vai, G.B and I.P. Martini (eds.). 20. Anatomy of an orogen:
the Apennines and adjacent Mediterranean basins.
Kluwer Academic Publishers, Great Britain: 351-366.
THE NAUTILUS 125(l):36-40, 2011
Page 36
Dillwynella voightae new species, a new skenei morph gastropod
(Turbin idae) from the western Atlantic and a new record of
Dillwynella modesta (Dali, 1889)
Thomas Kunze
Invertebrate Zoology
Swedish Museum of Natural History
Box 50007
SE 10405 Stockholm, SWEDEN
and
Department Biologic I
Ludwig-Maximilians-Universitat Miinchen
BioZentrum Martinsried
GroBhaderner Str. 2
82152 Planegg-Martinsried, GERMANY
[email protected]
ABSTRACT
Dillwynella is a marine gastropod genus found on natural wood
falls and sunken algal holdfasts in the Caribbean Sea and the
Pacific Ocean. Dillwynella voightae new species from the Gulf
of Mexico was the second species found in the Atlantic. Previ-
ously known only from two localities in the Caribbean Sea,
D. modesta (Dali, 1889) has now been recorded at a third site,
off southeastern Brazil.
Additional keywords: Bathyal, deep sea, Skeneidae, wood fall
INTRODUCTION
Dillwynella modesta (Dali, 1889) was originally
described as Teinostoma (Dillwynella) modesta (Dali,
1889a), in the family Trochidae. Later in the same year,
Dali changed the status of Dillwynella to a full genus
within the Trochidae (Dali, 1889b). The species was
described from off St. Lucia (13° 5 1,30' N, 61°03.45' YV;
Smith, 1889: 968), on coarse sand at a depth of 413
meters (Dali, 1889a). Marshall (1988) mentioned that at
the same station the wood ingesting limpet Pectinodonta
arcuata Dali, 1882 was also found, therefore both spe-
cies may have lived originally on wood (Marshall, 1988).
A second record ol 5 specimens of D. modesta from off
the coast of Georgia, USA (Dali, 1927) was given, but the
specimens are mostly immature (Dali, 1927) and,
according to Waren (pers. com.), in a very bad condition.
Nowadays, the genus Dillwynella is referred to the sub-
family Skeneinae, family Turbinidae (Marshall, 1988;
Bouchet & Rocroi, 2005). Williams and Ozawa (2006)
placed the Turbinidae inside the vetigastropod super-
family Trochoidea. This is the third record of D. modesta
since the type lot was recorded. It is the first time that
this species has been found south of the Caribbean Sea.
Marshall (1988) described Dillwynella lignicola,
Dillwynella liaptricola, and Dillwynella ingens from
the New Zealand region. Hasegawa (1997) added the
following four species from the Suruga Bay to this genus:
Dillwynella vitrea , Dillwynella planorbis, Dillwynella
fallax and Dillwynella sheisinmaruae. Macrophotographs
of the species described by Hasegawa are illustrated in
Okutani (2000: 84—85). All these species of Dillwynella
were associated with sunken wood, except Dillwynella
liaptricola Marshall, 1988, which lives on sunken algal
holdfast (Marshall, 1988) in depths of 529-1200 m.
Ganesa panamensis Dali, 1902 may be a ninth species
included in the genus Dillwynella. It was found in the
Gulf of Panama at a depth of 1865 meters in mud and
has never been found outside this type locality. In his
description and figure five years later, Dali (1902; 1908)
recorded the genus with a question mark and stated his
uncertainty about the status of Ganesa. The shell figured
(Dali, 1902: pi. 19, fig. 4) resembles that of a Dillwynella
species. If it were to be reclassified within Dillwynella,
not only it would be the first species of this genus found
in the eastern Pacific, but would also be the deepest
occurring one.
Dillwynella voightae new species is the second species
of this genus described from the Atlantic region.
MATERIALS AND METHODS
The specimens were fixed in formaldehyde and pre-
served in ethanol. Pictures of the shells with soft parts
in ethanol and of the dried shell were taken with a
T. Kunze, 2011
Page 37
macro objective and digital camera. After drying of the
specimen, the body was pushed into the shell gently,
with a needle, to disconnect the columellar muscle.
Afterward, the shell with the soft parts was rehydrated
in a solution of water and very little dishwashing liquid.
With a hooked needle, the body was then pulled out of
the shell (Geiger et ah, 2007). For the scanning electron
microscope (SEM), the rehydrated soft parts were criti-
cal-point dried. To facilitate acquisition of more informa-
tion on the soft parts, the mantle roof was removed after
the first SEM session and mounted separately. Both the
soft parts (without the mantle roof) and the mantle roof
itself were examined again under SEM. After image-
acquisition of the body under SEM, the head-food was
dissolved in KOH and the radula cleaned and mounted
for SEM. For the SEM of the shell (paratype), the oper-
culum and the radula were air dried. All SE M specimens
were coated twice with gold from different orientation,
for ISO seconds.
Institutional abbreviations used are: FMNII: The
Field Museum of National History, Chicago, USA;
MNHN: Museum National d’Histoire Naturelle, Paris,
France; and USNM: National Museum of Natural
History, Washington, DC, USA.
SYSTEMATICS
Family Turbinidae Rafinesque, 1815
Subfamily Skeneinae Clark, 1851
Genus Dillwynella Dali, 1889
Type Species: Dillwynella modesta (Dali, 1889) (by
subsequent lectotype designation of Marshall, 1988)
Dillwynella voiglitae new species
(Figures 1-4, 10-20)
Description: Protoconch (paratype. Figures 10-11):
Most specimens badly corroded. Pictures of protoconch
(Figure 11) are taken from a juvenile specimen (shell
diameter = 1.5 mm). Protoconch 390 pm maximum
diameter, 0.5 whorls, covered by a thick deposit, hiding
all structures. Teleoeonch (holotype. Figures 1-4): Adult
shell with 2.7 whorls, large (diameter 5.8 mm, height 4.8
mm), rather thin and fine, color pure white. Teleoeonch
smooth, except for growth lines, which are prosocline
and cover entire teleoeonch. Suture distinct and narrow,
getting a little deeper on first half whorl. First quarter of
apical teleoeonch whorl with a median, strong, spiral rib
starting quite strong at the border of protoconch and
teleoeonch, fading out and disappearing (Figure 11).
Umbilicus a narrow chink, demarcated by inner lip, dis-
tinct, elongated, oval, and deep. Aperture moderately
D-shaped. Parietal callus thin. Lower part of the outer
lip broad. Parietal glaze thin.
Operculum (Holotype, Figures 4, 12): Diameter 2.8 mm,
multispiral, moderately thick, short growth edge; yellow,
partly brownish, translucent at outer edge.
Figures 1—4. Dillwynella voightae new species (holotype,
FMNH 312467, Gulf of Mexico, 5.8 mm width).
Page 38
THE NAUTILUS, Vol. 125, No. 1
Figures 5-9. Dillwynella modesta (Dali, 1889). 5-6. Lecto-
type (USNM 859220, off St. Lucia, 3.9 mm width). Photos by
A. Waren. 7-9. MNHN unnumbered, off southeastern Brazil,
3.1 mm width).
Radula (Holotype, Figures 16-18): Formula n-5-l-5-n,
length 3.5 mm, width 300 pm. Central tooth large, with
broad and smooth cutting edges, shaft reduced to a low
ridge, not hooked at tip. Lateral teeth longer than broad,
outer teeth getting larger, S-shaped, tip strongly hooked,
cutting area long and smooth. Marginal teeth slender,
elongated and simple, with smooth edge, strongly
hooked at tip. Third to fourth marginal teeth longest,
getting shorter and narrower laterally. Jaws present, with
prismatic elements, thin (Figure 20).
Gross Anatomy (Holotype, Figure 13-15): Body flesh-
colored; snout broad and flat; cephalic tentacles broad
at basis, getting long and slender at tip, with sensory
papillae. Large, V-shaped propodium. [Due to drying
and rehydration of soft parts, small structures like eye-
stalks and suboptic tentacles were stuck together and
could not be seen.] Four epipodial tentacles on each side
of mesopodium. Three epipodial tentacles, relatively
short, conical shaped with laterally placed sensory papil-
lae. First one has attached a small accessoiy tentacle,
which is smooth and small, without sensoiy papillae
(epipodial sense organ). Large number of sensory papil-
lae present on mantle edge and mantle roof. [Attempts
to separate the mantle roof from the soft parts caused
exposure of gut contents, which consisted of wood fibers
(Figure 19).
Type Material: Holotype: A dried shell, FMNH
312467 (Figures l^f, 12-20). Paratypes: 16 specimens
in ethanol, FMNH 312220, 1 juvenile shell dried, used
for SEM pictures of the protoconch, FMNH 312468
(Figures 10-11).
Type Locality: North Atlantic, Gulf of Mexico, Loui-
siana, U.S.A. (27° 44.09' N, 91° 14.49' VV), natural wood
fall, 610 m depth. The sample was taken by the grab
of the DSV Johnson-Sea Link 1 (operating from R/V
Seward Johnson), 19 Aug. 2006.
Material Preservation: The specimens were fixed in
formalin and stored afterward in 70% ethanol.
Etymology: Named after Dr. Janet R. Voiglit, Field
Museum of Natural History, who collected the specimens.
Comparative Remarks: Dillwynella voightae new
species is the largest described species of this genus.
The teleoconch resembles Dillwynella vitrea Llasegawa,
1997, D. haptricola Marshall, 1988, and D. modesta
(Dali, 1889). These four species have a distinct, median
strong spiral rib on the beginning of the protoconch
and have no ribs in the area around the umbilicus.
Dillwynella vitrea , D. haptricola, and D. voightae differ
by the shape of their umbilicus. Dillwynella vitrea has a
distinct big umbilicus, whereas D. voightae shows a nar-
row chink, and D. haptricola a small chink almost closed
by its thin inner lip. Dillwynella modesta (Figures 5-9;
SEM images: Marshall, 1988: fig. 2: D-E) differs by
lacking an umbilicus.
T. Kunze, 2011
Page 39
Figures 10-20. Dillwynella voightae new species. 10-11. Juvenile specimen shell (paratype, FMNH 312220, shell 2.9 nun width).
10. Shell. 11. Protoconch of juvenile specimen shell. 12-20. Holotype (FMNH 312467, 5.8 mm width). 12. Operculum. 13. Ventral
view of foot. 14. Epipodial tentacles and epipodial sense organs. 15. Lateral view of soft parts with propodium and snout.
16-18. Radula. 19. C Jut content. 20. J aw. Abbreviations: a, attachment area of the operculum; e, epipodial tentacle; es, epipodial
sense organ; s, snout; p, propodium.
Page 40
THE NAUTILUS, Vol. 125, No. 1
Distribution: Known only from type locality.
Remarks: The wood fibers in the gut show that D.
voightae feeds directly on wood and grazes not only on
the bacteria film.
Dillwynella modesta (Dali, 1889)
Type Material: Lectotype: A dried shell, USNM
859220 (Marshall, 1988; originally syntype USNM
95077, after Dali, 1889a), illlustrated in Dali (1889a),
macrophotographs (Figures 5-6). Paralectotype: A dried
shell, USNM 95077; SEM pictures in Marshall (1988:
958, 993).
Type Locality: St. Lucia at Blake Station 205 coarse
sand in 413 meters depth.
Material Examined: Two diy specimens, one empty
shell, and one shell with soft parts, MNHN (Figures 7-
9), off southeastern Brazil (23°47' S, 42° 10' W), N.O.
Marion Dufresne, Cruise MD 55, Bouchet, Leal, and
Metivier coll. May 1987, sta. CB105, 610 m depth.
Distribution: Western Atlantic from Gulf of Mexico
to Brazil, but only known from three localities.
Remarks: The specimens of Dillwynella modesta
found off Brazil (Figures 7-9) are quite similar to the
types. This is the second finding of this species and
shows its wide distribution. PJnfortunately, there are no
data available for the substrate of the specimens.
DISCUSSION
The presence of an epipoclial sense organ at the base of tire
papillate epipoclial tentacles, described by Crisp (1981)
and histology shown for microgastropods in Kunze et al.
(2008), underlines tire position of this genus in tire
Trochoidea/Turbinoidea (Bouchet and Rocroi, 2005). To
solve its precise position in this group and confirm dre
position in the Skeneinae more information like microanat-
omy or sequencing are needed. The new record of
Dillwynella modesta shows its vide occurrence in dre
western Adantie. It also demonstrates how rare and incom-
plete dre records of sunken wood species are in this area.
ACKNOWLEDGMENTS
I thank Dr. Janet B. Voight, Dr. Joelren Gerber (FMNH)
and Dr. Philippe Bouchet (MNHN) from Marion-
Dufrense, Cruise MD 55, for providing the specimens.
I am very grateful to Dr. Anders Waren (Swedish
Museum of Natural I listory, Stockholm) for support and
comments on the topic of this work, as well for providing
the pictures of the types of Dillwynella modesta. Dr.
Bruce Marshall (National Museum of New Zealand Te
Papa Tongarewa, Wellington) provided helpful com-
ments that improved the manuscript. This research was
supported by a fellowship ol the Gottlieb Daimler- and
Karl Benz-Foundation (Ladenburg, Germany).
LITERATURE CITED
Bouchet, P. and J.-P. Rocroi. 2005. Classification and nomen-
clator of gastropod families. Malacologia 47: 1-397.
Crisp, M. 1981. Epithelial sensoiy structures of trochids. Journal
of the Marine Biological Association of the UK 61: 95-106.
Dali, W. H. 1889a. Report on the results of dredging under the
supervision of Alexander Agassiz in the Gulf of Mexico
(1877-78) and in the Caribbean Sea (1879-80). 29: Report
on the Mollusca, Part 2: Gastropoda & Scaphopoda. Bul-
letin of the Museum of Comparative Zoology (Harvard)
18: 1-M92.
Dali, W. H. 1889b. A preliminary catalogue of the shell-bearing
marine molluscs and brachiopods of the south-eastern
coast of the United States. United States National
Museum Bulletin 37: 221 pp.
Dali, W. H. 1902. Illustrations and description of new,
unfigured, or imperfectly known shells, chiefly American,
in the U. S. National Museum. Proceedings of the United
States National Museum 24: 499-566.
Dali, W. II. 1908. Reports on the dredging operations off the
west coast of Central America to the Galapagos, to the west
coast of Mexico, and in the Gulf of California, in charge of
Alexander Agassiz, carried on by the U. S. Fish Commission
Steamer “Albatross,” during 1891, Lieut. Commander Z. L.
Tanner, U. S. N., Commanding, XXXVIII. and Reports on
the Scientific Results of the Expedition to the eastern trop-
ical Pacific in charge of Alexander Agassiz, by the U. S. Fish
Commission Steamer “Albatross,” from October, 1904, to
March, 1905, Lieut. Commander L. M. Garrett, U. S. N.,
Commanding, XIV. Bulletin of the Museum of Compara-
tive Zoology (Harvard) 46: 205—187.
Dali, W. H. 1927. Small shells from dredgings off the southeast
coast of the United States by the United States fisheries
Steamer “Albatross” in 1885 and 1886. Proceedings of the
United States National Museum 70: 1-134.
Geiger, D.L., B.A. Marshall, W. F. Ponder, T. Sasaki, and
A. Waren. 2007. Techniques for collecting, handling, pre-
paring, storing and examining small molluscan specimens.
Mollusean Research 27: 1-50.
Hasegawa, K. 1997. Sunken wood-associated gastropods col-
lected from Suruga Bay, Pacific Side of the central
Honshu, Japan, with descriptions of 12 new species.
National Science Museum Monographs 12: 59-123.
Kunze, T., F. Beck, M. Bruckner, M. HeB, and G. Haszprunar.
2007. Skeneimorph Gastropods in Neomphalina and
Vetigastropoda - A Preliminary Report. Zoosymposia 1:
119-131.
Marshall, B.A. 1988. Skeneidae, Vitrinellidae and Orbit-
estellidae (Mollusca: Gastropoda) associated with biogenic
substrata from bathyal depth off New Zealand and New
South Wales. Journal of Natural History 22: 949-1004.
Okutani, T. 2000. Marine Mollusks in Japan. Tokai University
Press Tokyo 1173 pp.
Smith, S. 1889. List of dredging stations ol the U.S. Coast
Survey, and the British Steamer Challenger, in North
American water, from 1867 to 1887, together with those
of the principal European Government Expeditions in the
Atlantic and Arctic Oceans. Annual Report Commissioner
Fish and Fisheries 1886: 873-1017.
Williams, S.T. and T. Ozawa. 2006. Molecular phylogeny suggests
polyphyly of both the turban shells (family Turbinidae) and
the superfamily Trochoidea (Mollusca: Vetigastropoda).
Molecular Phylogenetics and Evolution 39: 33-51.
The first confirmed record of the Chinese
Pond Mussel ( Sinanodonta woodiana)
(Bivalvia: Unionidae) in the United States
The Chinese Pond Mussel, Sinanodonta woodiana (Lea,
1834) (previously referred to as Anodonta woodiana ), is a
widely introduced unionid around the world. There is
evidence that Anodonta from China were imported into
Asian markets in the western United States as early as
the late 1800s (Wood, 1892), but were not known to have
been released in open waters. Watters (1997) surveyed
the countries where this nonindiginous species had been
documented as established and reported them from
France, Hungary, Romania, Indonesia, Costa Rica, and
the Dominican Republic. The native range ol this spe-
cies was reported to be eastern Russia, China, Cambodia
[doubtful], Thailand [this is refuted by Brandt (1974)],
Malaysia [it is claimed by Brandt (1974) to have been
imported to several Malaysian localities by Chinese fish
breeders] and Taiwan. Watters (1998, 1999) added
Singapore, the Philippines, and possibly Panama to the
list of countries where this species has been introduced.
Watters (1997) noted the absence of Sinaondonta
woodiana records for the United States but pointed out
that it might be confused with the native species of
Anodonta of similar size and shape, Anodonta
suborbiculata or Anodonta sp., subsequently described
as A. hartfieldorum. Watters observed that “Given the
history of this species' invasion elsewhere, and the con-
tinued farming and exporting [importing] of its hosts, it is
likely that A. woodiana eventually will invade North
America and other countries.
Information on the range expansion of the Chinese
Pond Mussel across Europe has been continuously
updated by Mienis (1999, 2001, 2002a-c; 2003, 2004a, b;
2005, 2006a-c; 2007a, b; 2008a, b; 2009a, b; 2010),
documenting the occurrence of this invasive mussel as it
spread across 15 countries in Europe: Austria, Belgium,
Bulgaria, France, Greece, Hungary, Italy, Moldova,
Poland, Romania, Serbia, Slovakia, Sweden, the Nether-
lands, and Ukraine. Distribution information for France
and Europe including a discussion of colonization
hypotheses and ecological threats has been provided by
Adam (2010). Bogan and Sehilthuizen (2004) reported it
from the island ol Borneo, Sabah, Malaysia.
Sinanodonta woodiana appears to have been introduced
via the release of host fishes infested with gloehidia.
Watters (1997) listed potential nonindigenous fish hosts
including Cyprinidae (minnows): Acheilgnathus moriokae ,
Metzia takakii , Puntius semifasciolatus , Rhodens tabira ,
Zncco platypus , Z. temmincki; and Gobiidae (gobies):
Rhinogobius brunneus. Fish hosts also include commer-
cially imported cultured fish: Cyprinidae: Bighead
Carp (. Hypophthalmichthys nobilis), Black Caip
(. Mylopharyngodon piceus ), Common Carp ( Cyprinus
cai-pio). Grass Carp ( Ctenopharyngodon idella), Silver
Carp ( Hypophthalmichthys molitrix ); and Cichlidae (cich-
lids): Nile Tilapia ( Oreochromis niloticus). One native fish,
Poecillidae, (mosquitofishes), Western Mosquitofish, Gam-
busia ajfinis , is also reported to serve as a glochidial host.
Mienis (2002b) noted that Grass Caip and Silver Carp
were the probable host fish for Sinaondonta woodiana
when it was first introduced into Europe in 1983.
Three live specimens of anodontine bivalves
suspected to be Sinaondonta woodiana were collected
from the New Jersey Conservation Foundation’s fish
ponds, off Joe Ent Road, 3.3 air miles south-southeast of
the center of Pittstown, Franklin Township, Hunterdon
County, New |ersey by the NJ Endangered and
Nongame Species Program staff on 7 June 2010. These
specimens were placed directly into 95% ethyl alcohol
and sent to the North Carolina State Museum of Natural
Sciences, Raleigh, and catalogued (number NCSM
46965) into the Mollusk Collection.
A small mantle snip was taken to be used for DNA
analyses. DNA was extracted and a portion of the mito-
chondrial gene cytochrome oxidase subunit I [COI] was
sequenced following protocols outlined in Raley et al.
(2006). A BLAST search (Zhang et al, 2000) was per-
formed with these sequences which confirmed their
identification as Sinanodonta woodiana. These same
sequences were inserted into our data matrix of
anodontine bivalves where it clustered with two other
specimens of S. woodiana and was sister to Anodonta
beringiana. Genetic data and shell characters appear
sufficient to verify the identity of these samples as
S. woodiana , confirming the first record of an
established population of this highly invasive species in
the U.S.
Following the discovery of Sinaondonta woodiana , the
New Jersey Conservation Foundation staff lowered
water in the ponds and killed all fish with Rotenone. Fish
removed from the ponds included: Bluegill, Bighead
Capo, Common Cap), Grass Caip (diploid), Largemouth
Bass, and American Eel. Although the ponds have been
lowered, they are fed by runoff and springs and have
begun to refill. It is unknown whether live mussels
remain in the ponds. Planning is underway to determine
the best method of complete eradication at the site. Pos-
sible actions include either draining the ponds via
pumping or allowing them to freeze over during the
winter and then conducting surveys to determine if there
are surviving individuals. Shells have been found in
Wiekecheoke Creek downstream of the ponds at several
locations but no live individuals were found. This creek is
Page 42
THE NAUTILUS, Vol. 125, No. 1
Figure 1. Picture of the shell of one of the specimens col-
lected from fish ponds, Hunterdon County, New Jersey. NCSM
46965-3.
Figure 2. Picture of umbonal sculpture of specimen
Sinanoclonta woodiana NCSM 46965.1.
tributary to Delaware River and also connects to the D &
R Canal at Stockton, New |ersey. The occurrence of
shells along Wickeeheoke Creek and a recent sighting
of a relict shell near the D & R canal at Prallsville Mills
is evidence that fish hearing Chinese Pond Mussel
gloehidia may have spread downstream. The extent of
the invasion is unclear at this time.
The molecular work presented here is a contribution
from the NC State Museums Molecular Genetics
Laboratory.
LITERATURE CITED
Adam, B. 2010. L’Anodonte chinoise Sinanodonta woodiana
(Lea, 1834) (Mollusca, Bivalvia, Unionidae): une espece
introduite qui colonise le bassin Rhone-Mediterranee.
MalaCo 6:278-287. www.journal-malaco.fr
Bogan, A.E. and M. Schilthuizen. 2004. First report of the
introduced freshwater bivalve, Anodonta woodiana (Lea,
1834) from the island of Borneo, Sabah, Malaysia.
Ellipsaria 6(1): 5.
Brandt, R.A.M. 1974. The non-marine aquatic Mollusca of
Thailand. Arehiv fur Molluskenkunde 105:1-423.
Mienis, H.K. 1999. Once more Anodonta ( Sinanodonta )
woodiana. Triannual Unionid Report 18:2-3.
Mienis, H.K. 2001. Some more information concerning the
invasive mussel Sinanodonta woodiana (Lea, 1834).
Ellipsaria 3(2): 9-10.
Mienis, H.K. 2002a. The Chinese Pond Mussel Sinanodonta
woodiana continues its conquest of Europe. Ellipsaria
4(1): 11-12.
Mienis, H.K. 2002b. The Chinese Pond Mussel Sinanodonta
woodiana in Europe: Further gleanings. Ellipsaria 4(2):
12- 13.
Mienis, H.K. 2002c. Sinanodonta woodiana also in Serbia.
Ellipsaria 4(3): 9—10.
Mienis, H.K. 2003. Additional information concerning the con-
quest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 8. Where are the records from
the Netherlands? Ellipsaria 5(3): 14-15.
Mienis, H.K. 2004a. Additional information concerning the
conquest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 9. News from Belgium, Italy,
Romania and Serbia. Ellipsaria 6(1): 8-9.
Mienis, H.K. 2004. b Additional information concerning
the conquest of Europe by the invasive Chinese Pond
Mussel Sinanodonta woodiana. 10. News from the Neth-
erlands, Belgium and the Czech Republic. Ellipsaria 6(3):
13- 14.
Mienis, H. K. 2005. Additional information concerning the con-
quest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 11. News from Hungary, Poland
and Ukraine. Ellipsaria 7(1): 8-9.
Mienis, H.K. 2006a. Additional information concerning the
conquest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 12. News from Austria, Slovakia
and Greece. Ellipsaria 8(1): 8-9.
Mienis, H.K. 2006b. Additional information concerning
the conquest of Europe by the invasive Chinese Pond
Mussel Sinanodonta woodiana. 13. News from Austria,
the Netherlands, Poland and Ukraine. Ellipsaria 8(2):
9-10.
Mienis, H.K. 2006c. Additional information concerning the
conquest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 14. News from Italy, Romania and
Serbia. Ellipsaria 8(3): 8-9.
Mienis, H.K. 2007a. Additional information concerning the
conquest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 15. News from Bulgaria, Italy,
Poland and Sweden. Ellipsaria 9(2): 3-4.
Mienis, H.K. 2007b. Additional information concerning the
conquest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 16. News from the Czech Repub-
lic, Germany, Poland, Romania, Serbia and Slovakia.
Ellipsaria 9(3): 9-10.
Mienis, H.K. 2008a. Additional information concerning the
conquest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 17. News from Hungary, Italy,
Poland and Serbia. Ellipsaria 10(1): 10-11.
A. E. Bogan et al., 2011
Page 43
Mienis, H.K. 2008b. Additional information concerning the
conquest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 18. News from Austria, Greece,
the Netherlands, Poland and Slovakia. Ellipsaria 10(2):
9-10.
Mienis, H.K. 2009a Additional information concerning the
conquest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 19. News from Austria, France,
Hungary, Moldova, Romania, Serbia and Sweden.
Ellipsaria 11(1): 10-11.
Mienis, H.K. 2009b. Additional information concerning the
conquest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 20. News from Belgium.
Ellipsaria 11(2): 5-6. [Repeated 2009, Ellipsaria 11
(3): 13.].
Mienis, H.K. 2010. Additional information concerning the con-
quest of Europe by the invasive Chinese Pond Mussel
Sinanodonta woodiana. 22. News from Austria, France,
Italy, Poland and Ukraine. Ellipsaria 12(2): 9.
Raley, ME., J.F. Levine and A. E. Bogan. 2006. Hemolymph
as a nonlethal and minimally invasive source of DNA
for molecular systematic studies of freshwater mussels.
Tentacle 14:33-35.
Watters, G.T. 1997. A synthesis and review of the expanding
range of the Asian freshwater mussel Anodonta woodiana
(Lea, 1834) (Bivalvia: Unionidae). The Veliger 40: 152-156.
Watters, G.T. 1998. The continuing saga of Anodonta
woodiana. Triannual Unionid Report 14: 10.
Watters, G.T. 1999. More Anodonta woodiana. Triannual
Unionid Report 17:18.
Wood, W. M. 1892. Appearance of an Asiatic Anodonta in
the Chinese markets of San Francisco. The Nautilus 6(5):
51-52.
Zhang, Z., S. Schwartz, L. Wagner, and W. Miller. 2000.
A greedy algorithm tor aligning DNA sequences. Journal
of Computational Biology 7: 203-14.
Arthur E. Bogan
North Carolina State Museum of Natural
Sciences Research Laboratory, MSC 1626
Raleigh, NC. 27699-1626 USA
[email protected]
Jeanette Bowers-Altman
New Jersey Department of Environmental Protection
New Jersey Division of Fish and
Wildlife Endangered and Nongame
Species Program 220 Blue Anchor Road,
Sicklerville, NJ 08081 USA
Morgan E. Raley
North Carolina State Museum of Natural Sciences
Research Laboratory, MSC 1626 Raleigh,
NC 27699-1626 USA
THE NAUTILUS 125(1 ):44, 2011 Page 44
Errata
In the last issue (The Nautilus, volume 124, issue number 4), on page 161, right-hand column, two last lines, replace . .and
redescribed Archivesica nipponica in detail.” for “. . .and redescribed Archivesica shiretokensis in detail.”
In the same issue (The Nautilus, volume 124, issue number 4), the following authors and page numbers were omitted from the “Index
to Authors” (unnumbered page 195 at the end of issue):
Bertsch, II 188
Fallon, P„ Jr. 166
Lyons, W. G 192
Rosenberg, G 192
Snyder, M. A 192
Sponsored in part by the State of Florida, Department
of State, Division of Cultural Affairs, the Florida Arts
Council and the National Endowment for the Arts.
NATIONAL
ENDOWMENT
FOR THE ARTS
INSTRUCTIONS TO AUTHORS
THE NAUTILUS publishes articles on all aspects of the
biology, paleontology, and systematics of mollusks.
Manuscripts describing original, unpublished research
and review articles will be considered. Brief articles, not
exceeding 1000 words, will be published as notes and do
not require an abstract. Notices of interest to the mala-
cological community will appear in a notices section.
Manuscripts: Each original manuscript and accompa-
nying illustrations should be submitted to the editor pref-
erably via e-mail or as hardcopy in triplicate.
Text must conform to the dimensions of 8V2 x 1 1-inch
paper, double-spaced, and single-column throughout (in-
cluding literature cited, tables, and figure captions). Au-
thors should follow the general recommendations of Sci-
entific Style and Format — The CSE Manual for Authors,
Editors, and Publishers, available from the Council of
Science Editors at www.councilscienceeditors.org. The
first mention of a scientific name in the text should be
accompanied by the taxonomic authority, including year.
Latinized names and other words to be printed in italics
must be underlined; leave other formatting indications to
the editor. Metric, not English, units are to be used. Geo-
chronologic modifiers should be capitalized only when
units are formally recognized: for instance, use Late Cre-
taceous but early Miocene. Likewise, only modifiers of
formally recognized chronostratigraphic units are capi-
talized: use Lower Jurassic but upper Oligocene.
The sequence of sections should be title page, ab-
stract, introduction, materials and methods, results, dis-
cussion, acknowledgments, literature cited, tables, figure
captions, figures. The title page should include the title,
author’s name(s) and address(es). If corresponding au-
thor is not the senior author, please indicate. The ab-
stract should summarize in 250 words or less the scope,
main results, and conclusions of the article. Abstracts
should be followed by a list of additional key words. All
references cited in the text must appear in the Literature
Cited section and vice-versa. Please follow a recent issue
of THE NAUTILUS for bibliographic style, noting that
journal titles must be unabbreviated. Information on
plates and figures should be cited only if not included
within the pagination of cited work. Tables must be num-
bered and each placed on a separate page. If in doubt,
please follow a recent issue of the journal for sequence of
sections and other style requirements.
Illustrations: Illustrations are rendered either at full-
page width (maximum width 17 cm) or column width
(maximum width 8.2 cm). Please take these dimensions
into consideration when preparing illustrations. Page-
width illustrations ideally should span the entire width of
printed page (17 cm). “Tall” page-width illustrations
should be avoided, square or “landscape” formats work
better. Please design plates accordingly, such that there
will be enough space left at the bottom of printed page
for plate caption. (Digital technology has made this task
much easier.)
All line drawings must be in black, clearly detailed,
and completely labeled. Abbreviation definitions must be
included in the caption. Line drawings must be high
resolution files at at least 600 dpi (dots per inch) resolution
at actual size. Standard digital formats for line drawings
include .tif, .bmp, .psd, .eps, and .pdf.
Photographs may be submitted in black-and-white or
color, preferably in RGB mode if in color. Standard digi-
tal formats for photographs include .tif, .psd, .jpg, or .pdf.
Photographs must be high resolution files at least 300 dpi
resolution at actual size.
If more than one figure is included in an illustration,
all figures are to be consecutively numbered (Ligures 1,
2, 3,'. . . , NOT Ligures 1A, IB, 1C, . . . , NOR Plate 1,
Ligure 1, . . .). In illustrations with more than one figure,
make sure that blank areas between figures is kept to a
minimum, thereby allowing for more area for each indi-
vidual figure.
Compressed files (e.g., .jpg) may be used to facilitate
transmission of files during original submission, but may
not be acceptable at final submission (see below).
Voucher Specimens: Deposition of the holotype in a
recognized institutional, public collection is a require-
ment for publication of articles in which new species-
level taxa are described. Deposition of paratypes in in-
stitutional collections is strongly encouraged, as is the
deposition of representative voucher specimens for all
other types of research work.
The Editorial Process: Upon receipt, all manuscripts are
assigned a number and acknowledged. The editor reserves
the right to return manuscripts that are substandard or
not appropriate in scope for THE NAUTILUS. Manu-
scripts deemed appropriate for the journal will be sent
for critical review to at least two reviewers. The review-
ers’ recommendations will serve as basis for rejection or
continuation of the editorial process. Reviewed manu-
scripts will be sent back to authors for consideration of
the reviewers’ comments. The revised version of the
manuscript may at this point be considered accepted for
publication by the journal.
Final Submission: Authors of accepted manuscripts are
required to submit a final version via e-mail to the editor
at [email protected]. Please do not send low-resolu-
tion or compressed illustration files at this stage. Send any
files larger than 20 Mb on a CD or DVD to the editor.
Proofs: After typesetting, proofs will be sent to the au-
thor. Author should read proofs carefully and send cor-
rections to the editor within 48 hours. Changes other than
typesetting errors will be charged to the author at cost.
Offprints: An order form for offprints will accompany
the proofs. Offprints will be ordered through the editor.
Authors with institutional, grant, or other research sup-
port will be asked to pay for page charges at the rate of
$60 per page.
0 This paper meets the requirements of ANSI/NISO Z39. 48-1 992 (Permanence of Paper)
FHE NAUTILUS
Volume 125, Number 2
June 10, 2011
'ISSN 0028-1344
A quarterly devoted
to malacology.
LfD/
^JUTHSO/y
JUN A o '/()))
R ARIES**
EDITOR-IN-CHIEF
Dr. Jose H. Leal
The Bailey-Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
BUSINESS MANAGER
Rodger Bunnell
The Bailey- Math lews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
EDITOR EMERITUS
Dr. M. G. Harasewych
Department of Invertebrate Zoology
National Museum of
Natural Histoiy
Smithsonian Institution
Washington, DC 20560
CONSULTING EDITORS
Dr. Rudiger Bieler
Department of Invertebrates
Field Museum of
Natural History
Chicago, IL 60605
Dr. Arthur E. Bogan
North Carolina State Museum of
Natural Sciences
Raleigh, NC 27626
Dr. Philippe Bouchet
Laboratoire de Biologie des
Invertebres Marins et Malacologie
Museum National d’Histoire Naturelle
55, rue Buffon
Paris, 75005 France
Dr. Robert H. Cowie
Center for Conservation Research
and Training
University of Hawaii
3050 Maile Way, Gilmore 409
Honolulu, III 96822
Dr. Robert T. Dillon, Jr.
Department of Biology
College of Charleston
Charleston, SC 29424
Dr. Eileen H. [okinen
8234 E. North' Shore Road
Sault Ste. Marie, All 49783
Dr. Douglas S. Jones
Florida Museum of Natural Histoiy
University of Florida
Gainesville, FL 32611-2035
Dr. Harry G. Lee
4132 Ortega Forest Drive
Jacksonville; FL 32210
Dr. Charles Lydeard
Biodiversity and Systematics
Department of Biological Sciences
University of Alabama
Tuscaloosa, AL 35487
Bruce A. Marshall
Museum of New Zealand
Te Papa Tongarewa
PO. Box 467
Wellington, NEW ZEALAND
Dr James H. McLean
Department of Malacology
Natural History Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Paula M. Mikkelsen
Paleontological Research
Institution
1259 Trumansburg Road
Ithaca, NY 14850
Dr. Diarmaid 6 Foighil
Museum of Zoology and Department
of Biology
University of Michigan
Ann Arbor, MI 48109-1079
Dr. Gustav Paulay
Florida Museum of Natural Histoiy
University of Florida
Gainesville, FL 32611-2035
Mr. Richard E. Petit
P.O. Box 30
North Myrtle Beach, SC 29582
Dr. Gaiy Rosenberg
Department of Mollusks
The Academy of Natural Sciences
1900 Benjamin Franklin Parkway
Philadelphia, PA 19103
Dr. Angel Valdes
Department of Malacology
Natural Histoiy Museum
of Los Angeies County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Geerat J. Vermeij
Department of Geology
University of California at Davis
Davis, CA 95616
Dr. G. Thomas Watters
Aquatic Ecology Laboratory
1314 Kinnear Road
Columbus, OH 43212-1194
SUBSCRIPTION INFORMATION
The subscription rate for volume
125 (20J 1) is US $54.00 for
individuals, US $88.00 for
institutions. Postage outside the
United States is an additional US
$10.00 for regular mail and US
$28.00 for air delivery. All orders
should be accompanied by payment
and sent to: THE NAUTILUS, P.O.
Box 1580, Sanibel, FL 33957, USA,
(239) 395-2233.
Change of address: Please inform
the publisher of your new address at
least 6 weeks in advance. All
communications should include both
old and new addresses (with zip
codes) and state the effective date.
THE NAUTILUS (ISSN 0028-1344)
is published quarterly bv The Bailey-
Matthews Shell Museum, 3075
Sanibel-Captiva Road, Sanibel, FL
33975.
Periodicals postage paid at Sanibel,
FL, and additional mailing offices.
POSTMASTER: Send address
changes to: THE NAUTILUS
P.O. Box 1580
Sanibel, FL 33957
THE0NAUTILUS
CONTENTS
Volume 125, Number 2
June 10, 2011
ISSN 0028-1344
Lindsey T. Groves New species of Paleogene cypraeoideans (Gastropoda) from the Pacific
slope of North America 45
Phillip J. Fallon, Jr. Descriptions and illustrations ol some new and poorly known
turrids (Gastropoda: Turridae) of the tropical northwestern Atlantic.
Part 3. Genus Crossispira Swainson, 1840, subgenus Crassisclava
McLean, 1971 53
Kyle F. Bennett DNA barcoding reveals Brachidontes (Bivalvia: Mytilidae) from
Andrew J. Reed two ecologically distinct intertidal habitats on Long Key,
Richard A. Lutz Florida Keys, are cryptic species, not ecotypes 63
Richard E. Petit A new Sveltia (Gastropoda: Cancellariidae) from off Guadeloupe,
M.G. Hai •asewyeh French West Indies 72
John I). Taylor Not a “living fossil:" the eastern Pacific bivalve Tellidorella belongs with
Emily A. Glover Lucinidae, not Cardiniidae 75
Paul Valentieh-Scott
Cristian Aldea A new gigantic species of Z eidora Adams, I 860 from Antarctic waters
Diego G. Zelaya (Gastropoda: Fissurellidae) 79
Jesus S. Troneoso
Timothy A. Pearce Do Philomycus carolinianus (Gastropoda: Philomycidae) prefer
Katherine A. Porter to congregate? 83
Eugene V. Goan Authorship and date of a key South American paper by
Richard E. Petit Phillip P. King (1832) 86
Diego G. Zelaya
THE NAUTILUS 125(2):45-52, 2011
Page 45
New species of Paleogene cypraeoideans (Gastropoda)
from the Pacific slope of North America
Lindsey T. Groves
Natural History Museum of Los Angeles County
Malacology Section, 900 Exposition Boulevard
Los Angeles, CA 90007 USA
[email protected]
ABSTRACT
A new species of Bemaya sensu stricto (Cypraeidae) from
Eocene rocks of Washington and four new species of Eocypraea
sensu stricto (Eocypraeidae), one from Paleocene strata of
northern California, two from Eocene strata of Washington,
and one from Baja California Sur, Mexico, are described. The
new species of Bemaija sensu stricto and the Washington spe-
cies of Eocypraea sensu stricto represent the northernmost
Cenozoie records for their respective genera in western North
America. A tentative record of Eocypraea ( Eocypraea ) inflata
(Lamarck, 1802), previously known only from the Lutetian Stage
(middle Eocene) of France, Belgium, and England, is noted
from the middle Eocene Domengine Formation of Kings
County, California.
Additional keywords: Bemaya, Eocypraea, fossils, paleontology,
Paleocene, Eocene
INTRODUCTION
Five new species of Paleogene cypraeoideans are
described from localities on the Pacific slope of North
America (Table 1). The new species of Bemaija sensu
stricto represents the first record of this genus from
Washington and is the northernmost record of the
genus in western North America. Four new species of
Eocypraea sensu stricto are described from strata in Lake
County, California, Thurston and Lewis counties, Wash-
ington, and Baja California Sur, Mexico. All four species
represent first records from their respective regions
and the species from Washington are the northernmost
representatives of the genus in western North America.
These taxa are indicators of shallow, warm water depos-
itional environments.
STRATIGRAPHY AND GEOLOGIC AGES
The formations listed below, from oldest to youngest,
are those from which the new species are described.
Because these formations have been mentioned by previ-
ous authors, only a brief overview of the stratigraphic
nomenclature and age will be mentioned. Readers will be
referred to additional sources for detailed descriptions.
Martinez Formation
Whitney in Gabb (1869: xiii) provisionally proposed tbe
Martinez Group to “include a series of beds, of small
geographical extent, found at Martinez [California] and
on the northern flank of Monte Diablo.” He also incor-
rectly noted that the group may eventually prove to be
worthy of ranking only as a subdivision of the Cretaceous
Chico Group. In the same volume, Gabb (1869: 129)
referred to the Martinez Group as “the upper portion of
‘Division A’ of the California reports.” These beds were
provisionally demonstrated to be “Paleocene” age by
Clark and Vokes (1936). Brice (1953) referred to Paleo-
cene strata in Lake County, California, as Martinez For-
mation. He noted that “fossils characteristic of the
Paleocene Martinez are found in scattered localities
through the sandstone, and the lithologic assemblage is
similar to that of the type Martinez formation.” There-
fore, for the lack of a more appropriate name, the usage
of Brice will be followed and these uppermost lower or
lowermost upper Paleocene (Danian/Thanetian stages)
beds in Lake County will be referred to as “Martinez”
Formation.
Crescent Formation
The Crescent Formation of Arnold (1906: 460-461)
was described for a “series black basalt and greenish
basalt tuffs and tuffaceous sands found in the vicinity of
Port Crescent,” Clallam County, Washington. Weaver
(1937) referred to the Crescent Formation as middle
Eocene (“Capay” California provincial molluscan stage
[CPMS]) tuffaceous shales and sandstones and basaltic
agglomerate of marine origin exposed on the northern
flank of the Olympic Peninsula. Recently, much confu-
sion has been ascribed to Eocene deposits near
Maynard on Discoveiy Bay. Durham (1944) referred
Page 46
THE NAUTILUS, Vol. 125, No. 2
Table 1. List of the species of Bemaya (Protocypraea),
Bemaya sensu stricto, and Eocypraea sensu stricto from
western North America and their generalized localities
(formation is included for new species).
Bemaya (Protocypraea) and Bemaya sensu stricto
Late Cretaceous
Bemaya ( Protocypraea ) argonautica (Anderson, 1958)
[Jackson Co., Oregon]
B. (P.) berryessae (Anderson, 1958) [Yolo Co., California]
B. (P.) gualalaensis (Anderson, 1958) [Mendocino Co,
California]
B. (P.) popenoei Groves, 2004 [Orange Co., California]
B. (P.) rineyi Groves, 1990 [San Diego Co., California]
B. ( Bemaya ) beardi Groves, 2004 [Vancouver Id., British
Columbia]
B. (B.) crawfordcatei Groves, 1990 [San Diego Co., California]
B. ( B . ) jeanae Groves, 2004 [Butte Co., California]
Eocene
Bemaya (Protocypraea) grovesi Squires and Demetrion, 1992
[Baja California Sur, Mexico]
Bemaya (Bemaya) squiresi new species [Crescent Formation,
Jefferson Co., Washington]
Eocypraea sensu stricto
Late Cretaceous
Eocypraea (Eocypraea) louellae Groves, 1990 [Yolo Co.,
California]
Paleocene
Eocypraea ( Eocypraea ) novasumma (Nelson, 1925) [Ventura
Co., California]
Eocypraea (Eocypraea) takeosusukii new species [“Martinez”
Formation, Lake Co., California]
Eocene
Eocypraea (Eocypraea) batequensis new species [Bateque
Formation, Baja California Sur, Mexico]
Eocypraea (Eocypraea) bay erquei (Gabb, 1864) [Contra Costa
Co., California]
Eocypraea (Eocypraea) castacensis (Stewart, 1926 [1927])
[Kern Co., California]
Eocypraea (Eocypraea) crescentensis new species [Crescent
Formation, Thurston Co., Washington]
Eocypraea (Eocypraea) jimgoederti new species [Crescent
Formation, Lewis Co., Washington]
Eocypraea ( Eocypraea ) ef. E. (E.) inflate (Lamarck, 1802)
[Kings Co., California]
Eocypraea (Eocypraea) maniobraensis Squires and Advocate,
1986 [Riverside Co., California]
to these beds as Eocene basalts, sandstones, shales,
and small limestone lenses. Armentrout and Berta
(1977) mentioned Narizian/Refngian benthic foraminif-
eral stages (late middle to late Eocene) aged foraminif-
era from a locality within the Townsend Shale Member
of the Lyre Formation on the east side of Discovery
Bay. Tabor and Cady (1978) mapped outcrops on the
west side of Discovery Bay as a “sandstone and minor
siltstone member” of the Lyre Formation, a younger
unit than the Crescent Formation. Armentout and
others (1983) referred to these beds as “sandstone of
Maynard” and proposed that it interfingers with the
lower to middle Eocene upper Crescent Formation.
Most recently Spencer (1984) mapped the area as
a “sedimentary member” of the Crescent Formation.
Domengine Formation
Anderson (1905) described the “Domijean Sands” for
widespread outcrops on the north flank of Mt. Diablo,
Fresno County, California and the type locality is in the
NE14 of section 17, north of Coalinga. The molluscan
faunas were described by Clark and Vokes (1936) and
Vokes (1939). These faunas became the basis of the
“Domengine” [CPMS] of Clark and Vokes (1936), which
they believed to be middle Eocene (Squires (1988). Most
recently, based on calcareous nannoplankton and mag-
netic stratigraphy, Prothero (2001) considered the for-
mation to be early to middle Eocene age.
Bateque Formation
The Bateque Formation of Mina (1956, 1957) was named
for outcrops along the Pacific side of Baja California,
Mexico, from the north end and east side of Laguna San
Ignacio to the San Juanico area about 105 km to the
south (Squires and Demetrion, 1992). The formation
ranges in age from middle early Eocene to late middle
Eocene (“Capay” [CPMS] through “Tejon” [CPMS])
based on calcareous nannoplankton, planktonic foramini-
fers, and mollusks (Squires and Demetrion, 1992).
ABBREVIATIONS
Abbreviations used for institutional catalog and/or local-
ity numbers, affiliations, and condensed terminology are
as follows (unless indicated otherwise, collections are in
California): CIT, California Institute of Technology, Pas-
adena (collections now at LACMIP); CPMS, California
provincial molluscan stage; CSUN, California State
University, Nortlnidge (collections now at LACMIP);
IGM, Instituto de Geologia Universidad Nacional
Autonoma de Mexico, Mexico Citv; LACMIP, Natural
Histoiy Museum of Los Angeles County, Invertebrate
Paleontology Section; LACMVP, Natural History Museum
of Los Angeles County, Vertebrate Paleontology Sec-
tion; UCLA, University of California, Los Angeles (col-
lections now at LACMIP); UCMP, University of
California, Museum of Paleontology, Berkeley; USGS,
United States Geological Survey, Menlo Park.
Measurement parameters are defined as follows:
length = greatest distance between anterior and poste-
rior ends; width = greatest distance between lateral mar-
gins; and height = greatest distance between base and
dorsum.
SYSTEMATIC PALEONTOLOGY
The classification used here for Cypraeidae follows that
of Schilder and Schilder (1971) and Fehse (2001) for
Eocypraeidae.
L.T. Groves, 201 1
Page 47
Superfamily Cypraeoidea Rafinesque, 1815
Family Cypraeidae Rafinesque, 1815
Subfamily Bernayinae Schilder, 1927
Tribe Bernayini Schilder, 1927
Genus Bemaya Jousseaume, 1884
Type Species: Cypraea media Deshayes, 1835, by
original designation. Upper middle Eocene (Bartonian
Stage), Auvers-sur-Oise, Val-d’Oise (northwest of Paris),
France.
Diagnosis: Shell medium to large size; anterior end
somewhat carinate; dorsum smooth; spire of medium
height and partially covered; aperture wide, sides
rounded; anterior and posterior canals deep; fossula
smooth, concave, wide.
Remarks: Schilder and Schilder (1971) recognized 22
species and 11 subspecies of worldwide Bemaya sensu
stricto. Four of their subspecies have been raised to
specific status, one species and one subspecies have
been reassigned to other genera, three species have been
described subsequent to 1971 (see Groves, 1990; 2004),
and another new species is described here. This brings
the present total to 29 species and six subspecies. Only
four of these species are from western North America
(Table 1).
Subgenus Bemaya Jousseaume, 1884
Bemaya (Bemaya) squiresi new species
(Figures 1-2)
B. (B.) n. sp. Groves, 1997: 7.
Diagnosis: Bernaya of large size, anterior and poste-
rior canals deep, spire of medium height, fossula con-
cave and smooth (although columellar dentition extends
slightly onto fossula), posterior terminal ridges extend to
margins.
Description: Shell of medium to large size, con-
stricted anteriorly; maximum height of shell nearly
centered; maximum width of shell slightly posterior of
center; aperture wide, straight; dentition coarse to
medium; columellar lip with 25 teeth, labral lip with 24
teeth; prominent anterior terminal ridges that form a
slight marginal callus.
Comparison: The new species is unlike any other
Bemaya from western North America. Flowever, it does
resemble Bemaya obesa (Deshayes, 1865) from the
upper middle Eocene (Bartonian) of the Paris Basin,
France, particularly the specimen figured by Cossmann
and Pissarro (1911: pi. 32, fig. 162-1). The new species
is less inflated, more constricted anteriorly, has a
wider less sinuous aperture, and has finer dentition than
B. obesa. Because the posterior terminal ridges are
missing in B. squiresi , they cannot be compared; how-
ever, the anterior terminal ridges of B. obesa are more
prominent than those of B. squiresi. A specimen identi-
fied as B. (£>.) obesa, figured by Perrilliat and others
(2003: 43, figs. 5-6) from the middle Eocene San Juan
Formation, central Chiapas, southern Mexico, lacks
enough shell material for adequate comparison to the
new species.
Discussion: Post-burial crushing has damaged the an-
terior portion of the aperture and dorso-ventrally dis-
torted the specimen . Generic and subgeneric assignment
are based on the wide aperture, deep anterior and poste-
rior canals, and medium-height spire. Bemaya squiresi
represents the northernmost occurrence of the genus in
Cenozoic strata and the only representative of the genus
described from Washington.
Material: The new species is represented by a single
fairly well preserved specimen that exhibits original shell
material on the base and minor amounts of original shell
material on the dorsum.
Type Material: Holotype LACMIP 13644, measures
52.7 mm in length, 40.0 mm in width, and 26.3 mm in
height.
Type Locality: LACMIP loc. 22341 [ex UCLA
loc. 2341], southwest end of Discovery Bay, Jefferson
County, Washington. Middle lower Eocene (“Capay”
[CPMS] = Ypresian Stage), Crescent Formation.
Etymology: This species is named after friend and
colleague Richard L. Squires (CSUN Geological Sci-
ences) for his extraordinary contributions to molluscan
paleontology.
Family Eocypraeidae Schilder, 1924
Subfamily Eocypraeinae Schilder, 1924
Tribe Eocypraeini Schilder, 1924
Genus Eocypraea Cossmann, 1903
Type Species: Cypraea inflata Lamarck, 1802, by ori-
ginal designation, middle Eocene (Lutetian/Bartonian
stages), Paris Basin, France.
Diagnosis: Inflated-pyriform shell of small to medium
size; spire involute; narrow elongate aperture; fossula
broad, smooth, concave.
Remarks: Schilder and Schilder (1971) recognized 23
species and nine subspecies of Eocypraea sensu stricto.
Six of their subspecies have been elevated to specific
status, five species have been described subsequent
to 1971, and lour new species are described here which
brings the total to 38 species and three subspecies.
Nine of these species are from western North America
(Table 1). Schilder (1924) established the subfamily
Eocypraeinae for various genera of extinct and living
eypraeids and ovulids including Eocypraea of Cossmann
(1903). Schilder (1932) included Eocypraea in the family
Amphiperatidae (= Ovulidae), subfamily Cypraediinae,
but included fossil and living genera of ovulids
Page 48
THE NAUTILUS, Vol. 125, No. 2
Figures 1-12. Paleogene cypraeoideans. 1-2. Bemaya ( Bemaya ) squiresi new species, holotype LACM1P 13644, from LACMIP
loc. 23341, 52.7 mm length. 3-4. Eocypraea ( Eocypraea ) takeosusukii new species, holotype LACMIP 13645 from LACMIP loc.
7045, 18.8 mm length. 5-6. Eocypraea ( Eocypraea ) batequensis new species, holotype IGM 5174 from LACMIP loc. 16951, 9.4 mm
length. 7-8. Eocypraea ( Eocypraea ) crescentensis new species, holotype LACMIP 13646, from LACMP loc. 16655, 10.9 mm length.
9—10 Eocypraea (Eocypraea) iimgoederti new species, holotype LACMIP 1364 1 , from LACMIP loc. 41573, 12./ mm length. 1 1—12.
Eocypraea ( Eocypraea ) sp„ cf. E. (E.) inflate (Lamarck, 1802), hypotype UCMP 15815 from UCMP loc. A-1282, 27.1 mm length.
only. In 1971 Schilder and Schilder included the sub-
family Eocypraeinae in the family Ovulidae and again
included living and fossil genera. Fehse (2001) elevated
Eocypraeinae to lull family status (Eocypraeidae) but
included only extinct genera.
Subgenus Eocypraea Cossmann, 1903
Eocypraea ( Eocypraea ) takeosusukii new species
(Figures 3-4)
E. (E.) n.sp. Groves, 1997: 7
Diagnosis: An Eocypraea with inflated shell and
slightly s-shaped aperture.
L.T. Groves, 2011
Page 49
Description: Shell moderately inflated, of medium
size, constricted anteriorly; spire completely covered;
dorsum highly arched; maximum height nearly cen-
ter; maximum width nearly center; aperture slightly
s-shaped and widens anteriorly, curves sharply toward
columella posteriorly; denticulation semi-coarse with
smooth interstices; outer lip with 16 teeth, inner lip
with 11 teeth; fossula smooth, wide; all surfaces smooth;
posterior columella highly inflated; posterior canal
deep, anterior canal missing; anterior and posterior
basal ridges slight and do not form basal calluses; base
rounded.
Comparison: Eocypraea ( E .) takeosusukii is unlike
other eocypraeid in the eastern Pacific and is most simi-
lar to Eocypraea bartlettiana (Maury, 1912: 86-87,
pi. 1 1, figs. 11-13) from the Paleoeene (Thanetian Stage)
ol Soldado Rock, Trinidad, Trinidad and Tobago. The
new species differs from E. bartlettiana by the lack of a
prominent basal callus, coarser dentition, and more sin-
nous aperture.
Discussion: Good preservation of the holotype per-
mits unequivocal generic assignment. Eocypraea (£. )
takeosusuki differs from all other eoeypraeids in the
Western Hemisphere and is the first eocypraeid de-
scribed from the “Martinez” Formation.
Material: The new species is represented by a single,
moderately well preserved specimen exhibiting original
shell material on its base and dorsum but with minor
amounts of shell missing from the dorsum. The anterior
end of the shell is missing.
Type Material: Holotype LACMIP 13645, measures
18.8 mm in length, 14.4 mm in width, 11.2 nun in height.
Type Locality: LACMIP loe. 7045 {ex CIT loc. 1589),
East of Lower Lake, Lake County, California, “Martinez”
Formation.
Etymology: This species is named in honor of the late
Takeo Susuki {ex UCLA) for his numerous important
contributions to the study of invertebrate paleontology
of southern California.
Eocypraea (Eocypraea) batequensis new species
(Figures 5-6)
Eocypraea P sp. Squires and Demetrion, 1992: 31, figs.
77-79.
E. (E.) n. sp.l. Groves, 1997: 8.
Diagnosis: An Eocypraea with inflated shell and slightly
s-shaped aperture.
Description: Shell moderately inflated, of small size,
constricted anteriorly and posteriorly; spire covered;
maximum height of dorsum slightly posterior of cen-
ter; maximum width nearly center; aperture slightly
s-shaped; denticulation semi-coarse with smooth inter-
stices; outer lip with 24 teeth, inner lip with 18 teeth;
fossula smooth, wide; all surfaces smooth; anterior canal
shallow, posterior canal deep; anterior and posterior
terminal ridges short; slight basal marginal callus on
outer lip; base rounded.
Comparison: The new species is unlike any known
species in the eastern Pacific. However it somewhat
resembles Eocypraea inflate (Lamarck, 1802) from the
middle Eocene (Lutetian Stage) of Parnes, Oise Depart-
ment, Paris Basin, France as illustrated by Cossmann
and Pissaro (1911: pi. 32, fig. 162-7) and E. cotteri Cox
(1930: pi. 19, figs. 8a-8c) from the late Paleoeene
(Thanetian Stage) of the Samana Range of northwest
India. Eocypraea (E.) batequensis differs from both
mainly by its smaller size but also by it's narrower aper-
ture, finer dentition, and less calloused outer lip.
Discussion: Excellent preservation ol the holotype
permits unequivocal generic assignment. Eocypraea (E.)
batequensis differs from all other eoeypraeids in the
Western Hemisphere and is the first described from Baja
California Sur, Mexico.
Material: Represented by a single well preserved
internal mold.
Type Material: Holotype IGM 5174, measures 9.4 nun
in length, 6.5 mm in width, and 5.1 mm in height.
Type Locality: LACMIP loc. 16951 (= CSUN loc.
1220b), Mesa La Salma, Baja California Sur, Mexico,
Bateque Formation.
Etymology: This species is named for the Bateque
Formation.
Eocypraea ( Eocypraea ) crescentensis new species
(Figures 7-8)
E. (E.) n. sp. 2. Groves, 1997: 7 (in part).
Diagnosis: An eocypraeid with inflated shell and
slightly s-shaped aperture.
Description: Shell moderately inflated, of small size;
constricted anteriorly and slightly produced; spire cov-
ered; maximum height slightly posterior of center; max-
imum width nearly center; aperture wide and veiy
slightly s-shaped; denticulation coarse with smooth
interstices, outer lip with 14 teeth, inner lip with 6 teeth;
fossula smooth, wide; dorsal surface exhibits linear pat-
tern which could represent growth lines; anterior and
posterior canals shallow; anterior and posterior basal
ridges reduced forming a slight collumellar basal callus;
slight posterior spiral sulcus present; base rounded.
Comparison: Eocypraea (E.) crescentensis n. sp. most
closely resembles E. (E. ) jimgoeclerti n. sp. (this paper)
but has a straighter aperture, a less prominent basal
collumellar callus, more produced extremities, and a
posterior spiral sulcus.
Page 50
THE NAUTILUS, Vol. 125, No. 2
Discussion: Excellent preservation of the holotype
permits positive generic assignment. Eocypraea (E.)
crescentensis differs from all other eocypraeids in the
Western Hemisphere and is the first eoeypraeid de-
scribed from the Crescent Formation. The new species
represents the northernmost record of the genus in west-
ern North America.
Material: The new species is represented by the
fairly well preserved holotype specimen that exhibits
original shell material and a poorly preserved topo-
typie internal mold that measures 7.8 mm in length,
5.6 mm in width, and 4.3 mm in height, and three
small fragments
l\|je Material: Holotype LACMIP 13646, measures
10.9 mm in length, 7.6 mm in width, and 6.1 mm in
height.
O
Type Locality: LACMIP loc. 16655 (ex CSUN loc.
1563), Larch Mountain, Thurston County, Washington,
Crescent Formation.
Etymology: This species is named for the Crescent
Formation, Washington.
Eocypraea ( Eocypraea ) jimgoederti new species
(Figures 9-10)
E. (£. ) u.sp. 2. Groves, 1997: 7 (in part).
Diagnosis: An eoeypraeid with inflated shell and slightly
s-shaped aperture.
Description: Shell slightly inflated, of small size;
constricted anteriorly and posteriorly and slightly pro-
duced; spire covered; dorsum highly arched; maximum
height slightly posterior of center; maximum width
nearly centered; aperture wide for size, slightly s-shaped;
dentieulation coarse with smooth interstices; outer lip
with 14 teeth, inner lip with 12 teeth; fossula smooth
and wide; all surfaces roughened by preservation; poste-
rior columella moderately inflated; anterior canal shal-
low, posterior canal deep; anterior terminal ridges
prominent, posterior terminal ridges slightly reduced;
basal marginal callus moderate on outer lip; base
rounded.
Comparison: Eocypraea (E.) jimgoederti new spe-
cies is different from all other eocypraeids from the
eastern Pacific but is somewhat similar to a specimen
of E. (£. ) dollfusi (Laubriere, 1881) from the middle
Eocene (Lutetian Stage) of Parnes, Oise Department,
Paris Basin, France as figured by Cossmann and Pissaro
(1911: pi. 33, fig. 162-8). The new species has coarser
dentition, straighter aperture, and has a less inflated
columellar region than E. (E. ) dollfusi.
Discussion: Good preservation of the holotype per-
mits positive generic assignment. Eocypraea (£. )
jimgoederti differs from all other eocypraeids in the
Western Hemisphere and is the second eoeypraeid
described from the Crescent Formation.
Material: The new species is represented by a single
fairly well preserved specimen that exhibits original shell
material.
Type Material: Holotype LACMIP 13647, measures
12.7 mm in length, 8.2 mm in width, and 6.9 mm in
height.
Type Locality: LACMIP loc. 41573 (ex CSUN loc.
1573), Doty Hills, Lewis County, Washington, Crescent
Formation.
Etymology: This species is named for colleague }im
Goedert, Gig Harbor, Washington, who collected the
holotype and donated it to LACMIP and for his numer-
ous important contributions to Tertiary molluscan pale-
ontology of Washington.
Eocypraea ( Eocypraea ) sp., cf. £. (E.) inflata (Lamarck,
1802)
(Figures 1 1-12)
Eocypraea castacensis (Stewart, 1926 [1927]): Vokes,
1939: 26, 154, pi. 20, fig. 14.
Cypraea castacensis Stewart, 1926 [1927]: Ingram,
1942: 103, pi. 8, fig. 6.
Eocypraea (Eocypraea) moumieti Dolin and Dolin,
1983: 36; Groves', 1997: 8.
Remarks: The hypotype of Vokes (1939, pi. 20,
fig. 14) [UCMP 15815] most closely resembles £. (£.)
inflata (Lamarck, 1802) from middle Eocene strata
(Lutetian/Bartonian stages) of France, Belgium, and
England. This is particularly evident from the illustra-
tions of Cossmann, 1903 (pi. 9, figs. 18-19) and
Cossmann and Pissarro, 1911 (pi. 32, fig. 162-7). It also
superficially resembles E. (£. ) maniobraensis Squires
and Advocate, 1986 from the lower Eocene (“Capay”
[CPMS]) Maniobra Formation of Riverside County,
California. Eocypraea (£. ) maniobraensis is more elon-
gate, has coarser dentition, has a prominent basal callus,
and is significantly larger than £. (£. ) sp. cf. £. (E.)
inflata.
Vokes (1939) and Ingram (1942) both misidentified
this poorly preserved specimen as £. (£. ) castacensis
(Stewart, 1926 [1927]). Most specimens of £. (£.)
castacensis have a fairly prominent basal callus and it is
less globose than £. (£. ) sp., cf. £ . (£. ) inflata. Dolin
and Dolin (1983) described £. (£. ) moumieti from the
Gan Basin, Pyrenees Atlantique Deptartment, France.
They included the hypotype of Vokes (1939) as this
new species but did not refigure it. Dolin and Ledon
(2002) tentatively reassigned £. (£. ) moumeti to the
eoeypraeid genus Sulcocypraea . Eocypraea (£. ) sp. cf.
£. (£. ) inflata differs from E. (£. ) moumeti by its finer
dentition and a slightly more inflated columellar region.
L.T. Groves, 2011
Page 51
ACKNOWLEDGMENTS
Many thanks to Richard L. Squires (CSUN) and LouElla
R. Saul (LACMIP) who reviewed an early draft of the
manuscript and offered valuable comments and sugges-
tions. Richard L. Squires (CSUN) collected the eoey-
praeid specimen from the Bateque Formation and
made it available for study. Maria del Carmen Perrilliat
(IGM) kindly loaned the Bateque Formation specimen.
James L. Goedert (Gig Harbor, Washington and
LAC MVP Research Associate) collected the eocypraeid
specimens from the Crescent Formation, made them
available for study, and provided pertinent information
regarding their stratigraphic occurence. Special thanks
to David Lindberg (UCMP) who loaned compara-
tive material. The late Don McNamee (LACM Research
Library) processed numerous interlibrary loans and
assisted in the acquisition of several obscure references.
Mary Stecheson (LACMIP) provided access to the
LACMIP collection. Cathy L. Groves (LACM Echino-
derms) and Brian Koehler (LACM Entomology Section)
assisted with digital image manipulations. The thorough
review of Charles L. Powell, II (USGS, Menlo Park, CA)
is gratefully acknowledged.
LITERATURE CITED
Anderson, F. M. 1905. A stratigraphic study in the Mount
Diablo Range of California. Proceedings of the
California Academy of Sciences, 3rd series 2(2): 155-
248, pis. 13-35.
Anderson, F. M. 1958. Upper Cretaceous of the Pacific coast.
Geological Society of America Memoir 71: 1-378, figs. 1-3,
pis. 1-75.
Armentrout, J.M. and A. Berta, 1977. Eoeene-Oligocene
foraminiferal sequence from the northeast Olympic Pen-
insula, Washington. Journal of Foraminiferal Research
7: 216-233, figs. 1-4, pi. 1.
Armentrout, J.M., D.A. Hull, J.D. Beaulieu, and W.W. Ran.
1983. Correlation of Cenozoie stratigraphic units of west-
ern Oregon and Washington. State of Oregon, Depart-
ment of Geology and Mineral Industries Oil and Gas
Investigation 7: iii + 1-90.
Arnold, R. 1906. Geological reconnaissance of the coast of
the Olympic Peninsula, Washington. Bulletin of the
Geological Society of America 17: 451-468, figs. 1-4,
pis. 55-58.
Brice, J.C. 1953. Geology of the Lower Lake quadrangle,
California. California Division of Mines Bulletin 166:
1-72, figs. 1-3, pis. 1-7.
Clark, B.L. and H.E. Vokes. 1936. Summary ol the marine
Eocene sequence of western North America. Bulletin of
the Geological Society of America 47(6):851-878, figs.
1-2, pis. 1-2.
Cossmann, M. 1903. Essais de paleoconchologie comparee.
Volume 5. Privately published: Paris, 215 pp., 16 figs.,
9 pis.
Cossmann, M. and G. Pissarro. 1907-1913. Ieonographie com-
plete des eoquilles fossils de l'Eocene des environs de
Paris. 2(1): pis. 1-9 [1907]; 2(2): pis. 10-25 [1910]; 2(3):
pis. 26-45 [1911]; 2(4): pis. 46-65 [1913], Paris.
Deshayes, G.-P. 1835. Description des eoquilles fossils des
environs de Paris. 2: 1-783 + Atlas, pis. 1-105. F.-G.
Levrault, Paris.
Deshayes, G.-P. 1865. Description des animaux sans vertebres
deeouverts dans le basin de Paris. 3: 1-667 + Atlas, pis.
1-107. J.-B. Bailliere et Fils, Paris.
Dolin, C. and L. Dolin. 1983. Revision des Triviaeea et
Cypraeacea (Mollusea, Prosobranchiata) Eocenes recoltes
dans les localities de Gan (Tuilerie et Acot) et Bosdarros
(Pyrenees Atlantiques, France). Mededelingen van de
Werkgroep voor Tertiaire en Kwartaire Geologie 20(1):
5-48, figs. 1-31.
Dolin, L. and D. Ledon. 2002. Nouveaux taxons et discussion
de la systematique des genres correspondants d’Ovulidae
(Mollusea, Caenogastropoda) de l’Eocene inferieur de
Gan (France). Geodiversitas 24: 329-347, figs. 1-5.
Durham, J.W. 1944. Megafaunal zones of the Oligocene of
northwestern Washington. University ol California Publi-
cations, Bulletin of the Department of Geological Sci-
ences 27(5): 101-212, figs. 1-7, pis. 13-18.
Fehse, D. 2001. Beitriige zur kenntnis der Ovulidae (Mollusea:
Cypraeoidea) VIII. Einleitung zur Familie sowie Katalog,
Taxonomie und Bibliographic und Bemerkungen zu
verwandten Gruppen. Acta Conchyliorum 5: 3-47.
Gabb, W.M. 1864. Description of the Cretaceous fossils. Geo-
logical Survey of California, Palaeontology 1(4): 57-217,
3 unnumbered figs., pis. 9-32.
Gabb, W.M. 1869. Description of new, and revision of previ-
ously described, Cretaceous fossils. Part 1. Geological
Survey of California. Palaeontology 2(2): 127-205,
pis. 19-34.
Groves, L.T. 1990. New species of Late Cretaceous
Cypraeacea (Mollusea: Gastropoda) from California and
Mississippi, and a review of Cretaceous cypraeaceans of
North America. The Veliger 33(3): 272-285, figs. 1-34.
Groves, L.T. 1997. Fossil and recent species of eastern Pacific
Cypraeacea (Cypraeidae and Eocypraeinae [Ovulidae]):
An update (extended abstract). Western Society of
Malacologists Annual Report 29: 7-10.
Groves, L.T. 2004. New species of Late Cretaceous Cypraeidae
(Gastropoda) from California and British Columbia
and new records from the Pacific slope. The Nautilus
118: 43-51, figs. 1-11.
Ingram, W.M. 1942. Type fossil Cypraeidae of North America.
Bulletins of American Paleontology 27(104): 95-123,
pis. 8-11.
Jousseaume, F. P. 1884. Etude sur la famile des Cypraeidae.
Bulletin de la Soeiete Zoologique de France 9: 81-100.
Lamarck, J.B.P.A. de M. de. 1802. Memories sur les fossils
des environs de Paris. Annales du Museum National
d’Histoire Naturelle 1: 383-391 [reprinted by Paleonto-
logical Research Institution, Ithaca, New York, 1978].
Laubriere, M. 1881. Description d’especes nouvelles du bassin
Paris. Bulletin de la Soeiete Geologique de France, serie
3, 9: 377-384, pi. 8.
Maury, C. |. 1912. A contribution to the paleontology of Trini-
dad. [ournal of the Academy of Natural Sciences of Phila-
delphia, 2nd series, 15: 25-112, pi. 5-13.
Mina, F. 1956. Bosquejo geologieo de la part sur de la penin-
sula de Baja California. Twentieth International Geologi-
cal Congress, Excursion A-7: 1-77.
Mina, F. 1957. Bosquejo geologieo del Territorio Sur de la Baja
California. Assoeiacion Mexicana de Geologos Petroleros
Boletin 9: 139-269.
Page 52
THE NAUTILUS, Vol. 125, No. 2
Nelson, R.N. 1925. A contribution to the paleontology ol the
Martinez Eocene of California. University of California
Publications, Bulletin of the Department of Geological
Sciences 15(1 1): 397-466, pis. 49-61.
Perrilliat, M.del C.. J. Avendano, and F.J. Vega. 2003, Middle
Eocene eypraeoideans from the San Juan Formation,
Chiapas, southern Mexico. Revista Mexicana de Ciencias
Geologicas 20(1): 41-51, figs. 1-46.
Prothero, D.R. 2001. Magnetic stratigraphy of the lower-
middle Eocene Domengine, Avenal, and Yokut sand-
stones, western San Joaquin Basin, Fresno and Kings
counties California. In: Prothero, D.R. (ed.), Magnetic
stratigraphy of the Pacific Coast Cenozoic. Pacific Sec-
tion, Society for sedimentary geology. Book 91: 45-55,
figs. 1-6.
Rafinesque, C.S. 1815. Analyse de la nature, ou tableau de
l’univers et des corps organizes. Palermo, Sicily, Italy,
224 p.
Schilder, F.A. 1924. Systematischer Index der rezenten
Cypraeidae. Archiv fur Naturgesehiehte 90A(4): 179-214.
Schilder, F.A. 1927. Revision der Cypraeacea (Moll., Gastr.).
Archiv fur Naturgesehiehte 91(A): 1-165.
Schilder, F.A. 1932. Cypraeacea. In: Quenstedt, W. (ed)
Fossilium Catalogus, 1: Animalia, 55: 1-276.
Schilder, M. and F.A. Schilder. 1971. A catalogue of living and
fossil cowries, Institut Royal des Sciences Naturelles de
Belgique, Memories 85: 1-246.
Spencer, P. K. 1984. Lower Tertiary biostratigraphy and paleo-
eeology of the Quilcene-Diseovery Bay area, northeast
Olympic Peninsula, Washington. University of Washington,
unpublished Ph.D. dissertation, 173 p., 2 pis.
Squires, R.L. 1988. Geologic age refinement of west coast
Eocene marine mollusks. In: Filewiez, M.V. and R.L.
Squires (eds.), Paleogene stratigraphy, west coast of
North America. Pacific Section, Society of Economic
Paleontologists and Mineralogists, Book 58: 107-112,
fig.l, pis. 1—2.
Squires, R.L. and D.M. Advocate. 1986. New early Eocene mol-
lusks from the Orocopia Mountains, southern California.
Journal of Paleontology 60: 851-864, figs. 1-3.
Squires, R.L. and R. Demetrion. 1992. Paleontology of the
Eocene Bateque Formation, Baja California Sur, Mexico.
Natural History Museum of Los Angeles Count)' Contri-
butions in Science 434: 1-55, figs. 1-144.
Stewart, R. 1926 [1927], Gabb’s California fossil type gastro-
pods. Proceedings of the Academy of Natural Sciences
of Philadelphia 78: 287-447, figs. 1-4, pis. 20-32.
Tabor, R.W. and W. M. Cady. 1978. Geologic map of the
Olympic Peninsula, Washington. United States Geological
Survey, Miscellaneous Investigations Series, Map 1-994,
2 sheets, 1:125,000.
Vokes, H.E. 1939. Molluscan faunas of the Domengine and
Arroyo Hondo formations of the California Eocene.
Annals of the New York Academy of Sciences 38: 1-246,
pis. 1-22.
Weaver, C.E. 1937. Tertiary stratigraphy of western Washington
and northwestern Oregon. University of Washington Publi-
cations in Geology 4: 1-266, pis. 1-15.
APPENDIX 1. LOCALITIES CITED
LACMIP loc. 7045 [ex CIT loc. 1589], 1200 ft. south
of bridge over Herndon Creek on Monticello-Lower
Lake Highway, 0.8 mile east of Lower Lake, Lake
County, California. Latest early or earliest late Paleocene
(Danian/Thanetian stages) “Martinez” Lormation
(uppermost “unnamed” [CPMS] or lowermost “Marti-
nez” [CPMS]). Coll.: W.P Popenoe, 12 May 1944.
LACMIP 16655 [ex CSUN 1563], At elevation of
2230 ft. (680 m), exposed in roadcut on northeast side of
logging road, latitude 47°59'3" N, longitude 123° 8' 12"
W, 300 m north and 50 m east of southwest corner of
sec. 1, T17N, R4W and 500 in S32E of Larch Mountain,
U.S. Geological Survey, 7.5 minute. Capital Peak Quad-
rangle, provisional edition 1986, Black Hills, Thurston
County, Washington. Upper part of the Crescent Forma-
tion. Age: Middle early Eocene (“Capay” [CPMS]). Coll.
J.L. and G.H. Goedert, July, 1992 and September, 1997.
LACMIP 16951 [ex CSUN loc. 1220b]. Along a
prominent ridge, north side of a minor canyon on the
west side of Mesa La Salina, 84-130 m above the bottom
of the Bateque Lormation in this area, approximately
1 .25 km southeast of the intersection of 1 13 °00/ W and
26°45' N, Mexican government topographic quadrangle
map (1:50,000) of San Jose de Gracia (#G12A64), Baja
California Sur, Mexico (1982 ed.). Coll.: R.L. Squires
and R.A. Demetrion, 1988.
LACMIP 23341 [ex UCLA 3341], Southwest end
of Discovery Bay, on Highway 101, 1000 ft. south
of Maynard, sec. 23, T29N, R2W, Jefferson County,
Washington. Middle early Eocene (Ypresian Stage),
Crescent Formation (“Capay” [CPMS]). Coll.: H.C.
Jamison and S.D. Conrad, April, 1952.
LACMIP 41573 [ex CSUN 1573], In a “borrow
pit” 228 m south and 548 m east of northwest corner of
sec. 23, T14N, R5W, U.S. Geological Survey, 7.5 minute,
Doty Quadrangle, provisional edition 1986, Lewis
County, Washington. Crescent Formation. Age: Middle
Eocene (“Domengine” [CPMS]). Coll. J.L. Goedert,
1993-1994.
UCMP A- 1282. Approximately 100 feet below the
uppermost fossiliferous layer, near the center of north
edge of section 20, on hill slope immediately south of
point where the Big Tar - McClure Rd. crosses saddle
at head of stream running into McClure Valley, T23S,
R17E, U.S. Geological Survey, 15 minute, Cholame
Quadrangle, Kings County, California. Age: Middle
Eocene (“Domengine” [CPMS]).
THE NAUTILUS 125(2):53-62, 201 1
Page 53
Descriptions and illustrations of some new and poorly known
turrids (Gastropoda: Turridae) of the tropical northwestern
Atlantic. Part 3. Genus Crassispira Swainson, 1840,
subgenus Crassisclava McLean, 1971
Phillip J. Fallon, Jr.
77 Cedar Drive
Farmingdale, NY 11735 USA
[email protected]
ABSTRACT
Illustrations and descriptions of eight small turrids in the genus
Crassispira Swainson, 1840, subgenus Crassiclava McLean,
1971, are provided. Five are described for the first time. All
are from shallow water around islands of the southeastern
Caribbean (between 10°-] 3° north latitude) and appear to
represent an example of divergence among isolated island
populations in a small geographic region. Species include
Crassispira ( Crassiclava ) affinis (Reeve, 1846), Crassispira
( Crassiclava ) astlienes Faber, 2007, Crassispira ( Crassiclava )
blanquilla new species, Crassispira ( Crassiclava ) cana new
species, Crassispira ( Crassiclava ) mackintoshi new species,
Crassispira ( Crassiclava ) masinoi new species, Crassispira
( Crassiclava ) multicostata new species, and Crassispira
( Crassiclava ) vexillum (Reeve, 1845). Species are treated sys-
tematically and the island or island groups where they have
been found illustrated to emphasize their very limited distri-
butions and geographic proximity. The five reported here for
the first time represent a sizeable range expansion of the
known subgenus-group Crassiclava in the western Atlantic;
and inasmuch as several islands along the north coast of South
America have yet to be explored, additional species of
Crassiclava may turn up.
Additional keywords: Neogastropoda, western Atlantic
INTRODUCTION
This is the third in a series of papers describing small
relatively unknown or confusing crassispirine turrids. In
this part, eight species in the subgenus Crassiclava
McLean, 1971 are discussed, five new to science.
Recently, some heretofore undescribed crassispirines
have been acquired from a rather small geographic
region of the southeastern Caribbean, islands and areas
near coastal South America that lie between 10°-13° N
(Figure 1 ). Their close resemblance to one another and
to known members of the subgenus suggests a close
evolutionary affinity; most apparently limited in distribu-
tion to a single island or island clusters with no known
overlap. Such diversity in Crassiclava has likely been
fostered by the isolation of small populations that
have direct developing non-planktonie larvae, and a hab-
itat preference for the shallow water around islands
separated from one another by deep water, likely a har-
rier to dispersal. The mode of development is only
inferred here; however, Maes (1983: 322) states that
the protoconch of a species in the same subgenus,
Crassispira ( Crassiclava ) apicata (Reeve, 1845), suggests
full intraeapsular development.
The purpose of this work is to describe five previously
undescribed species that belong in the subgenus-group
Crassiclava McLean, 1971, to re-describe Crassispira
( Crassiclava ) affinis (Reeve, 1846), a little-known and
misunderstood species, on the basis of specimens found
that closely match Reeve’s description (the type has
not been located), and to re-describe Crassispira
( Crassiclava ) vexillum (Reeve, 1845) to provide a basis
by which it can be compared to the other members
of the subgenus. Another, Crassispira ( Crassiclava )
astlienes Faber, 2007, has been included for comparison
purposes but its original description is sufficiently
detailed and so not re-described here.
MATERIALS AND METHODS
Materials and methods given in Part 1 of this series
(Fallon, 2010), apply to this work. Since that publication,
types located at the Natural History Museum (London)
(NHMUK) have been examined and photographed for
this work, in addition to specimens in the collections of
the National Museum of Natural History (USNM) and
Academy of Natural Sciences of Philadelphia (ANSP). St.
Vincent and the Grenadines is abbreviated SVG herein.
SYSTEMATICS
Subfamily Crassispirinae Morrison, 1966, senstt McLean,
1971a, b
Page 54
THE NAUTILUS, Vol. 125, No. 2
Figure 1. Southern Caribbean Crassispira (Crassiclava)
spp. localities. 1. Cabo de la Vela. 2. Los Monjes Is. 3. Aruba I.
4. El Supi, Paraguana Peninsula. 5. Curasao I. 6. Las Aves
Arehipellago. 7. La Tortuga I. 8. La Blanquilla 1. 9. Los Tostigos
Is. 10. Carriacou I., Ronde I., and Grenada I., Grenada, north
to south. 11. Petit Nevis I., Baliceaux I., Canouan I., and Union
I., SVG, north to south. 12. St. Vincent I., Young 1. and Bequia
I., north to south, SVG (not all appear on map).
Genus Crassispira Swainson, 1840
Subgenus Crassiclava McLean, 1971
Type Species: Pleurotoma turricula G.B. Sowerby I,
1834 (synonyms: P. cormgata G.B. Sowerby I, 1834;
P. sowerbyi Reeve, 1843), by original designation. Santa
Elena, “western Colombia” (no coastal locality by that
name is found in present day Colombia.)
Remarks: McLean placed two species from the west
coast [eastern Pacific] in his new subgenus describ-
ing them as having a protoconch of 2.5 smooth rounded
whorls; strong narrow axial ribs that arise at the whorl
periphery, and extend to the following suture; fine
spiral cords, strongest anteriorly where they are slightly
nodulose at rib intersections; weakly nodded subsutural
cord; concave sulcus; thin outer lip, edge crenulated by
spiral cords; shallow stromboid notch; deep U-shaped
anal sinus, broad at its entrance, bordered by a large
parietal callus; varfx consisting ol a thickened axial rib
behind the anal sinus; inner lip raised; and a broad,
deeply notched anterior canal. Furthermore, he identi-
fied two characters that separated this group from other
eastern Pacific crassispirines: a strong parietal tubercle
in front ol a broad sinus entrance, and a radula with a
well-formed central raehidian tooth and marginal teeth
of modified wishbone or duplex type (McLean, 1971:
121). Later, Maes corrected McLean’s analysis of the
radula, finding his central tooth was really two
unhardened lateral teeth such that the radula of the
subgenus has no central tooth (Maes, 1983: 321).
Although McLean believed that his group was con-
fined to the tropical western Pacific, Maes recognized
the radula of a tropical northwestern Atlantic (TNWA)
species she identified as Crassispira ( Crassiclava )
apicata (Reeve, 1845) as very similar to that of
Crassispira ( Crassiclava ) turricula (G.B. Sowerby I,
1834), the type of the subgenus (Maes, 1983: 322). The
sculptural details of her specimens from the British Vir-
gin Islands (Maes, 1983: fig. 15) differ somewhat in that
axial ribs are weak, not strong, and extend well into the
sulcus, not ending at it. Kilburn soon afterwards added
four species to Crassiclava from the South African fauna
(Kilburn, 1988: 239). His descriptions varied slightly
from McLean’s original, in that the subsutural cord was
absent to moderately strong, and the siphonal canal
varies from unnotched to deeply notched in South Afri-
can species.
In summary, members of the subgenus Crassiclava of
the TNWA have shell characters consistent with those
described by previous workers. They are crassispirines
having: a strong parietal lobe in front of an open,
U-shaped anal sinus; a weakly to moderately excavated
sulcus without, or with spiral threads, some more swol-
len than others, or with a weak spiral cord; fine axial ribs
that extend from the suture to the shell base, usually
reduced and narrowed in the sulcus; spiral threads or
incised lines in rib interstices; and widely spaced cords
or ridges on the shell base, sometimes swollen or
nodulose at rib intersections.
Crassispira ( Crassiclava ) affinis (Reeve, 1846)
(Figures 2-15)
Pleurotoma affinis Reeve, 1846: pi. 34, fig. 309 (name attribut-
ed to Gray). The type could not be located; however, the
coloration (“yellowish”), extrapolated size (11.8 mm), and
locality (“St. Vincent”) of Reeve’s species are consistent
with the specimens described here (see comparison in Fig-
ures 2, 3). Beau (1858: 8); Krebs (1864: 7); Paetel (1888).
Mangelia affinis “Gray”: II. & A. Adams (1853: 99).
Drillia affinis “Gray”: Tryon (1884: 194; pi. 21, fig- 22).
Pleurotoma affinis “Gray”: Dali (1885: 232).
Crassispira apicata auct. non (Reeve, 1845): misidentifieation
by Fallon (2008: 12, figs. 21a-c).
Not Crassispira (Crassispirella) affinis (Reeve, 1846): Altena
(1975: 63, pi. 7, figs. 5, 6).
Not Crassispira affinis (Reeve, 1846): Williams (2005: number
3130, except the inset in the left photo, which is Reeve’s
drawing); Faber (2007: 123, figs 10, 11, 18).
Description: A 12.3 x 5.0 mm specimen is described
here (Figures 4-5) (length to 12.9 mm). Fusiform, trun-
cated anteriorly, of 9 convex whorls; apex slightly acumi-
nate; axial sculpture predominant. Suture appressed;
sulcus about 0.3 height of spire whorl, moderately exca-
vated; shoulder round, or slightly angled in some spec-
imens. Body whorl 61% of total shell length (56-62 %
among intact specimens). Protoconch paucispiral, ol 2
smooth slightly worn whorls, obscuring axial riblets, if
present (Figure 6); 10.5 mm Baliceaux I. specimen has
10 riblets on last 0.5 whorl of protoconch (Figures 7).
Axial sculpture of narrow, low, slightly opisthocline ribs,
reduced in sulcus to mere raised lines that are hooked
to left in an arc that reflects outline of anal sinus, thickest
just below sulcus, tapering anteriorly, evanescing on
shell base; 26 ribs on penultimate, 14 on last whorl (15-
26 on penultimate, 11-22 on last whorl of examined
specimens); ribs generally narrower than interspaces,
variable, sometimes broad, indistinct, especially on body
whorl. Growth striae present; risible in sulcus. Spiral
sculpture of numerous spiral threads in sulcus, one or
P.J. Fallon, Jr., 2011
Page 55
Figures 2-20. Crassispira spp. 2-15. Crassispira ( Crassiclava ) affinis (Reeve, 1S46). 2. Pleurotoma affinis Reeve, 1S46. Drawing
from Reeve, 1846: 34, fig. 309, 11.8 mm. 3. USNM 1154261, Carriacou I., Grenada, 12.9 x 4.5 mm. 4. BMSM 17955, Ronde I.
Grenada, 12.4 x 5.0 mm. 5. Same spec, as in 4, enlarged view of anterior lateral side. (i. Protoconch, author’s coll.. Union I., SVG,
8.0 x 3.1 mm. 7. Protoconch, ANSP 425811, Baliceaux I. SVG, 10.5 x 4.0 mm. 8. Authors coll., Devil's Bay, Grenada, 9.8 x 4.2 mm.
9. FLMNPI 446785, Union I., SVG, 10.6 x 3.7 mm. 10. Author’s coll., Canouan I., SVG, 11.5 x 4.6 mm. 11. Author’s coll.. Union I.,
SVG, 10.0 x 3,5 mm. 12. Author’s coll.. Union I., SVG, 9.4 x 3.7 mm. 13. ANSP 425811, Baliceaux I. SVG, 10,5 x 4.0 mm.
14. Author’s coll.. Union I., SVG, 8,3 x 3.6 mm. 15. BMSM 17954, Petit Nevis I., SVG, 10.7 x 4,5 mm. 10. Crassispira ( Crassiclava )
asthenes Faber, 2007. Holotype, ZMA Moll. 4.07.057, Aruba, 11.4 x 4.2 mm (photograph courtesy Marien Faber). 17-20.
Crassispira ( Crassiclava ) masinoi new species. 17. Holotype, USNM 1154263, ofl Santa Martha Beach, Curasao I., 10.7 x 3.8 mm.
18. Holotype, enlargement of anterior lateral view. 19. Paratype, ANSP 425814, type locality, 9.8 x 3.8 mm. 20. Same spec, as in 19,
enlarged Mew of protoconch.
Page 56
THE NAUTILUS, Vol. 125, No. 2
more swollen; fine spiral grooves present on shell face
overriding axial ribs; flattened cords on shell base that
are slightly nodulose at intersection with axial ribs, nod-
ules becoming more pronounced anteriorly. Seven (5-8)
spiral ridges on anterior fasciole. Outer lip thin, projects
a short distance out from base of varix, strengthened
behind by short axial; shallow stromboid notch present
(Figure 5). Varix, moderately large, angled at shoulder,
appearing hump-like, positioned behind anal sinus. Anal
sinus deep, round at its apex, bordered by parietal lobe
on one side. Two low spiral ridges present on inside of
outer lip (0-2 ridges in other specimens) strongest just
below anal sinus underneath varix, its length same as
width of varix; the other less well defined and broader,
lies near stromboid notch and marks beginning of
siphonal canal. Inner lip appressed along entire length;
thickened anteriorly, very thin on parietal wall. Aperture
narrowly oval and ends anteriorly in short unnotched
siphonal canal. Shell color yellow-orange; specimens
may also be light brown, orange-brown, yellow, and very
pale lemon yellow. May or may not have brown spire tip.
A sampling of color forms appears in Figures 8-15.
Type Material: Not located.
Material Examined: A total of 131 specimens from 12
localities have been examined:
1 spec., 1 1.8 x 4.6 mm, at 12 m. Petit Nevis I., SVG,
G. Mackintosh!, 13 May 1993 (USNM 1154259); 2 spec.,
10.7 x 4.5 (Figure 15) and 10.1 x 4.2 mm (both decol-
late), at 7.6 m. Petit Nevis I., SVG, G. Mackintosh!
16 May 1993 (BMSM 17954); 1 spec., 10.3 x 3.8 mm,
at 7.6 m. Petit News, SVG, G. Mackintosh! 14 Jul 1996
(author’s coll.); 2 spec., 10.5 x 4.0 (Figures 7, 13) and
9.6 x 3.8 mm, at 12.2 m, S end of Baliceaux I., SVG,
G. Mackintosh!, 23 Apr 1997 (ANSP 425811); 6 spec.,
10.2 x 3.8, 10.2 x 4.1, 9.2 x 3.8, 10.8 x 4.0, 9.6 x 3.3,
and 11.4 x 4.2 mm, at 4. 6-7. 6 m, Corbay Bay, Canonan
I., SVG, G. Mackintosh! 6-9 June "2004 (USNM
1154260); 1 spec., 11.5 x 4.6 mm (Figure 10), at 4.6 m,
Dove Cay, Canouan I., SVG, G. Mackintosh! 6 June 2004
(author’s coll.); 21 spec., largest 10.8 x 4.0, smallest 7.4
x 3.1 mm, at 5.5 m, Corbay Bay, Canouan I., SVG, G.
Mackintosh! 6 Dec 2006 (author’s coll.); 2 spec., 11.3 x
4.2 and 9.4 x 3.7 mm (Figure 12), at 20 m, 0.4 km E of
"Bloody Head’’, NW Union I., SVG, B. Masino! 31 Aug
2010 (author’s coll.); 22 spec., largest 11.6 x 4.4, 10.0 x
3.5 (Figure II), and smallest 7.9 x 3.2 mm, at 18 m,
Chatham Bay, Union I., SVG, G. Mackintosh! 6 Apr
2007 (author’s coll.); 5 spec., 10.7 x 3.8, 8.8 x 3.4, 8.9 x
3.3, 7.8 x 2.9, and 8. 1 x 2.9 mm, at 9 m, Clifton Harbor,
Union I., SVG, G. Mackintosh! 10 May 2007 (ANSP
425810; 8 spec., 10.6 x 3.7 (Figure 9), 10.2 x 3.6, 11.1
x 3.9, 10.1 x 3.7, 8.6 x 3,3, 8,3 x 3.0, 8.0 x 3.3, and 7.6
x 2.7 mm, at I I m, Clifton Harbor, Union 1., SVG, G.
Mackintosh! 30 May 2004 (FLMNH 446785); 56 spec.,
intertidal, crabbed and worn, up to 10.6 x 4.5 mm,
broken apex, 8.3 x 3.6 mm specimen in Figure 14, Clif-
ton Harbor, Union I., SVG, P. Fallon!, 16 Jun 2007
(authors coll.); 1 spec., 12.9 x 4,5 mm (Figure 3), at
9 m. NW coast, Carriacou I., Grenada, G. Mackintosh!
Dec 1996 (USNM 1154261); 1 spec., 10.9 x 4.2 mm, at
15 nr, SE corner, Ronde I., Grenada, G. Mackintosh! 25
Jan 1997 (author’s coll.); 1 spec., 12.3 x 5.0 mm (Fig-
ures 4, 5), at 6.7 m, Ronde I., Grenada (BMSM 17955);
2 spec., 12.2 x 5.3 (broken tip) and 10.7 x 3.8 mm
(immature lip), at 4.6 m, Ronde I., Grenada, G. Mackin-
tosh! 30 Dec 2006 (ANSP 425812); 1 spec., 8.9 x 3.6
mm, at 6.7 m, S side of Molinere Pt., Grenada, G. Mack-
intosh!, 18 Apr 2004 (author’s coll.); 2 spec., 10.7 x 4.1
and 8.7 x 3.4 mm, at 6.7 m, outside anchorage, St.
Georges, Grenada, G. Mackintosh!, 24 Jun 2003 (USNM
1154262); 2 spec., 8.6 x 3.7 and 9.8 x 4.2 mm (Figure 8),
both decollate, at 9 m. Devil’s Bay, Grenada (author’s
coll.).
T\pe Locality: "St. Vincent ".
Range: St. Vincent and the Grenadines (Petit Nevis I.,
Baliceaux I., Canouan l.. Union l.) and Grenada
(Carriacou I., Ronde I., Grenada I.) (locations TO” and
“II ” in Figure 1).
Remarks: The similarity of Reeve’s drawing (which is
taken as representative of the type) to the specimens
here identified as Crassispira affinis is illustrated by the
juxtaposition of the drawing of Pleurotoma affinis
(Reeve’s pi. 34, fig. 309) with a 12.9 x 4.5 mm specimen
from Carriacou I., Grenada, in Figures 2 and 3. The
drawing and selected specimen are very similar but there
are some small differences that may be due to “artistic
license”. Axial ribs appear to end at the sulcus in the
drawing, whereas they continue into the suture in spec-
imens in hand, albeit much reduced. The anterior end of
Reeve’s drawing appears to be somewhat narrower, a
feature characteristic of less mature shells. While the
type1 of C. affinis would have been examined for subtle
characters not shown in the drawing, the likelihood of a
veiy similar but different species inhabiting the environs
of St. Vincent and the Grenadines with the observed
degree of similarity is remote, especially given the com-
monness of these specimens.
C. affinis is most easily recognized by its yellow or
yellowish colors, which is unique among the Crassiclava.
From Crassispira ( Crassiclava ) asthenes Faber, 2007
(Figure 16) it differs in having less regular axial ribs and
a longer anterior canal. Crassispira asthenes is described
as uniformly light brown in color (Faber, 2007: 123), not
the yellow of C. affinis (the color of the specimen shown
in Figure 16 is off).
Crassispira ( Crassiclava ) masinoi new species
(Figures 17-20)
Desc ription: Holotype 10.7 x 3.8 mm, fusiform, trun-
cated anteriorly, of 8.5 convex whorls; body whorl 56%
of total shell length (paratype 57%). Suture appressed;
sulcus moderately excavated, about 0.3 whorl high; shoul-
der round; axial sculpture predominant (Figures 17, 18).
P.J. Fallon, Jr., 2011
Page 57
Protoconch paucispiral, of 1.5 smooth whorls with 3 faint
rib lets at end (Figure 19). Axial sculpture of slightly
opisthocline ribs, narrower than their interspaces, with
occasionally 2 or 3 ribs bunched together on last whorl.
Ribs reduced and hooked to left in sulcus, thickest just
below sulcus, and extending to anterior fasciole; 21 ribs
on penultimate, 14 on last whorl. Spiral sculpture of
grooves of varying strengths on whorl face, fainter on
axial rib crests, deeper in interspaces; more widely
spaced and deeper on shell base such that axial ribs
appear slightly nodulose. Sulcus without spiral cord; with
microscopic spiral lines and growth striae in addition to
axial ribs. Six spiral cords on anterior fasciole. Outer lip
thin, edge smooth, strengthened behind by 3 short axial
ribs; shallow stromboid notch present (Figure 18). Varix
narrower at shoulder but abruptly broadens immedi-
ately below; positioned about 0.25 whorl before edge of
outer lip. Anal sinus deep, round at its apex, open at lip
edge. Inner lip appressed along its entire length, thicker
anteriorly, thin in parietal area, and ending with large
round parietal lobe posteriorly. Edge ol lip and parietal
lobe visibly layered. Low spiral ridge present inside
inner lip just anterior to sinus and under varix, its length
limited to width of varix. Aperture narrowly oval and
ends anteriorly in short, open siphonal canal. Shell
honey-colored; rib crests, mid-whorl band, and shoulder
of varix whitish.
Type Material: Holotype: USNM 1154263. Paratype:
1 spec., 9.8 x 3.8 mm, type locality (ANSP 425814)
(Figure 20).
Type Locality: 0.4 km WNW off Santa Martha Beach,
0.8 km W of Santa Martha Bay entrance, W coast,
Curasao I., Netherlands Antilles, at 34 m depth.
Range: Known only from the type locality (location “5”
in Figure 1).
Remarks: Crassispira masinoi is a distinctive species
recognizable by its honey-colored base color, whitish
mid-whorl band and varix, lack of subsutural cord, and
its single, paired, or triple axial ribs. It is closest in
appearance to C. asthenes but that species has a different
varix and possesses a subsutural cord. From C. ajfinis it
differs in possessing axial ribs that extend to the anterior
fasciole. Differences from other Crassiclava follow
under their descriptions below.
Etymology: Robert Masino’s Crassiclava. Named for
Mr. Robert Masino of Ft. Myers, Florida who collected
the type specimens.
Crassispira ( Crassiclava ) blanquilla new species
(Figures 21-26)
Description: Holotype 10.2 x 3.9 mm (lengths to 10.3
mm), fusiform, truncated anteriorly; of 9 moderately
convex whorls; axial sculpture is predominant. Suture
appressed, scalloped by ribs; sulcus height approximately
0.3 whorl, moderately excavated. Body whorl 52%
of shell length (52-60%) (Figure 21). Protoconch
paucispiral, of 2 smooth whorls, last 0.5 whorl with weak
axials (Figure 22). Axial sculpture of narrow almost
thread-like ribs, 25 on penultimate whorl, 20 on body
whorl to varix (22-25 on penultimate, 15-20 on body
whorl to varix of type specimens), narrower than inter-
spaces, slightly opisthocline, extending from near suture
to following suture, evanescing on shell base. Ribs in
sulcus are curved to left reflecting outline of anal sinus,
reduced in thickness and height, and terminate in slight
swelling near suture in some specimens. Spiral sculpture
of closely packed spiral threads in sulcus, 2 closest to
suture swollen, flattened, override swollen ends of axial
ribs (Figure 23); incised spiral lines cover remaining
shell, faint or obsolete on rib crests, deeper in inter-
spaces. Five spiral grooves on shell base cut axial ribs
into low squarish nodules, a few shallower spiral incised
lines lie in-between ridges. 5 or 6 spiral cords run along
anterior fasciole. Outer lip thin and smooth, projecting
out a short distance from a thickened varix, strengthened
by an axial rib between varix and edge of lip. Varix broad,
positioned behind anal sinus. Stromboid notch shallow,
marking transition of aperture to short, open anterior
canal, unnotched. Anal sinus deep, U-shaped, bordered
on one side by heavy parietal lobe. Low spiral ridge
present inside inner lip just anterior to sinus and under
varix, its length limited to width of varix. Inner lip is
narrow, thick anteriorly, very thin on parietal wall and
terminating in parietal lobe where outer lip joins. Shell
color creamy white, rib crests paler, apex light brown;
shell base and sulcus of holotype with diffuse bands of
light brown; yellow or orange-yellow bands on some
paratypes. Aperture color corresponds to specimens’
band color — brown, dark yellow or dark orange-yellow.
Type Material: Holotype: (USNM 1154264). Paratypes:
1 spec., 10.3 x 3.9 mm (missing protoconch), at 18.3 m.
La Blanquilla I., Venezuela, G. Mackintosh!, 1 Jan 2000
(USNM 1154265); 2 spec., 6.2 x 2.8 and 7.3 x 2.8 mm,
at 7.6 m. La Blanquilla I., Venezuela, G. Mackintosh!,
4 Jan 2000 (ANSP 425813); 2 spec., 7.6 x 3.1 (Figure 24)
and 7.5 x 3.0 mm, at 7.6 m, La Blanquilla I., Venezuela,
G. Mackintosh!, 4 Jan 2000 (LLMNH 446786); 2 spec.
8.1 x 3.3 (Figure 25) and 8.6 x 3.5 mm (Figures 23, 26),
at 7.6 nr. La Blanquilla I., Venezuela, G. Mackintosh!,
4 Jan 2000 (author’s coll.).
Type Locality: La Blanquilla Island, Venezuela, in 7.6-
18 m depths.
Range: Known only from the type locality (location “8”
in Ligure 1).
Remarks: Crassispira blanquilla differs from C. ajfinis
in having more uniformly spaced axials ribs, and in
possessing a darker colored aperture. Lrom C. asthenes
it differs in having a more pinched shell base, and differ-
ent coloration; C. asthenes is uniformly light brown with
the protoconch paler whereas C. blanquilla is creamy
white, with a brown protoconch. Lrom C. masinoi it
Page 58
THE NAUTILUS, Vol. 125, No. 2
Figures 21-37. Crassispira spp. 21-26. Crassispira ( Crassiclava ) blanquilla new species, all from type locality. 21. Holotype
USNM 1154264, 10.2 x 3.9 mm. 22. Holotype, enlarged view of protoconch. 23. Paratype, Authors coll., 8.6 x 3.5 mm, enlarged
view showing sulcus. 24. Paratype, FLMNH 446786, 7.6 x 3.1 mm. 25. Paratype, authors coll., 8.1 x 3.3 mm. 26. Paratype, author's
coll type locality, 8.6 x 3.5 mm. 27-30. Crassispira ( Crassiclava ) multicostata, new species, all from oil El Supi, Paraguana
Peninsula, Venezuela. 27. Holotype, USNM 1154266, 11.0 x 4.3 mm. 28. Paratype, USNM 1154267, 10.4 x 4.1 mm. 29. Enlarged
view of sulcus of paratype. 30. Enlarged view of protoconch of paratype. 31-37. Crassispira ( Crassiclava ) mackintoshi new species.
31 Holotype USNM 1 154268, LosTestigos Is., Venezuela, 10.2 x 3.9 mm. 32. Holotype, enlarged view of protoconch. 33. Paratype,
ANSP 425815 type locality, 9.8 x 3.7 mm. 34. Paratype, BMSM 17953, type locality, 7.0 x 3.0 mm. 35. Enlarged view of sulcus
spec, in Figure 33. 36. Author’s coll., Cabo de La Vela, La Guajira Prov., Colombia, 9.9 x 4.0 mm. 37. Specimen from oil
Los Monges Is., Venezuela, 9.6 mm (photograph courtesy Femorale).
P.J. Fallon, Jr., 201 1
Page 59
differs in having more uniformly spaced axial ribs, spiral
threads in the sulcus, and a shorter anterior canal. It also
differs in coloration.
Etymology: Named after the type locality. La Blanquilla
Island, Venezuela. Name in apposition.
Crassispira ( Crassiclava ) multicostata new species
(Figures 27-30)
Description: Holotype 11.0 x 4.3 mm, fusiform, anteri-
orly truncated, of 8.75 moderately convex whorls; axial
sculpture is predominant (Figure 27). Suture appressed;
sulcus, slightly excavated, narrow, width approximately
0.25 whorl height; shoulders round. Body whorl 55% of
shell length (paratype 59%). Protoconch worn on holo-
type; of 2 glassy whorls with 8 riblets on last 0.5 whorl
of paratype (Figure 30). Axial sculpture of fine, almost
thread-like, slightly opisthocline ribs that extend to ante-
rior fasciole on body whorl. Ribs slightly reduced and
hooked to the left in sulcus, rib ends swollen near suture;
microscopic growth striae between axial ribs. Distance
between ribs variable; average about the same as their
width; 35 ribs on penultimate, 30 on last whorl. Spiral
sculpture of up to 5 threads in sulcus of last whorl (Fig-
ure 29), fewer in earlier whorls; spiral threads override
axial ribs; no subsutural cord present. Shallow spiral
grooves cover remaining portion of whorls, more widely
spaced on shell base. Rib segments between spiral
grooves slightly swollen, more so and forming 7 slightly
nodulose rows on shell base. Seven smooth spiral cords
on anterior fasciole. Outer lip chipped on holotype, so no
visible stromboid notch; varix broad, about 4-5 axial ribs
in width, and immediately precedes anal sinus. Anal sinus
shallow, incompletely formed, paratype has thin, straight
lip, sinus not yet formed. Inner lip narrow, thin and
appressed to columella; weak parietal callus present
where outer lip joins. Anterior canal very short, open,
unnotched. Color creamy white, axial ribs white, broad
orange band on shell base, spire apex and aperture dark-
orange. Paratype is purple-brown, axial ribs white, apex
and aperture brown.
Type Material: Holotype: USNM 1154266; paratype:
10.4 x 4.1 mm (Figure 28), from type locality (USNM
1154267) (A. jorio and L. Coutol).
ty pe Locality: Off El Supi, Paraguana Peninsula, Falcon,
Venezuela, in 33 m depth.
Range: Known only from the type locality (location “4”
in Figure 1).
Remarks: Crassispira multicostata is easily distin-
guished from other Crassiclava by its greater number of
axial ribs. From C. affinis it differs in having a shorter
anterior canal, and thinner, more and better defined ribs,
and in coloration. From C. asthenes it also differs in
coloration (C. asthenes is uniformly light brown). From
C. masinoi it also differs in having a narrower sulcus and
in possessing spiral threads in the sulcus. Its coloration
is similar to C. blanquilla , but it differs in having slightly
less convex whorls and a narrower sulcus.
Etymology: The Many-ribbed Crassiclava. From Latin
multi — many and costata — ribbed. This species has
more axial ribs than any other known Crassiclava.
Crassispira ( Crassiclava ) mackintoshi new species
(Figures 31-36)
Description: Holotype 10.2 x 3.9 mm (lengths to 12.4
mm), compact-oval shape, of 8.5 convex whorls total.
Suture appressed; sulcus narrow, only slightly excavated,
approximately 0.25 whorl in height; shoulder round,
whorls slightly convex. Body whorl 54.9% of shell
length (55-65% in examined specimens) (Figure 31).
Protoconch paucispiral, of 1.75 whorls; last 0.5 whorl
with 6 weak axials, the first few weakest, visible only on
whorl’s shoulder (Figure 32). Teleoeonch of 6.25 whorls;
axial sculpture is predominant. Axial sculpture of narrow,
slightly opisthocline ribs narrower than interspaces,
extending from suture to suture, slightly swollen at their
ends near the suture, curved or hooked left in sulcus,
reflecting outline of anal sinus and reduced in thickness
and height; evanescing on base of shell. Ribs number 30
on penultimate, 27 on last whorl (range is 24-31 on
penultimate, 18-30 on last whorl). Spiral sculpture of
closely packed threads in sulcus, those near suture swol-
len (Figure 35); incised spiral lines on whorl face, faint
on rib crests but distinct in interspaces; of 6 spiral cords
on shell base that cut axials into squarish, low nodules
at intersection with axial ribs; 7 spiral cords on anterior
fasciole. Outer lip thin, smooth, projects out a short dis-
tance from varix, which is positioned behind anal sinus,
strengthened by a rib; low spiral ridge present on inside
of outer lip just below anal sinus. Anal sinus deep,
U-shaped, bordered on one side by heavy parietal lobe.
Stromboid notch marks transition of aperture to short,
open anterior canal. Inner lip is narrow, appressed to
columella, thick anteriorly, very thin on parietal wall.
Base color dark gray; shell apex, columella, and tip of
anterior canal brown; very light gray to white band pre-
sent below suture; crests of axial ribs and spiral cords on
anterior canal white. An all-brown form exists.
Type Material: Holotype: USNM 1154268. Paratypes,
all from the type locality: 2 spec., 9.8 x 3.7 (Figure 33,
35) and 6.8 x 3.0 mm (ANSP 425815); 2 spec., 9.3 x 3.5
and 6.9 x 3.0 mm, missing protoconch (FLMNH
446787); 2 spec., 7.0 x 3.0 (Figure 34) and 7.5 x 3.0
mm, broken protoconch (BMSM 17953); 2 spec., 8.8 x
3.6 and 8.1 x 3.6 mm, broken spire (P. Williams coll.).
Type Locality: North of Testigos Grande, Los Testigos
Islands, Venezuela, at 6.1 m depth (G. Mackintosh!, 10
Oct 1999).
Material Examined: 3 spec., 12.4 x 4.7, 10.2 x 3.8,
and 9.9 x 4.0 mm (Figure 36), at 4-10 m, Cabo de La
Vela, Guajira Province, Colombia, A. Jorio and L. Couto!
(authors coll.).
Page 60
THE NAUTILUS, Vol. 125, No. 2
Range: Los Testigos Is., Venezuela, Cabo de la Vela,
Guajira (locations "9” and “1”, respectively, in Ligure 1).
Remarks: A 9.6 mm specimen depicted on Femorale’s
Photo Gallery website (Coltro and Coltro, 1999) from
Los Monges, Venezuela, may be this species (Ligure 37,
location “2” in Ligure 1). A very similar but undescribed
species from La Tortuga I., Venezuela (location 7 in
Ligure 1) is shown in Ligure 45. Crassispira mackintoshi
is closest to C. multicostata but differs in the arrange-
ment of spiral threads in the sulcus, and has fewer axial
libs. It differs from C. affinis, C. asthenes , C. masinoi ,
and C. blanquilla in having a shallower, narrower anal
sulcus and a more compact-oval shape. It is also a differ-
ent color, dark gray with white axials, not yellow as in
C. affinis , or uniformly light brown as in C. asthenes , or
honey-colored as in C. masinoi, or creamy white as in
C. blanquilla.
Etymology: Named for one of the collectors of the type
specimens, and most of the specimens presented in this
paper, Gaiy Mackintosh.
Crassispira ( Crassiclava ) cana new species
(Ligures 38-40)
Description: Holotype 11.4 x 4.4 mm, fusiform, of 8.5
strongly convex whorls; axial sculpture predominant.
Suture appressed, slightly scalloped by underlying ribs of
preceding whorl; sulcus excavated, about 0.25 height
of spire whorl (Ligure 38). Body length 57% of total
shell length. Protoconch paucispiral, of 2 smooth but not
glossy whorls, last 0.5 whorl with 8-9 fine riblets
Figures 38-45. Crassispira spp. 38-40. Crassispira ( Crassiclava ) cana new species. 38. Holotype, USNM 1154269, 11.4 x
4.4 mm. 39. Holotype, enlarged view of protoconch. 40. Holotype, enlarged view of anterior lateral half. 41-44. Crassispira
( Crassiclava ) vexillum (Reeve, 1845). 41. Holotype, NIIMUK 1900.3.9.38, 9.7 x 3.5 mm. 42. Holotype, enlarged view of parietal
callus. 43. USNM 1154270, Young I., SVG, 9.6 x 3.2 mm. 44. FLMNH 446788, Young I., SVG, 9.1 x 3.1 mm. 45. Crassispira
( Crassiclava ) sp. Unidentified species from oil La Tortuga I., Venezuela, 9.3 mm (photograph courtesy Femorale).
P.J. Fallon, Jr., 2011
Page 61
(Figure 39). Axial sculpture of fine, slightly opisthocline
axial ribs, hooked to the left in sulcus, with ends swollen
near suture; some libs finely, unequally bifurcated on
shell base; 19 axial ribs on the penultimate whorl, 16 on
last whorl to varfx. Microscopic growth striae in sulcus,
also hooked to the left. Spiral sculpture of indistinct and
irregularly spaced shallow incised lines between ribs,
absent on rib crests, more closely packed in sulcus. No
subsutural cord. Shell base with 5-6 evenly spaced bat-
tened spiral cords, nodulose at their intersection with axial
ribs. Five spiral cords on anterior fasciole. Outer lip thin,
projects out from a thickened varix, slightly scalloped by
the spiral cords; reinforced by a rib; shallow stromboid
notch present (Figure 40). Varix broad and swollen, posi-
tioned a little behind the anal sinus. Anal sinus deep,
U-shaped, bordered by the parietal callus. Inner lip is
narrow, appressed to columella; thickened anteriorly, and
posteriorly into heavy parietal callus where it joins the
outer lip. Shell color white with dark purple-brown shell
base, which is incompletely overlapped by succeeding
whorls; aperture dark purple-brown. Rib crests, some
spiral cords, and varix white; shell apex, anterior canal,
and fasciole brown, not purple-brown.
Type: Holotype: USNM 1154269.
Type Loeality: Aves de Sotavento, Las Aves archipel-
ago, Federal Dependency, Venezuela, in 7-10 m.
Range: Known only from the type locality (location “6”
in Figure 1). Both specimens shown on the Femorale’s
Photo Gallery website (Coltro and Coltro, 1999: num-
bers 37594 and 42682) are from Sotavento, Las Aves,
and were collected by G. Mackintosh Oct 1998 (M.
Coltro pers. comm. 29 Sep 2009).
Remarks: Crassispira cana is unique in its coloration
among Crassiclava. From C. ajfinis it also differs in
lacking subsutural spiral threads and in having only a
few spiral incised lines overriding the ribs. Crassispira
ajfinis, has less distinct ribs, and less distinct axial rib
traces in the sulcus. From C. blanquilla it differs in
having fewer axials (19 vs. 22-25 on their respective
penultimate whorls); from C. mackintoshi it differs
in being broader, in having a wider sulcus, fewer axials
(19 vs. 24-31 on the penultimate), and lacking spiral
elements in the sulcus. From C. vexillum it differs in
having more convex whorls giving it a more shouldered
appearance, a broader sulcus with heavier rib traces,
stronger spiral cords on the shell base, and the crests of
ribs and cords on the body are white — not the same color
as the band, as is the case with C. vexillum.
Etymology: White-capped Crassiclava. “Cana" is the
feminine form of the Latin adjective canus, one of whose
meanings is white-capped (Oxford Latin Dictionary).
The peculiar coloring ot this species, which appears to
be a consistent trait, brings to mind a snow-capped peak.
Crassispira ( Crassiclava ) vexillum (Reeve, 1845)
(Figures 41-44)
Pleurotoma vexillum Reeve, 1845: pi. 29, fig. 264: Higgins and
Marrat (1877); Paetel (1888).
Drillia vexillum (Reeve, 1845): Tryon (1884: 209, pi. 13, fig. 72).
Crassispira vexillum (Reeve, 1845): Maes (unpublished, per
Rosenberg, 2009); Williams (2005: number 31 17).
Not Drillia vexillum (Reeve, 1845): Hidalgo (1904) and Hedley
(1913) for Indo-Pacifie species.
Description: Holotype 9.7 x 3.5 mm, narrowly fusiform,
of 8 slightly convex whorls; suture appressed; sulcus nar-
row, flat to slightly convex, approximately 0.25 height of
whorl; body whorl 65% of the total length; axial sculpture
predominant (Figure 41). Other examined specimens are
9. 1-9.6 mm in length, with immature lips. Protoconch of
holotype worn, the 9.6 mm specimen (USNM 1154270)
has 2 smooth dark brown whorls and few weak axials on
last 0.25 whorl. Axial sculpture consists of narrow, well
defined and slightly opisthocline ribs, reduced in sulcus
to fine arcuate lines, ends swollen near the suture. Ribs
evanesce on shell base; number 19 on penultimate and 13
to varix on body whorl of holotvpe, 18 on penultimate on
other 2 examined specimens. Spiral sculpture in sulcus of
threads, heaviest near suture, and together with swollen
axial ends form nodulose subsutural fold. Spiral threads
present on remainder of whorl, but fade on rib crests;
approximately 5 well-spaced spiral cords on body whorl
slightly nodulose at intersection with axials, with very fine
threads between them. Six or 7 spiral cords on anterior
fasciole. Outer lip broken, partially missing in holotype;
with U-shaped anal sinus and large parietal lobe;
stromboid notch not evident on broken lip. Aperture
narrowly oval; anterior canal short, open. Shell color
ivoiy white with chocolate-colored band anteriorly, and
narrower one on sulcus; color shows through inside shell
aperture.
Type: Holotype: NHMUK 1900.3.9.38.
Type Locality: Unknown to Reeve; herein designated as
Young I., St. Vincent and the Grenadines.
Material Examined: 1 spec. 9.6 x 3.2 mm (Figure 43),
at 4.6-10.7 m. Young I., SVG, G. Mackintosh!, 1998
(USNM 1154270); I spec., 9.1 x 3.1 mm (Figure 44), at
4.6 m. Young I., SVG, G. Mackintosh!, 3 Sep 2000
(FLMNH 446788). Only photographs of the following
were examined: Femorale’s Photo Gallery website
species 62659 (Coltro and Coltro, 1999), 10 mm, at
50-70 m, Bequia I., SVG (Carlos Henckes, pers. comm.,
20 Jul 2009); Williams (2009: number 3117), Young I.,
SVG (Peggy Williams, pers. comm., 20 Jul 2009).
Range: St. Vincent and the Grenadines (Young I., and
Bequia I.), location “12” in Figure 1. No specimens have
been found in museum collections or in more recent
publications to confirm Barbuda as a valid locality as
reported by Higgins and Marrat (1877).
Remarks: Crassispira vexillum is easily distinguished
from other Crassiclava by its small size (usually less than
10 mm in length), narrowly fusiform shape, and unique
Page 62
THE NAUTILUS, Vol. 125, No. 2
coloration. The chocolate-colored banding is present on
all specimens examined, and on all others seen in photo-
graphs. Its inclusion in Crassiclava is based on the pres-
ence of a heavy parietal lobe at the front of the anal
sinus, thin axial ribs that extend from suture to suture,
spiral threads confined to rib interstices except on the
shell base, and a weakly formed subsutural cord.
Reeve described this species without locality. Higgins
and Marrat (1877) included this taxon among the spec-
imens taken in the Argo Expedition to the West Indies in
1876. The first modern worker to recognize this as a
Western Atlantic species, over 130 years after its original
description, was V.O. Maes (unpublished, per Rosenberg,
2009). Since then, specimens have been figured by Wil-
liams and on the internet on Femorale’s Photo Gallery
(Coltro and Coltro, 1999), and all reportedly found
around St. Vincent I., the type locality assigned herein. In
addition to St. Vincent, Higgens and Marrat (1877) listed
Barbuda as a locality, but this cannot be verified as the
whereabouts of their specimens have not been found.
Tryon (1884: 209) lists this species from Port Jackson,
Australia. Hidalgo (1904) and Medley (1913), also list the
species from the Indo-West Pacific. No subsequent ref-
erences citing occurrence of this species in the Indo-
Pacific have been found in the literature, so these reports
are interpreted as misidentifications or miss-localiza-
tions, especially in light of the close match to Reeve’s
type of specimens collected from SVG in recent years.
ACKNOWLEDGMENTS
I wish to thank Drs. Donn Tippett and Jon Greenlaw
for their helpful comments on the manuscript; and to
Dr. Jerry Harasewych and Paul Callomon, Curator of
the NMNH and Collections Manager of the ANSP
malacology collections, respectively, and to Ms. Kathie
Way, Collections Manager, Zoology Higher Inverte-
brates, NPIMUK (London) for allowing access to their
valuable material. I also wish to thank Peggy Williams,
Robert Masino, and Randy Allamand for providing
specimens critical to this work.
LITERATURE CITED
Adams, H. and A. Adams. 1853. The Genera of Recent
Mollusca; Arranged According to Their Organization.
John van Voorst, London, vol. 1: 1-256 + 32 pis.
Altena, C.O. van Regteren. 1975. The marine Mollusca of
Suriname (Dutch Guiana) Holocene and Recent. Part III.
Gastropoda and Cephalopoda. Zoologisehe Verhandelingen
139: 3-104.
Beau, M. 1858. Catalog de coquilles recueillies a la
Guadaloupe et ses dependances. Precede d une introduc-
tion par M. Pjaul] Fischer. Paul Dupont, Paris, 27 pp.
Coltro, M. and J. Coltro. 1999. [Internet] Photo Gallery, 2009.
U R L http ://www. femorale . com .hr/
Dali, W. II. 1885. List of marine mollusca comprising the
quaternary fossils and recent forms from American locali-
ties between Cape Hatteras and Cape Roque includ-
ing the Bermudas. United States Geological Survey
24: 336 pp.
De Jong, K.M. and H.E. Coomans. 1988. Marine gastropods
from Curasao, Aruba and Bonaire. E.|. Brill, Leiden, New
York, Kobenhavn, Koln, 261 pp., 47 pis.
Faber, M.J. 2007. Marine gastropods from the ABC-islands
and other localities. 24. The subfamily Crassispirinae,
including the Strictispirinae, with the description of
Crassispira asthenes n. sp. (Gastropoda: Turridae) from
Aruba. Miscellanea Malacologia 2(6): 119-129.
Fallon, P. J., Jr. 2008. Hermit crab swarm. American Conc-
hologist 36(1): 9-13.
Fallon, P. J., Jr. 2010. Descriptions and illustrations of
some new and poorly known turrids of the tropical north-
western Atlantic. Part 1. Genera ‘Buchema’ Corea, 1934
and ‘Miraclathurella’ Woodring, 1928 (Gastropoda:
Turridae: Crassispirinae). The Nautilus 125: 15-28.
Hedley, C. 1913. Studies of Australian Mollusca, part XI. Pro-
ceedings of the Linnean Society of New South Wales 38:
258-339, pis. 16-19.
Hidalgo, J.G. 1904. XXXII. Catalogo de los moluscos testaceos
de las islas Filipinas. Revista de la Real Academia
de Ciencias Exactas, Fisica y Naturales de Madrid 1:
333-384.
Higgins, H.H. and F. P. Marrat. 1877. Mollusca of the Argo
Expedition to the West Indies, 1876. Museum Report of
the Free Public Library, Museum and Gallery of Art of the
Borough of Livei'pool 1: 1-19, 1 pi.
Kilburn, R.N. 1988. Turridae (Mollusca: Gastropoda) of south-
ern Africa and Mozambique. Part 4. Subfamilies
Drilliinae, Crassispirinae and Strictispirinae. Annals of
the Natal Museum 29(1): 167-320.
Krebs, II. 1864. The West Indian marine shells with some
remarks. W. Laubs Widow and Chr. Jorgensen, Copenha-
gen, 137 pp.
Maes, V.O. 1983. Observations on the systematics and biology
of a turrid gastropod assemblage in the British Virgin
Islands. Bulletin of Marine Science 33: 305-335.
McLean, J.H. 1971a. A revised classification of the family
Turridae, with the proposal of new sublamilies, genera,
and subgenera from the eastern Pacific. The Veliger
14: 1 14-130. July 1.
McLean, J. II. 1971b. Pages 686-766 in: A. M. Keen, Sea Shells
of Tropical West America. Stanford University Press,
Stanford, California, xvi, 1064 pp. Sept. 1.
Paetel, F. 1888. Catalog der Conehylien-Sammlung. Erste
Abtheilung: Die Cephalopoden, Pteropoden und Meers-
Gastropoden. Gebriider Paetel, Berlin, [1] + 639 pp.
Reeve, L.A. 1845. Monograph of the genus Pleurotoma.
Conehologia Ieonica 1: pis. 19-33.
Reeve, L.A. 1846. Monograph of the genus Pleurotoma.
Conehologia Iconica I : pis. 34-40.
Rosenberg, G. 2009. Malacolog 4.1.1: A Database of Western
Atlantic marine Mollusca [WWW database (version
4.1.1)]. URL http://www.malacolog.org/.
Tryon, G.W., Jr. 1884. Conidae, Pleurotomidae. Manual of
Conehology, Structural and Systematic, with Illustrations
of the Species. Tryon, Philadelphia, 413 pp., 34 pis.
Williams, M.A.S. 2005. Shallow-Water Turridae of Florida and
the Caribbean. Published by the author, Tallevast, Florida,
223 pp.
Williams, M.A.S. 2009. Shallow-Water Turridae of Florida
and the Caribbean, version 4. Published by the author,
Tallevast, Florida, 230 pp.
THE NAUTILUS 125(2):63-71, 2011
Page 63
DNA barcoding reveals Brachidontes (Bivalvia: Mytilidae) from
two ecologically distinct intertidal habitats on Long Key,
Florida Keys, are cryptic species, not ecotypes
Kyle F. Bennett 1 2
Andrew J. Reed“
Richard A. Lutz
Institute of Marine and Coastal Sciences
Center for Deep-Sea Ecology and Biotechnology
Rutgers University
New Brunswick, NJ 08901 USA
ABSTRACT
The nominal morphospecies Brachidontes exustus (Linnaeus,
1758) represents a cryptic species complex with multiple
genetic disjunctions resulting in regionally dominant, but
range-restricted, species throughout the western Atlantic,
Caribbean, and Gulf of Mexico. In the Florida Keys, four spe-
cies were previously identified using molecular techniques.
Specimens were collected in January 2005 from two distinct
habitats, a seawall and a mangrove, on Long Key, Florida Keys.
The locations are separated by <5 km. Eight specimens from
the mangrove and four from the seawall were sequenced for
the mitochondrial COI gene. Two seawall specimens were
sequenced at the internal transcribed spacer 2 (ITS-2), in the
nuclear ribosomal gene cluster, after the COI sequences
appeared to be from the male mitochondrial line. The COI
and ITS-2 sequences indicate that the two locations on Long
Key, Florida Keys, have different single-species populations.
The four seawall specimens were the Antillean species while
the eight mangrove specimens were the Gulf species. Given
that these mussels broadcast spawn, with subsequent
planktotrophic larval development, the sites likely share a com-
mon pool of potential larval recruits. Single-species populations
at each location are suggestive of habitat partitioning, ecologi-
cal filters, or differential recruitment.
Additional keywords: Brachidontes , cryptic species, Florida
Keys, cytochrome c oxidase subunit I (COI), DNA barcoding
INTRODUCTION
The scorched mussel, Brachidontes exustus (Linnaeus,
1758), is a small bivalve (maximum length = 25 mm) in
the family Mytilidae that commonly inhabits rock pilings,
1 Current address: Department of Biology, Elmhurst College,
Elmhurst, IL 60148 USA
2 Current address: Department of Biology, University of
Minnesota Duluth, Duluth, MN 55812 USA'
seawalls, and wharf pilings in the intertidal zone and is
most abundant in the lower intertidal (Seed, 1980).
Abbott (1974) considered B. exustus and Brachidontes
domingensis (Lamarck, 1819) separate species with the
range of B. exustus from North Carolina to Texas and
the West Indies and B. domingensis from Bermuda, the
Bahamas, and southeast Llorida and throughout the
Caribbean. Later authors (Rios, 1985; Jensen and
Harasewych, 1986) introduced taxonomic confusion by
reciprocally synonymizing the two names. Rios (1985),
working in Brazil, considered B. exustus the primary
name and B. domingensis a synonym. Jensen and
Harasewych (1986), publishing in a volume on the fauna
of Bermuda, used the more recent B. domingensis as the
primary name. Although these authors were working at
opposite ends of the range and designated a dillerent
primary name, the combined conclusions suggested that
a single intertidal Brachidontes species spans the entire
range from North Carolina to Argentina.
This moiphospecies has been shown to be a cryptic
species complex throughout its western Atlantic, Gulf of
Mexico, and Caribbean Basin range. Five molecular tax-
onomic units (MTU) within the nominal species have
been identified using nuclear and mitochondrial gene
trees. Each MTU has been given an informal name cor-
responding to its core geographical distribution; Antilles,
Atlantic, Bahamas, Gulf, and Western Caribbean (Lee
and O Foighil, 2005). Four of these cryptic species
(Antilles, Atlantic, Bahamas, and Gulf) have been found
in the Florida Keys (Lee and 6 Foighil, 2004). The four
species are nested, two sister-species apiece, within two
of the three main branches revealed by a ribosomal 28S
gene tree (Lee and O Foighil, 2005). The live cryptic
species have not yet been formally described and cur-
rently remain under the single moiphospecies taxon,
B rach idontes exustus.
DNA barcodes have been proposed as a method for
genetically cataloging the world’s biological diversity
Page 64
THE NAUTILUS, Vol. 125, No. 2
(Hebert et al., 2003). The proposed “barcode” is a short
section of the mitochondrial genome that can identify
unknown specimens when compared to an existing
database ol sequences, and are particularly useful in
identifying cryptic species (Hebert et ah, 2004; Gomez
et al., 2007) or other closely-related species (Packer
et al., 2009). The 5' region of the cytochrome c oxidase
subunit f (COI) mitochondrial gene, amplified by the
well-known “universal” COI primer pair of Folmer et al.
(1994), has emerged as the agreed-upon sequence for
DNA barcoding for most species. Some bivalves have a
unique mitochondrial inheritance system that may com-
plicate the effectiveness of DNA barcoding. Doubly uni-
parental inheritance (DUI) of sex-linked mitochondrial
lineages (Zouros et ah, 1994; Mizi et ah, 2005) results
in maternally and paternally-inherited mitochondrial
genomes coexisting in males. DNA barcodes that do not
match the known sequences of the species may result if
tissues used for DNA extraction are enriched with the
male line of mitochondria.
Lee and O Foighil (2004) collected nominal
Brachidontes exustus from three rocky intertidal sites
from the Florida Keys (Figure 1). The Bahamian and Gulf
species were most commonly encountered. The Baha-
mian species dominated their most southerly collection
site at Boca Chica Key, while the Gulf species was most
common at the Horseshoe site on Spanish Harbor/West
Summerland Key, though intermingled with individuals of
Key, and 3 = Key Biscayne. Upper left inset showing the
Floridian peninsula. Lower left inset showing Long Key and
collection locations of this study. S = seawall habitat location
and M = mangrove habitat location.
the Bahamian species. The Atlantic and Antillean species
were much less common and were identified from veiy
few individuals. The only genetically verified records of
these two presumably rarer species include a single Atlan-
tic species specimen found with an otherwise Bahamian
population at Boca Chica Key, and three sub-adults of the
Antillean species found along with five Bahamian species
individuals at Key Biscayne (Lee and O Foighil, 2004).
Lee and O Foighil (2004) did not collect specimens from
mangroves, a habitat for B. exustus encountered by Ben-
nett and Willan (2003) in the Florida Keys, and subse-
quently by Lee and O Foighil (2005), where they found
the Western Caribbean and Atlantic species in a mixed
population.
Sibling species and cryptic species complexes in what
were previously believed to be single species are well
known for many marine taxa (Knowlton, 1993), including
bivalves (Marko and Moran, 2009). In the Mytilus
complex of M. calif omianus , M. gallop rovincialis, and
M. trossulus on the western coast of North America, the
distributions appear to be maintained by subtle habitat
differences that influence local post-recruitment domi-
nance (Heath et al., 1995; Johnson and Geller, 2006).
Likewise, local habitat differences may influence
Brachidontes cryptic species distributions in the Florida
Keys. The goal of the present study was to determine the
species distribution in the two distinct habitat types on
Long Key, where B. exustus was encountered. A previous
study of Floridian Brachidontes spp. (Lee and O Foighil,
2004) did not include specimens from seawall or man-
grove habitats, nor were multiple samples taken from
different habitat locations on a single island.
MATERIALS AND METHODS
Study Area
Long Key, a 6-km long Y-shaped island in approxi-
mately the middle of the Florida Keys archipelago, has
an interior lagoon fringed by mangroves with a connec-
tion to the bayside of the island (Figure 1). The nearest
mile marker on US Route 1 serves as a useful universal
landmark for the Florida Keys and the number of the
nearest mile marker is included with the collection loca-
tions. Mile marker 0 corresponds to the western edge of
Key West, and the mile number increases as one moves
east and north towards mainland Florida.
The first collection location (latitude 24°48.10 N, longi-
tude 80°50.58 W) is an ocean-side vertical concrete sea-
wall near mile marker 66 at the west end of Long Key,
adjacent to the Long Key Viaduct (Figure 1). The lowest
intertidal zone of the seawall is approximately 1 m above a
sandy bottom. Wave exposure at this location is high and
directly impacts the exposed substrate. The second collec-
tion location (latitude 24°49.22 N, longitude 80°48.45 W),
near mile marker 68 and approximately 4 km to the north-
east, is a mangrove-lined boating channel that leads from
the bayside of the island to the interior lagoon and is
protected from direct wave action.
K.F. Bennett et al., 201 1
Page 65
Sample Collection
Living specimens were collected in January 2005. Four
small individuals approximately 1 I mm in length were
found in the lower intertidal on the seawall and all
were collected. A total of 46 individuals ranging in size
from 6 mm to 22 mm were collected from an abundant
population in the mangrove habitat. All specimens
were immediately transferred to a seawater (low-
through system and maintained alive for several days
before being frozen at — 40°C. The samples were sub-
sequently transported on diy ice and stored at — 80°C
prior to dissection and molecular characterization.
Specimens were thawed to room temperature, dis-
sected, and the soft tissues separated from the shell. The
disarticulated left valve of each subsequently typed speci-
men was photographed using a Nikon digital SLR camera
mounted on a Zeiss Stemi 2000-C dissecting scope.
DNA Extraction and Molecular Characterization
Total genomic DNA was isolated from approximately
20 mg of tissue from either the posterior adductor mus-
cle in larger specimens or mantle tissue in smaller spec-
imens. The extraction was accomplished with a DNeasy
Tissue Kit (Qiagen, Valencia, California) according to the
manufacturer's instructions. Extracts were stored at
— 20°C until used as PCR templates.
The target fragment for DNA barcodes, the 5' end of
the cytochrome c oxidase subunit I (COI) gene from the
mitochondrial genome, was amplified by polymerase
chain reactions (PCR) using Taq PCR Mastermix
(Qiagen, Valencia, California) and the well known “uni-
versal" COI primer pair, LOC 1490 and HOC 2198,
from Folmer et al. (1994) with a thermal cycler protocol
of 3 min initial denaturing at 95°C followed by 35 cycles
of 95°C for 1 min, 40°C for 1 min, 72°C for 1.5 min, with
a final 7 min extension at 72°C.
A second target fragment, the second internal tran-
scribed spacer (ITS2) region from the nuclear ribo-
somal gene cluster, was sequenced for two specimens
from the seawall lor reasons discussed below. The
ITS-2 was amplified with the forward primer (5'-
CATCGATATCTTGAACGC-3') from Lopez-Pinion
et al. (2002) initially designed for European scallops and
the reverse primer (5'-GCTCTTCCCGCTTCACTCG-3')
from Xu et al. (2001) initially designed for various spe-
cies of Crassostrea. The thermal cycler protocol was
3 min initial denaturing at 94°C followed by 30 cycles of
94°C for 30 s, 55°C for 30 s, and 72°C for 60 s with a
final extension of 5 min at 72°C. All reactions were pre-
pared in 50-pl volumes and a negative control containing
all reagents and the primer pair, without the DNA tem-
plate, was included with each amplification series. The
resulting PCR products, controls, and a 100-bp ladder
were run on a 2% agarose gel, stained with ethidium
bromide, and photographed under UV transillumination.
PCR products were checked for the appropriate size,
purified with a MinElute lot (Qiagen, Valencia, California)
according to the manufacturers directions and subse-
quently directly cycle-sequenced in both directions with
the above amplification primers utilizing the BigDye
Terminator v.3.1 Cycle Sequencing kit (Applied Bio-
systems, Forester City, California) and an automated
DNA sequencer (310 Avant Genetic Analyzer, Applied
Biosystems, Forester City, California).
Chromatograms of sequences were edited manually
by comparing both strands in 4Peaks (by Griekspoor
and Groothuis, Mekentosj.com). The edited sequences
were compared to an existing database of sequences
using the Basic Local Alignment Search Tool (BLAST)
(Altschul et ah, 1990) of the National Center for Biotech-
nolog)' Information (NCBI). The most significant align-
ment with the highest percent congruence to published
sequences was treated as the species identification.
Gene Tree
A subsample ol COI sequences representing each ol the
five cryptic species and their within-species diversity
from their total geographic range were obtained from
GenBank (accession numbers AY621879, AY621909,
AY621911, AY621913, AY621914, AY825105, AY825201,
AY825202, AY825204 and AY825216) (Lee and 6 Foighil,
2004; Lee and O Foighil, 2005) and combined with nine
of tire ten newly generated maternal COI sequences. The
sequences were aligned in Clustal X and a gene tree was
created using the neighbor-joining method.
RESULTS
Species Assignment from Sequences
The gene tree created from the seven mangrove and two
seawall specimen COI sequences and select COI
sequences obtained from GenBank show the relationships
of the specimens to the five cryptic species within the
complex (Figure 2). Two specimens from the seawall loca-
tion were excluded as explained below. Table 1 shows
species identifications based on comparisons to the NCBI
database for all sequences generated in this study.
Seawall Location
The resulting COI sequences, when compared to
the NCBI database, had closest matches to an Antil-
lean species sequence and a Biscayne elade species
sequence. The Biscayne clade was later named the
Antilles species after gene trees from the full western
Atlantic and Caribbean range showed that some speci-
mens initially collected from Key Biscayne during the
sampling of Lee and O Foighil (2004) were related to
the dominant species of the Antillean archipelago (Lee
and 6 Foighil, 2005). The match to an Antillean COI
sequence was 100% for two ol the four specimens
(Lee and 6 Foighil, 2004; Lee and 6 Foighil, 2005).
The two odier sequences were hard to clean and edit
because of many instances of unclear peaks in both the
Page 66
THE NAUTILUS, Vol. 125, No. 2
— AY62I91 1
— AY825105
•AY621909
,M66-3
M66-1
■AY825202
AY825201
J-M68-1 1
-M68-2
M68-3
-AY621914
•M68-4
rM68-6
Lr-M68-1
-M68-8
AY621913
pAY621879
I-AY825204
AY825216
Bahamian
Antillean
Gulf
Atlantic
W. Caribbean
Figure 2. Phylogram generated from DNA sequences of the
COI gene from representatives of cryptic species within the
Brachidontes exustus morphospeices complex. GenBank
sequence numbers and corresponding cryptic species are
labeled. The mile location and specimen number labeling the
sequences generated in this study are in bold.
forward and reverse sequences. The two cleaned and
edited sequences had sections at both ends that were
ambiguous, which were cropped from the full
sequence before being compared to the NCBI data-
base. The two sequences were 543 and 621 nucleotides
long and returned respectively an 82% and 83% closest
match to GenBank accession number AY621945, a
male mitochondrial line COI sequence of a Bahamian
species specimen collected at Boca Chica Key (Lee
and O Foighil, 2004). The most congruent non-male
COI sequence match for both specimens was an An-
tillean species sequence- AY825208 (Lee and O Foighil,
2005), with 80% congruence.
The specimens that yielded the presumptive male
COI sequence were subsequently sequenced at the
ITS-2 locus to determine their species identity. The
resulting sequences were 355 nucleotides long and when
compared to the NCBI database returned either 100%
or 99% congruence with AY621970. Sequence AY621970
is the complete sequence of the internal transcribed
spacer 2, and flanking portions of the 5.8S and 28S ribo-
somal RNA genes, obtained from voucher specimen
300123.6 of the University of Michigan Museum of Zool-
ogy. The specimen was collected from Key Biscayne,
Florida (Lee and 6 Foighil, 2004). Both of the newly-
generated ITS2 sequences contained a 4-nucleotide
deletion relative to the Bahamian sequences at aligned
location 130, a polymorphism consistent with the single
Antillean species ITS2 sequence in GenBank, and
lacking in any Bahamian species ITS2 sequence. The
four seawall specimens are thus grouped with the Antil-
lean species, by either mitochondrial COI or nuclear
ITS-2 sequences. The Antillean species is one of the two
less common species encountered by Lee and O Foighil
(2004) in the Florida Keys and this new record more
than doubles the confirmed number of individuals of this
species collected in South Florida.
Mangrove Location
Eight specimens from the mangrove location were cho-
sen for sequencing based on extremes in size and shape
revealed by a Principal Components Analysis based on
shell morphometries (unpublished data). The expecta-
tion is that if more than one species is present at this
location the extremes of size and shape would likely
include representatives of the cryptic species. COI
Table 1. Specimen, habitat type, sequenced gene, fragment length in nucleotides used for database comparisons, NCBI accession
number of sequence with most significant alignment, percentage congruence of de novo sequence to NCBI sequence, and resulting
species identification of specimen based on closest matching sequence.
K.F. Bennett et al., 2011
Page 67
sequences of seven specimens were 660 nucleotides long
and when compared to the NCBI database returned in
all cases a Gulf species closest match with 100% or 99%
congruence (Table 1). The COl sequence of one individ-
ual, M68-5, had many ambiguous peaks at both the 5'
and 3' ends and a clean sequence of 474 nucleotides was
excised from the longer sequence. This 474-nucleotide-
long fragment was compared to the NCBI database and
returned 99% congruence to a Gulf species COI
sequence. The shorter COI sequence was not included
in the gene tree, but nonetheless serves as a positive
identification of this specimen as the Gull species.
DISCUSSION
One major criticism of DNA barcodes as a method oi
species designation is the possibility of misidentifiea-
tions based on errors in the database of linked
sequences. This is a problem with using GenBank data,
where a submitter of the sequence names the taxon to
which the sequence is linked. There is no outside
review of the validity of the taxonomy and only the
original submitter can change the name attached to the
sequence. B. exustus appears to suffer from just such a
problem. The linked taxon in the NCBI database is
Homnomya exustus , a generic name long ago synony-
mized to Brachidontes exustus (Soot-Ryen, 1969). This
problem in taxonomy now extends to the Barcode of
Life Database (BOLD) by virtue of its linking to the
NCBI database. BOLD utilizes only a standardized
648-nucleotide fragment from voucher specimens
whose origin and current status are recorded (Hebert
and Gregory, 2005). Additionally, without the proper
taxonomic treatment of the cryptic species, there is no
way to know that cryptic species are involved without a
detailed knowledge of the elade information included
for each Brachidontes specimen in the GenBank data-
base. While the BOLD attempts to be more rigorous
than the GenBank database because voucher specimens
are required for each sequence, the lack of taxonomic
treatment for each of the cryptic species within the
Brachidontes exustus complex likely dooms them to
obscurity until a proper taxonomic treatment is under-
taken (Sehlick-Steiner et al., 2007).
Lee and O Foighil (2005), remarking on the distribu-
tions of the five Brachidontes species throughout the
entire known Atlantic, Gulf of Mexico, Bahamas, and
Caribbean range, note that the Gulf/7\tlantic elade
appears mostly on continental margins, while the Baha-
mas/Antilles elade is found predominately on oceanic
islands. The abiotic aspects of the mangrove habitat may
be more similar to continental margins, while the seawall
habitat may be more similar to the conditions found on
oceanic islands. Distinct differences between the bivalve
species assemblages on the bay and ocean-sides of the
Florida Keys archipelago are known (Bieler and
Mikkelsen, 2004; Mikkelsen and Bieler, 2007) and
the distribution of Brachidontes spp. on Long Key are
likely representative of the same environmental factors
that influence other bivalve species’ distributions. Fur-
thermore, the environmental conditions of the core distri-
butions of the individual Brachidontes species in the
western Atlantic, Gulf of Mexico, Bahamas, and Carib-
bean Sea observed by Lee and O Foighil (2005) relate to
the conditions coinciding with the species’ distribution on
Long Key. High salinity and low productivity associated
with ocean islands are present at the seawall, while lower
salinity and high productivity conditions associated with
continental margins are present at the mangrove site.
Only four individuals were found on the approxi-
mately 250 m of seawall after considerable effort and
all individuals were collected and used for genetic typ-
ing. Based on the very low abundance and small size of
the collected specimens, this location likely represents
a marginal habitat for Brachidontes spp., survivable by
only one of the species within the complex. The four
seawall individuals were only half the maximum length
of individuals found in the mangrove habitat yet they
are likely sexually mature. Mytilids have doubly unipa-
rental inheritance of sex-linked mitochondrial lineages
(DUI) (Zouros et al., 1994) and the initial extraction
appears to have been contaminated by sperm from a
portion of gonadal tissue extracted with the mantle
tissue. Only sexually mature males would have sperm
in sufficient quantities to make a significant contribu-
tion of the paternally-inherited COI sequence to the
PCR amplification. The smallest reproductive individ-
uals encountered during a study of the gametogenic
cycle of B. exustus (presumably the Atlantic species) at
Wassaw Island, Georgia were about 10 mm long
(Sweeney and Walker, 1998). This is slightly smaller
than the specimens collected from the seawall on Long
Key. If the threshold for reproductive size is similar for
the Atlantic and Antillean species, then the seawall
specimens are within the known limits of size for
reproductive individuals.
The presumptive male sequences are slightly less con-
gruent with the Antillean species maternal COI line
(80%) than they are with the known male COI
sequences (82%) from Bahamian specimens. An align-
ment of the two new presumptive male sequence frag-
ments in Clustal X showed the sequences to be very
close to each other with few single nucleotide substitu-
tions and one section of over 100 nucleotides identical
between the two sequences. The close congruence sug-
gests that the sequences are not amalgamations of ampli-
fied maternal and paternal COI PCR products but are
the sequences for the male COI of the Antillean species.
In other bivalves that display DUI the male mitochon-
drial genome has been hypothesized to have been
replaced and reset to the female mitochondrial line (Mizi
et al., 2005). The similar 20% differences between the
Bahamian male COI and the maternal Antillean species
COI may be a result of a resetting of the male COI line
to the maternal mitochondrial line after speciation.
A fuller gene tree comprising the male COI sequences
of each species within the complex would answer the
Page 68
THE NAUTILUS, Vol. 125, No. 2
questions of male mitochondrial genome origins. Con-
tamination by mitochondrial DNA from sperm would
not affect the amplification of the nuclear ITS-2 used
for the species designation of the two specimens that
yielded a presumptive male COI sequence.
Ideally, a range of size classes from the seawall loca-
tion would have been used for species identifications,
but all four of the specimens found on the seawall were
approximately 1 1 mm in length. Wave exposure at the
seawall is a prominent environmental feature and could
lie limiting abundance and survival at the seawall. At
Moss Landing, California, and along the central coast of
California, Mytilus spp. occurs in mixed populations in
which the dominant species differs among age classes.
When wave exposure is more intense, one species of
Mytilus comprises a greater proportion of adults than
juveniles, suggesting that the adults of this one species
are more resistant to dislodgement by wave action
(Heath et ah, 1996; Johnson and Geller, 2006). Wave
exposure may play a role in the species composition at
the seawall location, although wave exposure alone can-
not explain the observed pattern in the mangrove habi-
tat. Antillean species individuals should be present in the
mangrove, a habitat with low wave exposure, if wave-
induced dislodgement were the only environmental
attribute influencing the distribution.
The harsh conditions under high wave exposure may
limit the growth or set a maximum attainable size for the
few individuals that persist at the seawall. Alternatively,
larger individuals may still be susceptible to dislodge-
ment once over a certain size threshold. While all ol the
seawall specimens were about the same length, they may
be of varying ages and not representative of a single
settlement cohort because growth may slow to near zero
under the stress of intense wave exposure.
Unfortunately, the small sample size at the seawall loca-
tion and limited number of collection locations from Long
Key truncate the explanatory power of this study. The
inclusion of the apparently marginal habitat at the seawall
for a study of species distributions in the Llorida Keys
became a necessity because many locations that seemed
suitable for Brachidontes spp. did not have populations
and specimens were collected whenever they were
encountered. Nonetheless, the stark contrast of species-
specific populations of cryptic species at such proximal
locations and differing habitats warranted including such
a marginal habitat for comparison. The only other record
of the Antillean species in the Llorida Keys is from a
habitat at Key Biscayne with very low abundances of
Brachiclontes spp. (Lee and 6 Loighil, 2004). The Antil-
lean species may be more common in the Llorida Keys
than the records to date suggest because marginal habitats
have not been actively searched in the few existing studies
on this species complex.
At the mangrove location, specimens were found as
dense clusters of individuals within the byssal threads
of another bivalve, Isognomon sp., which were, in turn,
attached to the mangrove roots. It was not uncommon
to find 20 or more individuals within the threads of a
single Isognomon sp. Specimens were collected from
the same mangrove location during the summer of
2002 but were not used in this study. Shell morphol-
ogy over the 2.5-year period remained consistent and
the largest shells from the two collection times were
about the same length (« 25 mm). Unlike the individ-
uals collected from the seawall, the mangrove spec-
imens identified by COI sequences spanned the
entire range of sizes collected and the specimens cho-
sen for sequencing were at the extremes of size and
shape variation, if individual settlement events were
dominated by a single species, there should be a
change in the species composition at the various size
classes and between the two collections times. Based
on the consistent species designation by sequence data
over the entire range of size classes, combined with
the consistent shell morphology, it appears that the
exclusivity of the Gulf species at the mangrove location
was maintained over the 2.5 years between collections.
This would be unlikely if the observed distribution
were the result of stochastic larval settlement.
In contrast to the Long Key locations, other sites in
the Llorida Keys have more than one cryptic species of
Brachidontes exustus coexisting; on the same substrate
(Lee and O Loighil, 2004). Neither of the Long Key
collection locations was the rocky shore habitat sampled
by Lee and O Loighil (2004). Mixed-species populations
may reflect an overlap of suitable habitat that only exists
at some rocky shore locations. Species may be contem-
poraneous on the same rocky shore by habitat
partitioning, by depth, for example. Abiotic factors or
biotic interactions could limit one or both species distri-
bution on micro-scales in such a way to facilitate coexis-
tence. Lurther investigation of the species’ distributions,
at spatial scales of individuals to islands, is warranted to
elucidate the mechanisms of coexistence or exclusion
among the species within the complex.
Differential larval transport from single-clade source
populations could potentially impact adult distributions. If
the larvae of each species are not transported to all poten-
tial locations, the differences noted in the species distribu-
tions could be an artifact of larval transport processes and
not ecological filtering. This seems unlikely given that
Brachidontes exustus from the North American Atlantic
coast, as well as the closely related species B. granulata,
B. modiolus, and B. variahilis, broadcast spawn with
planktotrophic larvae that can stay in the water column
for up to 40 days before settlement (Campos and
Ramorino, I960; Lields and Moore, 1983; Morton, 1988;
Luller and Lutz, 1989). The planktonic larval phase would
provide ample opportunity for tidal fluxes and currents to
overwhelm any local larval source cohesiveness.
Studies of connectivity using biophysical modeling
and elemental tracking suggest that long-range dispersal
may be much rarer than simple assumptions of pelagic
larval duration and ocean currents would indicate
(Cowen et ah, 2006; Becker et ah, 2007). The four kilo-
meters between the Long Key collection locations
are well within the ecologically relevant magnitudes of
K. F. Bennett et al., 2011
Page 69
dispersal of 10 to 100 km of the Covven et al. (2006)
model and the 20 to 30 km suggested by experimental
approach of Becker et al. (2007). Within the dispersal
distances advanced by these researchers, larvae from
both Long Key populations would have a very high like-
lihood of being delivered to the nearby location. Addi-
tionally, their results imply that larvae of all Brachidontes
spp. present in the Florida Keys would be delivered to all
suitable Florida Keys locations, suggesting that species-
specific populations must reflect recruitment or post-
recruitment processes and not clade-limited settlement
events.
Previous authors (Lee and O Foighil, 2005) were
unable to determine the species of a given individual
by morphology alone. However, representative shell
shapes are included in their nuclear and mitochondrial
gene trees. A previous investigation of plasticity of
Brad} id antes spp. in the Florida Keys found large over-
laps in the shell morphologies of specimens sampled from
habitats with different wave exposures (Bennett and
Wilan, 2003). Their conclusion of environmentally-
induced plasticity is severely undermined by the discovery
of the cryptic species complex in the Florida Keys. Two of
Bennett and Wilan’s collection locations, the Horseshoe
site on Spanish HarborAVest Summerland Key and the
mangrove on Long Key, do not have the same species
distributions. The Horseshoe site has a mixture of Gulf
and Bahamian species (Lee and O Foighil, 2004), while
the mangrove location population is shown here to be
limited to the Gulf species. The broad morphological var-
iation that was observed at the sites sampled by Bennett
and Wilan (2003) is probably the result of morphological
differences between the cryptic species with the overlap
in shell morphology between locations being the result of
conserved Gulf species morphology. Regardless, the mor-
phological variation obseived does not reflect ecotypic
differences within a single species.
Notwithstanding Lee and O Foighil's (2005) observa-
tions on morphology, there were some obvious qualita-
tive differences in gross shell morphology between the
specimens from the two Long Key locations. Shells col-
lected from the seawall were thicker with more robust
ribbing and were wider across both valves compared to
shells of similar length collected from the mangrove hab-
itat. When viewed laterally, the overall shell outline of
the seawall specimens was more modioli form (Figures 3
through 6), while the mangrove specimens were more
mytiliform (Figures 7 through 14). For the seawall spec-
imens, the anterior margin was more rounded, the umbo
in a more dorsal orientation, and the overall ventral-
dorsal margin angle less than in specimens of similar size
from the mangrove. These morphological differences
match the known phenotypic plasticity of mytilids in
habitats with different wave exposures (Seed, 1968),
salinities (Nalesso et ah, 1992), or shorelines (Morton,
1991). However, in light of the existence of cryptic spe-
cies, it is unclear whether the obseived morphological
variation arises from phenotypic expression, genotypic
constraints, or a combination of the two.
Multivariate statistical methods to determine species
by shell morphometries may be constructed with a large
number of specimens that are unequivocally assigned to
species by molecular methods. However, a statistical
method is only possible if there are consistent genotype-
dependent morphological differences that overwhelm
any phenotypically-variable morphology. Sampling indi-
viduals from locations where the species coexist is the
obvious starting point for examining this question
because mussels from these locations should presumably
be exposed to identical phenotype-inducing environ-
mental cues and would be expected to display similar
phenotypic responses. Any consistent morphological dif-
ferences between the species at locations of coexistence
would only be those whose expression is more depen-
dent on genotype than phenotype. Moiphologieal dis-
crimination of cryptic species would make manipulation
experiments possible because the mussels would not
have to be lolled in order to determine species. Recipro-
cal transplant or common-brood experiments could
then be used to investigate the precise mechanisms reg-
ulating species survivability at single and multiple-
species locations.
The discovery of cryptic species in such close prox-
imity in the Florida Keys opens the possibility that
hidden biodiversity within Bradridontes spp.
populations may be found in other locations through-
out the Caribbean if sampling efforts were increased.
Most of the Caribbean island locations sampled by
Lee and O Foighil (2005) were from a single collec-
tion site and yielded a single species. The two loca-
tions sampled on Trinidad, which yielded different
species, provide an exception. While the two Trinida-
dian locations are about 20 km apart, the Atlantic
species was collected at the town of Chaguaramas and
the Antillean species was collected at Maracas Bay.
Although the habitat types are not listed, habitat spec-
ificity similar to what was observed on Long Key may
exist at these Trinidadian collection locations. Maracas
Bay is on the north side of the island with an exposure
to the Atlantic Ocean, while Chaguaramas is to the
west, on the Gulf of Paria. The species distributions
on Trinidad may be influenced by habitats with oce-
anic island and continental margin-like environments,
as with the distributions observed at Long Key.
Many intriguing questions remain regarding the eco-
logical mechanisms that affect the distribution of this
cryptic species complex in the Florida Keys and the
western Atlantic. More records of the species in close
proximity may be discovered if sampling efforts are in-
creased. Mangrove habitats in the Caribbean may sup-
port populations that are not the recognized dominant
regional species. Understanding the mechanisms in spe-
cific habitats that maintain or exclude each species
within the complex offers the potential to ask questions
regarding interactions of very closely related species in
the oceans. This little-studied complex may become a
good model to investigate these types of difficult to
answer questions.
Page 70
THE NAUTILUS, Vol. 125, No. 2
Figures 3-14. Disarticulated left valves of 12 specimens from two sample locations on Long Key. Figure numbers of each shell are
at die umbo. Shells in Figures 3 to 6 were collected from the seawall habitat, M66, and are the Antillean species. Shells in Figures 7 to
14 were collected from the mangrove habitat, M68, and are the Gulf species. Specimen codes for each figure are: 3) M66-1 ; 4) M66-2;
5) M66-3; 6) M66-4; 7) M68-1; 8) M68-2; 9) M68-3; 10) M68-4; 11) M68-5; 12) M68-6; 13) M68-8; 14) M68-11. Scale bar = 10 mm.
ACKNOWLEDGMENTS
Constantino Vetriani was instrumental in the execution
ol the laboratory portion of this project along with
students in the Deep-Sea Microbiology Lab at Rutgers
University. Special thanks to Rudiger Bieler and Paula
Mikkelsen, co-organizers of The International Marine
Bivalve Workshop (IMBW), held in the Florida Keys,
19-30 July 2002, and funded by the U.S. National
Science Foundation award DEB-9978119, as a part of
the Partnerships in Enhancing Expertise in Taxonomy
[PEET] Program, for the initial taxonomic question
posed to K.F. Bennett and R. Willan while participants
in the IMBW. Richard Willan was valuable at the
initiation of this project. A Conchologists of America
Grant to Malacology awarded to K. F. Bennett made
the molecular aspects of this project possible. Thanks to
the Florida Keys Marine Laboratory on Long Key for
the use of facilities during the IMBW and during
subsequent collecting efforts, and to Nina Bennett for
assisting with specimen collection. The manuscript was
greatly improved by the comments of D. Katherine
Coykendall, Judith Grassle, and from two anonymous
reviewers.
LITERATURE CITED
Altschul, S.F., W. Gish, W. Miller, E.W. Myers, and D.J.
Lipman. 1990. Basic local alignment search tool. Journal
of Molecular Biology 215: 403-410.
Becker, B.J., L.A. Levin, F.J. Fodrie and P.A. McMillan. 2007.
Complex larval connectivity patterns among marine inver-
tebrate populations. Proceedings of the National Academy
of Sciences 104: 3267-3272.
Bennett, K.F. and R. Wilan. 2003. Phenotypic plasticity
of Brachidontes mussels from differing shorelines and
habitats in the Florida Keys. 69th Annual Meeting of
the American Malacological Society, Ann Arbor, MI,
American Malacological Society.
K.F. Bennett et al., 2011
Page 71
Bieler, R. and P. M. Mikkelsen. 2004. Marine bivalves ol the
Florida Keys: a qualitative faunal analysis based on origi-
nal collections, museum holdings and literature data.
Malaeologia 46: 503-544.
Campos, B.M. and L. Ramorino. 1980. Larval and early ben-
thic stages of Brachidontes granulata (Bivalvia: Mytilidae).
The Veliger 22: 277-281.
Cowen, R.K., C.B. Paris, and A. Srinivasan. 2006. Scaling of
connectivity in marine populations. Science 311: 522-527.
Fields, A. and E. Moore. 1983. The larval biology of
Brachidontes modiolus (Linne, 1767) (Bivalvia: Mytilidae).
The Veliger 26: 52-61.
Folmer, O..M. Black, W. R. Hoeh, R.A. Lutz and R. Vrijenhoek.
1994. DNA primers for the amplification of mito-
chondrial cytochrome c oxidase subunit I from diverse
metazoan invertebrates. Molecular Marine Biology and
Biotechnology 3: 294-299.
Fuller, S.C. and R.A. Lutz. 1989. Shell morphology of larval
and post-larval mytilids from the north-western Atlantic.
Journal of the Marine Biological Association of the United
Kingdom 69: 181-218.
Gomez, A., P.J. Wright, D.H. Lunt, J.M. Cancino, G.R.
Carvalho, and R.N. Hughes. 2007. Mating trials validate
the use of DNA barcoding to reveal cryptic speciation ol a
marine bryozoan taxon. Proceedings of the Royal Society'
of London- B. Biological Sciences 274: 199-207.
Heath, D.D., D.R. Hatcher, and T.J. Hilbish. 1996. Ecological
interactions between sympatric Mytilus species on the
west coast of Canada investigated using PCR markers.
Molecular Ecology 5: 443-447.
Heath, D.D., P. D. Rawson, and T.J. Hilbish. 1995. PCR-based
nuclear markers identify alien blue mussel ( Mytilus spp.)
genotypes on the west coast ol Canada. Canadian Journal
of Fisheries and Aquatic Sciences 52: 2621-2627.
Hebert, P. D.N., A. Cywinska, S.L. Ball, and J.R. deWaard.
2003. Biological identifications through DNA barcodes.
Proceedings of the Royal Society of London- B, Biological
Sciences 270: 313-321.
Hebert, P. D.N. and T. R. Gregory. 2005. The promise ol DNA
barcoding for taxonomy. Systematic Biology 54: 852-859.
Hebert, P. D.N., E.H. Penton, J.M. Burns, D.H Janzen, and
W. Hallwachs. 2004. Ten species in one: DNA barcoding
reveals cryptic species in the neotropical skipper butterfly
Astraptes fidgerator. Proceedings of the National Acad-
emy of Sciences 101: 14812-14817.
Jensen, R.II. and M.G. Harasewych. 1986. Class Bivalvia. In:
W. Sterrer (eel.) Marine fauna and flora of Bermuda. John
Wiley and Sons, New York, pp. 461—491.
Johnson, S.B. and J.B. Geller. 2006. Larval settlement can ex-
plain the adult distribution of Mytilus califomianus Con-
rad but not of M. galloprovincialis Lamarck or M.
trossulus Gould in Moss Landing, central California: evi-
dence from genetic identification of spat. Journal ol
Experimental Marine Biology and Ecology 328: 136-145.
Knowlton, N. 1993. Sibling species in the sea. Annual Review
of Ecology and Systematics 24: 189-216.
Lee, T. and D.O Foighil. 2004. Hidden Floridian biodiversity:
mitochondrial and nuclear gene trees reveal four cryptic
species within the scorched mussel, Brachidontes exustus ,
species complex. Molecular Ecology 13: 3527-3542.
Lee, T. and D.O Foighil. 2005. Placing the Floridian marine
genetic disjunction into a regional evolutionary context
using the scorched mussel, Brachidontes exustus , species
complex. Evolution 59: 2139-2158.
Lopez-Pinion, M. J., A. Insua, and J. Mendez. 2002. Identifica-
tion ol four scallop species using PCR and restriction anal-
ysis of the ribosomal DNA internal transcribed spacer
region. Marine Biotechnology 4: 495-502.
Marko, P. B. and A.L. Moran. 2009. Out of sight, out of mind:
high cryptic diversity obscures the identities and histories
of geminate species in the marine bivalve subgenus Acar.
Journal of Biogeography 36: 1861-1880.
Mikkelsen, P. M. and R. Bieler. 2007. Seashells ol Southern
Florida: Living Marine Mollusks of the Florida Keys and
Adjacent Regions: Bivalves. Princeton University Press,
Princeton, 503 pp.
Mizi, A., E. Zouros, N. Mosehonas, and G.C. Rodakis. 2005.
The complete maternal and paternal mitochondrial
genomes of the Mediterranean mussel Mytilus gallopro-
vincialis: implications lor the doubly uniparental inheri-
tance mode ol mtDNA. Molecular Biology and Evolution
22: 952-967.
Morton, B. 1988. The population dynamics and reproductive
cycle of Brachidontes variabilis (Bivalvia: Mytilidae) in
a Hong Kong mangrove. Malaeological Review 21:
109-117.
Morton, B. 1991. The biology of Brachidontes erosus (Bivalvia:
Mytilidae) in Princess Royal Harbour, Albany, Western
Australia. In: F. E. Welis, W. D. I., II. Kirkman and
R. Lethbridge (eds.) The Marine Flora and Fauna of
Albany, Western Australia. Western Australia Museum,
Perth pp. 693-712.
Nalesso, R.C., L. F. L. Duarte, and E.G. Mendes. 1992. Pheno-
typic plasticity in Brachidontes darwinianus (Bivalvia:
Mytilidae). Revista Brasileira de Biologia 52: 245-249.
Packer, L.. J. Gibbs, C. Sheffield, and R. Hanner. 2009. DNA
barcoding and the mediocrity of morphology. Molecular
Ecology Resources 1: 42-50.
Rios, E.C. 1985. Seashells of Brazil. Rio Grande, Fundayao
Universidade do Rio Grande, Museu Oceanografico,
328 pp.
Schlick-Steiner, B.C., B. Seifert, C. Stauffer, E. Christian, R.II.
Crozier, and F.M. Steiner. 2007. Without morphology,
cryptic species stay in taxonomic crypsis following discov-
ery. Trends in Ecology and Evolution 22: 391-392.
Seed, R. 1968. Factors influencing shell shape in the mussel
Mytilus edulis Journal ol the Marine Biological Associa-
tion of the United Kingdom 48: 561-584.
Seed, R. 1980. A note on the relationship between shell shape
and life habits in Geukensia demissa and Brachidontes
exustus (Mollusca: Bivalvia). Journal ol Molluscan Studies
46: 293-299.
Soot-Ryen, T. 1969. Superfamily Mytilaeea Rafinesque, 1815.
In: R.C. Moore (Ed.) Treatise on Invertebrate Paleontol-
ogy. The Geological Society of America and University of
Kansas Press, Lawrence, pp. N271-N2S1.
Sweeney, M.L. and R.L. Walker. 1998. The gametogenic cycle
of Brachidontes exustus (Bivalvia: Mytilidae) at Wassaw
Island, Georgia. American Malaeological Bulletin 14:
149-156.
Xu, Z., X. M. Guo, PM. Gaffney, and J.C. Pierce. 2001. Chro-
mosomal location of the major ribosomal RNA genes in
Crassostrea virginica and Crassostrea gigas. The Veliger
44: 79-83.
Zouros, E., A.O. Ball, C. Saavedra, and K.R. Freeman. 1994.
An unusual type of mitochondrial DNA inheritance in the
blue mussel Mijtilus. Proceedings of the National Acad-
emy of Sciences 91: 7463-7467.
THE NAUTILUS 125(2):72-74, 2011
Page 72
A new Sveltia (Gastropoda: Cancellariidae) from off Guadeloupe,
French West Indies
Richard E. Petit
806 St. Charles Road
North Myrtle Beach, SC 29582-2846 USA
[email protected]
M.G. Harasewyeh
Department of Invertebrate Zoolog)'
National Museum of Natural History
Smithsonian Institution
P.O. Box 7012
Washington, DC 20013-7012 USA
ABSTRACT
Sveltia ijoyottei, the first Recent species of Sveltia from the
tropical western Atlantic, is described from bathyal depths off
Guadeloupe, French West Indies. It is distinguished from its
closest relative, Sveltia inquilinus (Jung and Petit, 1990) from
the Pliocene of the Dominican Republic, by its shorter, more
gradate spire, its narrower pseudoumbilicus, and by having
fewer, stronger denticles along the outer lip. It differs from
the Panamic S. centrota (Dali, 1896) in having a smaller,
narrower shell with 1-3 axial ribs between adjacent varices.
Additional key words: Pliocene, biogeography, paeiphile.
INTRODUCTION
The cancellariid genus Sveltia is readily diagnosed on
the basis of its biconieal shell, moderately high spire,
widely spaced axial ribs with an open spine at the shoul-
der, broad aperture, Haired peristome, and narrow
pseudoumbilicus. Sveltia has a widespread geographic
distribution in the Recent fauna, extending from western
Africa to Argentina, the tropical and temperate eastern
Pacific from Mexico to Chile, and New Caledonia. Dur-
ing the Pliocene, the range of Sveltia included most of
western Europe. Following the discoveiy of Sveltia
inquilinus (Jung and Petit, 1990: 91) from the Pliocene
of the Dominican Republic, these authors added Sveltia
to Woodring’s (1966: 428) list of paeiphile genera (genera
once present in both the Caribbean and the western
Pacific faunas that now survive only in the Pacific).
The discovery ol a Recent species ol Sveltia from Gua-
deloupe, described herein, reveals that the genus survives
in the Caribbean Sea, and is not a paeiphile genus.
SYSTEM ATICS
Family Cancellariidae Forbes and Hanley, 1851
S i i b family Cancel lariinae
Genus Sveltia Jousseume, 1887: 214.
Type Species: “ Sveltia varicosa Broee.” (= Voluta
varicosa Brocchi, 1814), by original designation.
Sveltia yoyottei new species
(Figures 1-3)
Description: Shell (Figures 1-3) small (to 13.6 mm),
thick, with tall conical spire (spire angle 55°), rounded
anterior, broadly ovate aperture with very short siphonal
canal, narrow siphonal fasciole and pseudoumbilicus.
Protoconch (Figures 4-5) paucispiral, increasing in di-
ameter from 370 pm to 1.2 mm in IV2 inflated,
smooth, glassy whorls, deviated from teleoconch axis
by WlO° . Transition to teleoconch abrupt (Figures 4-
5, arrows), marked by flared protoconch lip, onset of
thick, shouldered prosocline axial ribs with weak spiral
cords evident on ribs and shoulder. Teleoconch of 4
inflated, strongly shouldered whorls. Suture impressed.
Axial sculpture dominant, of strongly prosocline ribs
(9 on first postnuclear whorl, 11 on last whorl), with
thicker, broader varices forming on eveiy second then
third rib starting with third teleoconch whorl. Two
thick varices in close apposition appear to mark the
end of growth (as in species of Trigonostoma, see Petit
and Harasewyeh, 1987). Region between suture and
shoulder with 0-1 fine threads, broadly flared on ax-
ial ribs and varices. Spiral sculpture of: strong open
spines on ribs and varices along shoulder, 4-5 low,
weak, narrow, rounded cords between shoulder and
siphonal canal; 4 finer cords on siphonal canal, all
producing knobs or weakly open spines on axial ribs
and varices. Finer threads present between adjacent
cords near the shoulder. Aperture broadly ovate, taper-
ing anteriorly, deflected from coiling axis by 23°,
surrounded by continuous, flared peristome, broadest
along anterior third of outer lip. Outer lip with 10
short, rounded denticles. Inner lip with 2 denticles
along parietal region. Columella thick, concave, with
2 strong columellar folds and a siphonal fold. Siphonal
canal broad, indistinctly demarcated along outer lip.
Shell cream colored, inside and out. Periostracum un-
known. Operculum absent.
R.E. Petit and M.G. Harasewych, 2011
Page 73
Figures 1-3. Sveltia yoyottei new species. 1. Apertural, 2. Lateral, and 3. Dorsal views of the holotype, MNHN. Off Grande Terre,
Guadeloupe, France, French West Indies, in 300 m.
Figures 4-5. Sveltia yoyottei new species. 4. Apical and
5. Lateral views of the protoconch of the holotype.
Type Locality: Off Pointe de la Grande Vigie, north
Grande Terre, Guadeloupe, French West Indies, in
300 m.
Type Material: Holotype, Museum national d Histon e
naturelle, Paris, MNIIN 23684.
Etymology: This new species honors Mr. Jean-Claude
Yoyotte, who collected the type specimen.
Comparative Remarks: Sveltia yoyottei it most simi-
lar to Sveltia inquilinus (Jung and Petit, 1990) from the
Pliocene of the Dominican Republic from which it can
be distinguished by its slightly shorter, more gradate
spire, narrower pseudoumbilicus, and fewer, stronger
denticles along the outer lip. Sveltia inquilinus has more
inflated whorls with finer and more numerous spiral
sculpture. The closest living relative of S. yoyottei
appears to be S. centrota (Dali, 1896), which ranges from
Baja California to the Galapagos. Sveltia centrota differs
in having a much larger, broader, heavier shell with 8-10
evenly spaced varices per whorl, and lacks axial ribs
between adjacent varices. Sveltia yoyottei also resembles
Sveltia zahni (Bose, 1910) from the Pliocene of
Tehuantepec, Mexico, a precursor of S. centrota. How-
ever, S. zahni has a taller, narrower shell with a more
sharply angled shoulder with fewer varices, and a
smaller, narrower aperture.
ACKNOWLEDGMENTS
We are pleased to acknowledge the assistance of Mr.
Dominique Lamy of Guadeloupe, French West Indies,
who recognized this specimen to be an unkown species
and permitted us to publish this description.
Page 74
THE NAUTILUS, Vol. 125, No. 2
LITERATURE CITED
Bose, E. 1910. Zur jungtertiaren Fauna von Tehuantepec.
I. Stratigraphie, Beschreibung und Vergleich mit ameri-
kanischen Tertiarfaunen. Jahrbuch der Kaiserlich-
Koniglichen Geologischen Reichsanstalt 60: 215-255, pis.
12, 13.
Dali, W.H. 1896. Diagnoses of new species of mollusks from
the west coast of America. Proceedings of the United
States National Museum 18: 7-20.
Jung, P. and R.E. Petit. 1990. Neogene paleontology in die
northern Dominican Republic. 10. The family Cancel-
lariidae (Mollusea: Gastropoda). Bulletins of American Pale-
ontology 98(334): 85-144, pis. 1.5-29.
Petit, R.E. and M.G. Harasewych. 1987. The Indo-West
Pacific species of the genus Trigonostoma sensu stricto
(Gastropoda: Cancellariidae). The Veliger 30: 76-81.
Woodring, W. P. 1966. The Panama land bridge as a sea barrier.
Proceedings of the American Philosophical Society 110(6):
425-433. '
THE NAUTILUS 125(2):75-78, 201 1
Page 75
Not a “living; fossil:” the eastern Pacific bivalve Tellidorella
O
belongs with Lucinidae, not Cardiniidae
John D. Taylor
Emily A. Glover
Department of Zoology,
The Natural History Museum
London SW7 5BD, UNITED KINGDOM
j . taylor@nhm . ae . uk
[email protected]
Paul Valentieh-Scott
Santa Barbara Museum of Natural
History Santa Barbara,
CA 93105 USA
[email protected]
ABSTRACT
Tellidorella (type species: T. cristulata ) is a small eastern Pacific
bivalve presently classified in the Cardiniidae, a family other-
wise known as fossils from the Paleozoic and early Mesozoic.
Evidence from shell characters including external sculpture,
hinge teeth, and adductor muscle scars suggests a more appro-
priate placement in the subfamily Myrteinae of Lucinidae. This
is the first record of a myrteine in the eastern Pacific.
Additional keywords: Bivalvia, Myrteinae
INTRODUCTION
The marine bivalve genus Tellidorella Berry, 1963
includes a single, small (ca. 6 mm) living species,
T. cristulata Berry, 1963, which ranges from Baja
California to Peru on the eastern Pacific at offshore
shelf depths. The familial classification of the genus
lias been problematic. Originally placed in the
Crassatellidae by Berry (1963) it was moved to the
Cardiniidae by Cox and Chavan (1969) and regarded as
a living species of a family that otherwise ranged from
the Ordovician to early Jurassic periods (in their words,
a living fossil ). In the meantime, from Pliocene beds of
Ecuador, Olsson (1964) described a new genus,
Lirotarte, with L. paphia Olsson, 1964 as type species,
which he placed in the Astartidae. This species closely
resembles T. cristulata and the new genus was sub-
sequently synonymized with Tellidorella by Cox and
Chavan (1969). They provided the first illustration of
T. cristulata with an outline drawing of the shell interior
and photographic images of Lirotarte paphia. Since
then Tellidorella has continued to be classified within
the Cardiniidae (Keen, 1971; Dockery, 1982; Bernard,
1983). However, we believe that Tellidorella is much
better placed in the chemosymbiotic family Lucinidae
rather than Cardiniidae, Crassatellidae or Astartidae
and we outline our reasons below with new figures and
analysis of characters.
SYSTEMATICS
Tellidorella Berry, 1963
Type Species: Tellidorella cristulata Beriy, 1963:140,
by monotypy.
Lirotarte Olsson, 1964: 40. Type species: L. paphia
Olsson, 1964: 40, pi. 5, figs. 8, 8a-f), Pliocene, Ecuador,
Esmeraldas Formation. Length 3.2 mm, height 3 mm.
Description: Shell features as for T. cristulata below.
Remarks: Berry (1963) suggested placement of
Tellidorella in Crassatellidae because of a general simi-
larity with Crassinella species but noting (p. 140) that the
hinge “. . .is altogether distinctive if not indeed unique.”
A year later, Olsson (1964) placed Lirotarte in Astartidae.
Cox and Chavan (1969) synonymized the two genera and
placed Tellidorella in the Cardiniidae, stating (p. N580)
“This small shell is a "living fossil’ having all morphologi-
cal characters of the Cardiniidae, among which are the
right duplicate, V-shaped posterior laterals, lack of dis-
tinct 5b, a long Al, no marginal ATV and P1V."
Tellidorella cristulata Berry, 1963
(Figures 1-8, 19)
T. cristulata Berry, 1963: 140
T. cristulata. — Cox and Chavan, 1969: N580, fig. E80A2
(figs. E80Ala-c are T. paphia (Olsson, 1964))
T. cristulata. — Keen, 1971: 106 fig. 236 (right valve,
interior and exterior of holotype.)
Description: Shell very small (length ca. 6 mm), later-
ally compressed, slightly asymmetrical with left valve
slightly smaller, subtrigonal, ventrally rounded, posteri-
orly slightly truncate, umbones prominent, sharp, mod-
erately prosogyrate. Sculpture of around 10 widely
spaced, projecting commarginal lamellae that become
bluntly spinose along the posterodorsal margin. Posterior
dorsal area with lower commarginal lamellae in many
specimens. Interspaces between commarginal lamellae
Page 76
THE NAUTILUS, Vol. 125, No. 2
Figures 1-8. Tellidorella cristulata Berry, 1963, dredged, SE ofPunta San Antonio, Sonora, Mexico, 27°53'60" N, 11104'32" W.
Santa Barbara Museum of Natural Histoiy, SBMNH 83203. 1-2. Exterior of left valve (1) and right valves (2). Scale bar = 1 mm.
3-4. Interior of left and right valves. 5-6. Detail of cardinal teeth in left (5) and right (6) valves. Scale bar = 0.5 mm. 7. Dorsal view
showing lunule, ligament and escutcheon. 8. Detail of exterior shell sculpture showing radial folds between the commarginal
lamellae. Scale bar = 0.5 mm. Figures 9-18. Myrtea spinifera (Montagu, 1803) (9-14, 18) Porcupine Expedition, West of Ireland
(Natural Histoiy Museum, London, 1885.11.5 817—22) and Notormjrtea botanica (15-17) New South Wales, Australia, 1.6 km E of
Malabar Outlet, Sydney, 66 m (Australian Museum, Sydney, AMS C. 360780). 9. Myrtea spinifera juvenile, exterior of left valve. Scale
bar = 1 mm. 10-11. M. spinifera interior of left valve (10) and right valve (11). Scale bar = 1 mm. 1 2—13. M. spinifera, details of
cardinal teeth in left valve (12) and right valve (13) Scale bar = 1 mm. 14. M. spinifera, dorsal view. 15-16. Notormjrtea botanica
interior of right (15) and left (16) valves. Scale bar = 1 mm. 17. N. botanica detail of external sculpture. Scale bar = 0.5 mm.
18. Myrtea spinifera adult shell. Scale bar = 5mm.
with irregular radial ridges. Lunule lanceolate, elongate,
asymmetrical with left side narrower and fitting inside of
right valve. Escutcheon long, deep. Ligament external,
short. Hinge teeth: right valve with a single triangular
cardinal tooth, an elongate anterior lateral tooth and a
shorter posterior lateral. Left valve with two small cardi-
nal teeth separated by a triangular socket, anterior and
posterior lateral teeth small indentations. Adductor mus-
cle scars unequal, anterior scar larger than posterior.
Anterior scar reniform and ventrally detached from the
pallial line for about 1/3 of length (Ligure 19). Pallial line
entire, narrow. Inner shell margin smooth.
Holotype: California Academy of Sciences CAS-IZ
43974.00
Type Locality: Off Puerto Libertad, Sonora, Mexico,
29°51.8/ N, 1 12°46.S' W, 73 m.
Relationships of Tellidorella: Although Tellidorella
cristulata is a little studied species, since Cox and
Chavan (1969) its familial position has been firmly
entrenched in the Cardiniidae. This family, usually
assigned to superfamily Crassatelloidea, is known from
fossils ranging from the Ordovician to the Lower Juras-
sic, with eight included genera. No younger representa-
tives are known except for the Cox and Chavan (1969)
assignment of Tellidorella. Species of Cardinia are com-
mon in the early Jurassic (Lias) beds of northern
Europe and Palmer (1975) provides good illustrations
of a diversity of species. Cardinia species usually have
robust shells with heavy commarginal ridges and often a
V-shaped configuration of the heavy lateral teeth but
cardinal teeth are usually weak or absent.
The assignment of Tellidorella to Cardinidae was
made on the superficial similarity ol hinge teeth with
J.D. Taylor etal., 2011
Page 77
the V-shaped posterior lateral teeth of cardinids, sup-
posedly also present in Tellidorella . But the V-shaped
posterior laterals of Tellidorella actually consist of a sin-
gle lateral tooth that becomes dorsally near-confluent
with the edge of the escutcheon. The dorsal limb of the
V-shaped laterals is actually the inner edge ol the
escutcheon. Similarly, the so-called duplicate anterior
lateral teeth of the right valve are a single, long, true
lateral tooth with, dorsally, a groove and then the sharp
edge of the lunule. Because the valves of myrteineid
lucinids are asymmetrical, the edges ol the lunule and
escutcheon of the left valve fit into corresponding
grooves of the right valve. The figure of Tellidorella
cristulata in Cox and Chavan (1969, fig. 80A2) is a
misleading drawing that shows apparent V-shaped pos-
terior lateral teeth.
An initial inspection of Tellidorella cristulata
suggested to us that it would be better classified in the
family Lucinidae, with particular resemblance to Myrtea
species, although T. cristulata is smaller than most ol
these. Accordingly, we prepared lor SEM (scanning elec-
tron microscopy) examination specimens ol Mijrtea
spinifera (Montagu, 1803), the type species of Mijrtea
Turton, 1822, anti Notomyrtea botanica (Hedley, 1918)
of similar sizes to T. cristulata in order to compare shell
characters. These M. spinifera and N. botanica are juve-
nile shells, the species reach 25-30 mm and 15 mm in
length as adults, much larger than Tellidorella .
Shells of juvenile Mijrtea spinifera and Notomyrtea
botanica (Figures 9-18) are strikingly similar to
Tellidorella . Externally, the shell sculpture of M. spinifera
consists of widely spaced commarginal lamellae that are
projected into blunt spines along the posterior dorsal mar-
gin. The posterior dorsal area is marked by a zone of lower
lamellae. The lunule is long, lanceolate and asymmetrical,
the left valve fitting into the right. The escutcheon is long
and the ligament short and external. Internally, the hinge
teeth are veiy similar to Tellidorella, with a single triangu-
lar tooth in the right valve and two small cardinals in the
left valve. Lateral teeth are elongate and more prominent
in the right valve. The anterior adductor scar has a short
length of ventral detachment from the pallial line and the
ventral shell margin is smooth. Shell shape and hinge
teeth also closely resemble Notomyrtea botanica (Fig-
ures 15-16) from southern Australia. Mijrtea spinifera
lacks any radial sculpture between the commarginal
lamellae but this occurs in other Mijrtea group lucinids
such as Notomyrtea (Figure 17) and Eulopia Dali, 1901
(see Bretsky, 1976: pi. 34, figs. 11-13; Mikkelsen and
Bieler, p. 236).
An important group of shell characters used in the
recognition of Lucinidae concern the shape and length
of the anterior adductor muscle scar. In most lucinids
this is ventrally detached from the pallial line and
extends as an inwardly directed lobe. The muscle scar
varies both in length and in the angle of and extent of
ventral detachment from the pallial line. In genera such
as Miltha and Lucinoma the scar is veiy long and exten-
sively detached, while in others such as Myrtea and
Figure 19. Tracings of anterior adductor muscle scars in
left valve. A. Tellidorella cristulata, B. Mijrtea spinifera,
C. Notomyrtea botanica. Not to scale.
Parvilucina, it is short and only slightly detached from
the pallial line. Images ol Tellidorella cristulata clearly
show the anterior adductor scar with a short ventral
detachment from the pallial line (Figure 19). This is
similar to Myrtea spinifera and other 'Myrtea ’ group
lucinids (e.g., Glover and Taylor, 2007: fig. 6; Cosel and
Bouchet, 2008: fig. 14). Tellidorella shells also have
brown staining on the shell located at positions of the
anterior inhalant and posterior exhalant tubes indicating
the anterior-posterior water flow typical of lucinids.
Moreover, a body reconstituted from a dried shell pos-
sessed ctenidia with single demibranchs only and a nar-
row, elongate foot typical of Lucinidae.
In summary, the similarity of shell characters between
T. cristulata and juvenile Myrtea spinifera and N. botan-
ica indicate a close relationship. These include the later-
ally compressed shells, lateral asymmetry, the widely
spaced commarginal lamellae projected into postero-
dorsal flutes, the long lanceolate lunule, the short exter-
nal ligament, the similar arrangement of cardinal teeth
and the elongate lateral teeth more prominent in the
right valve and the anterior adductor muscle with a short
length of ventral detachment from the pallial line.
Tellidorella specimens are always about 6 mm in length
and we conclude that it is a small species. Despite the
similarity of Tellidorella to juveniles of Myrtea and
Notomyrtea, adults of these genera are morphologically
distinct (Figure 18).
Although no suitably preserved material was available
for molecular analysis we are confident that the shell
characters of Tellidorella cristulata indicate placement
in the Myrteinae subfamily of the Lucinidae. The
Myrteinae was first proposed as a subfamily by Chavan
(1969) but he included some genera such as Lucinoma
and Monitilora that recent molecular analyses exclude,
although species of Myrtea, Notomyrtea and Gloverina
form a highly supported clade distinct from all other
lucinids (Taylor et al., in press). Little is known of the
biology of most myrteines but Myrtea spinifera lives in
Page 78
THE NAUTILUS, Vol. 125, No. 2
offshore muds in the north-western Atlantic and, in
common with all studied Lucinidae (Taylor and Glover,
2000), possesses symbiotic sulphide-oxidizing bacteria
housed in bacteriocytes of the ctenidia (Southward,
1986; Dando et ah, 1985). Recent deeper water sam-
pling in the tropical Indo-West Pacific has recovered a
diversity of species within the subfamily (Glover and
Taylor, 2007; Cosel and Bouehet, 2008).
As well as Tellidorella paphia (Olsson, 1964), from the
Pliocene of Ecuador, another fossil that can be assigned
to the genus is the early Oligocene species Tellidorella
interlacinia Dockery, 1982: pi. 20, figs. 9-10) from the
Vicksburg Group, Mississippi, USA, 6.5 mm length.
Interestingly, although Dockery classified Tellidorella in
Cardiniidae he placed the figure amongst Lucinidae spe-
cies on plate 20. Also, Squires (1990) pointed out that
Corbis mclellani Hanna, 1927 (length 6 mm) from the
middle Eocene of southern California is a likely
Tellidorella species.
Our conclusion is that Tellidorella is not a ‘ living fos-
sil” member of the otherwise Paleozoic-early Mesozoic
family Cardiniidae, but should be classified as a small,
distinctive eastern Pacific genus in the Myrteinae sub-
family of Lucinidae. Although 32 species of Lucinidae
are known from the temperate and tropical eastern
Pacific (Coan, Valentieh-Seott, and Bernard 2000; Coan
and Valentich-Scott, in preparation), Tellidorella is the
only member of the Myrteinae yet recorded.
LITERATURE CITED
Bernard, F. R. 1983. Catalogue of the living Bivalvia of the
Eastern Pacific Ocean: Bering Strait to Cape Horn. Cana-
dian Special Publication of Fisheries and Aquatic Sciences
61: 1-102.
Berry, S.S. 1963. Notices of new eastern Pacific Mollusca.
-V. Leaflets in Malacology 1 (23): 139-146.
Bret sly. S.S. 1976. Evolution and classification of the Lucinidae
(Mollusca; Bivalvia). Palaeontographica Americana 8(50):
219-337.
Coan, E.V., P. Valentich-Scott, and F.R. Bernard. 2000. Bivalve
Seashells of Western North America. Marine Bivalve
Mollusks from Arctic Alaska to Baja California. Santa
Barbara Museum of Natural History, Santa Barbara,
763 pp.
Cosel, R. von and P. Bouehet. 2008. Tropical deep-water
lueinids (Mollusca: Bivalvia) from the Indo-Pacific: essen-
tially unknown, but diverse and occasionally gigantic. In:
Heros, V., R. Cowie, and P. Bouehet (eds.) Tropical Deep
Sea Benthos, volume 25. Memories du Museum national
d’Histoire naturelle, Paris, 196: 1 15-213.
Cox, L.R. and A. Chavan. 1969. Family Cardinidae Zittel,
1881. In: Moore RC, (ed.) Treatise on Invertebrate Pale-
ontology, Part N, Mollusca 6, Bivalvia, vol. 2. Boulder,
Geological Society of America and University of Kansas,
pp. N578-N580. '
Dando, PR., A. J. Southward, E.C. Southward, N.B. Terwilliger,
and R.C. Terwilliger. 1985. Sulphur-oxidising bacteria and
haemoglobin in gills of the bivalve mollusc Myrtea
spinifera. Marine Ecology Progress Series 23: 85-98.
Dockery, D.T. 1982. Lower Oligocene Bivalvia of the Vicksburg
Group in Mississippi. Mississippi Department of Natural
Resources Bureau of Geology Bulletin 123: 261 pp.
Glover, E. A. and J. D. Taylor. 2007. Diversity of chemosymbiotic
bivalves on coral reefs: Lucinidae of New Caledonia and
Lifou (Mollusca, Bivalvia). Zoosystema 29: 109-181.
Keen. A.M. 1971. Sea shells of tropical west America. Marine
molluscs from Baja California to Peru. 2ml edition.
Stanford University Press, Stanford, 1064 pp.
Mikkelsen, PM. and R. Bieler. 2007. Seashells of Southern
Florida. Living marine molluscs of the Florida Keys and
adjacent regions. Bivalves. Princeton University Press,
Princeton, 503 pp.
Olsson, A. A. 1964. Neogene molluscs from northwestern Ecua-
dor. Paleontological Research Institute, Ithaca, New York,
256 pp.
Palmer, C.P. 1975. The British Lower Jurassic species of the
bivalve genus Cardinia. Bulletin ol the British Museum
(Natural History) Geology 26: 1-44.
Southward, E.C. 1986. Gill symbionts in thyasirids and other
bivalve molluscs. Journal of the Marine Biological Associ-
ation of the United Kingdom 66: 889-914.
Squires, R.L. 1990. New Paleocene Fimbria (Mollusca:
Bivalvia) from the Pacific coast of southwestern North
America. Journal of Paleontology 64: 552-556.
Taylor, J.D. and E.A. Glover. 2000. Functional anatomy,
chemosymbiosis and evolution of the Lucinidae. In:
Harper, E.M., J.D. Taylor and J.A. Crame (eds). The
Evolutionary Biology of the Bivalvia. Geological Society
of London Special Publication 177: 207-225.
Taylor, J.D., E.A. Glover, L. Smith. P. Dyal, and S.T. Williams,
(in press). Molecular phylogeny and classification of the
chemosymbiotic bivalve family Lucinidae (Mollusca:
Bivalvia). Zoological Journal of the Linnean Society.
THE NAUTILUS 125(2):79-82, 2011
Page 79
A new gigantic species of Z eidorci Adams, I860 from Antarctic
waters (Gastropoda: Fissurellidae)
Cristian Aldea
Fundacion Centro de Estudios del
Cuaternario de Fuego-Patagonia y
Antartica (CEQUA)
Universidad de Magallanes
Avenida Bulnes 01890 - Casilla 737
Punta Arenas, CHILE
and
Departamento de Ecologia y
Biologfa Animal
Facultad de Cieneias del Mar
Campus Lagoas Marcosende, 36310
Universidad de Vigo, SPAIN
[email protected]
Diego G. Zelaya
Division Zoologia Invertebrados
Museo de la Plata
1900 La Plata
La Plata, ARGENTINA
Jesus S. Troneoso
Departamento de Ecologia y Biologfa Animal
Facultad de Cieneias del Mar
Campus Lagoas Marcosende, 36310
Universidad de Vigo, SPAIN
ABSTRACT
A new species of Z cidora, Z. antarctica new species, is
described from Bellingshausen Sea, Antarctica. The species is
characterized by having a large and low shell, with delicate
shell sculpture, spire extending beyond the shell's outline, and
relatively wide septum, curved at the anterior margin.
Additional keywords: Bellingshausen Sea, Southern Ocean
INTRODUCTION
To date, 14 Recent species of Z eiclora are known around
the world, most of them remaining poorly known
and based only on shell morphology (Geiger, 2006). Ol
these species, eight are known from the northern hemi-
sphere, in the Caribbean (. Zeidora naufraga Watson,
1883; Z. bigelowi Perez- Farfante, 1947; Z. neritica
Espinosa, Ortea, and Fernandez-Garees, 2004; and
Z. milerai Espinosa, Ortea, and Fernandez-Garees,
2004), Japan (Z. calceolina A. Adams, I860; Z. reticulata
A. Adams, 1862), Panama [Z. flabellum (Dali, 1896)],
and the Red Sea [Z. nesta (Pilsbry, 1890)]; and six spe-
cies from the southern hemisphere, from Galapagos
Islands [Z. galapagensis (McLean, 1970)], Easter Island
(Z. bahamondei Rehder, 1980), Australia [Z. lodderae
(Tate and May, 1900), Z. legrandi Tate, 1894, and
Z. tasmanica (Beddome, 1883)], and New Zealand
(Z. maoria Powell, 1936). Tate and May (1901) regarded
Zeidora legrandi as a junior synonym of Z. tasmanica-,
and Kuroda et al. (1971) and Kilburn (1978) reported
Z. reticulata as a synonym of Z. calceolina, although this
opinion was not shared by Herbert (1987).
In this paper, a new species of Zeidora from the
Bellingshausen Sea, Antarctica, is described. The mate-
rial reported here was collected during the BENTART
Expedition (Spanish Antarctic Program) aboard the R/Y
Hesperides, using an Agassiz trawl; and was deposited
at the Museo de Historia Natural de Madrid (MNCN),
Spain. For comparative purposes the collection ol The
Natural History Museum (NHMUK), London was stud-
ied, examining the types of Zeidora naufraga Watson,
1883 (holotype: NHMUK 1887.2.9.128), Z. maoria Pow-
ell, 1936 (2 syn types: NHMUK 1962954/1-2), and
Z. reticulata A. Adams, 1862 (holotype and another
specimen: NHMUK 1878.1.28.150).
SYSTEMATICS
Family Fissurellidae Fleming, 1822
Genus Zeidora A. Adams, 1860
Type Species: Zeidora calceolina A. Adams, 1860 (by
monotypy)
Zeidora antarctica new species
(Figures 1-8)
Diagnosis: Shell large, ovately elongated, low; spire
posteriorly located, extending beyond shells outline.
Shell surface with delicate reticulate sculpture. Septum
relatively wide, one-fourth total shell length, with ante-
rior margin markedly curved.
Description: Shell large (16.2 mm length in the holo-
type), with high expansion whorl rate, whitish, delicate,
translucent. Spire of 114 whorls, located on postero-
ventral margin, extending beyond shell outline. Pro-
toconch of one whorl, 150 pm in diameter, planorboid,
Page 80
THE NAUTILUS, Vol. 125, No. 2
Figures 1-7. Holotype of Z eidora antarctica new species (MNCN 15.05/53569). 1. Dorsal view. 2. Ventral view. 3. Lateral
view. 4. Protoeonch. 5. Selenizone and slit. 6. Detail of shell sculpture. 7. Crenulations of postero-ventral margin. Scale bars:
Figures 1-3 = 5 mm; 4 = 100 pm; 5 = 1 mm; 6 = 200 pm; 7 = 500 pm.
slightly twisted to right (Figure 4). Last whorl strongly
elongated, ovate, narrow in outline (width / length
ratio = 0.55), low (height / length ratio = 0.29) (Fig-
ures 1-3). Base with widely curved lateral margins; pos-
terior margin short, almost straight; anterior margin
gently curved (Figure 2). Selenizone extending along
entire teleoconeh whorl, relatively wide, sculptured with
distinct commarginal ribs, surrounded by narrow keels
(Figures 1, 5). Slit open, with margins parallel, wide and
short (1/5 total shell length). Shell surface sculptured
with about 80 primary radial ribs, crossed by ~100,
almost equally developed, commarginal ribs. Intersec-
tion ol radial and commarginal ribs producing
small nodules and squarish interspaces (Figure 6).
Between primary ribs, microscopic (secondary) radial
and commarginal threads (Figure 6). Primary radial
ribs producing small crenulations at postero-ventral mar-
gin (Figure 7). Inner shell surface whitish and brilliant,
outer shell sculpture showing through. Internal septum
relatively large, extending for about 1/4 total shell length,
with markedly curved anterior margin.
Type Locality: 70° 8' 12" S, 84° 5T 41" W, Bellings-
hausen Sea, Antarctica, 603 in (Figure 8).
Figure 8. Location map showing the type locality of Z eidora
antarctica new species (•).
Type Material: Holotype, MNCN 15.05/53569; mea-
surements in Table I .
Distribution: Only known from the type locality.
( ) A single vial containing two specimens of Z, reticulata is housed at the NI1MUK. One of these specimens is the
holotype, and the other -coming from Cuming collection- it is not a type; however, there is no way ol knowing which specimen
is which.
Figures 9-15. Z eidora species. 9-10. Holotype of Z. naufraga (NHMUK 1887.2.9.128). 11-12. Paratype of Z. maoria (NHMUK
1962954). 13-15. Holotype and another specimen of Z reticulata (NHMUK 1878.1.28.150). Scale bars: Figures 9-10 = 5 mm,
11-15= 1mm.
Page 82
THE NAUTILUS, Vol. 125, No. 2
Etymology: The species is named after the geographic
area where the specimen was collected.
Remarks: Zeidora antarctica new species closely
resembles Z. naufraga (Figures 9-10), Z. maoria
(Figures 11-12), and Z. reticulata (Figures 13-15) in
general shell outline and sculpture. However, in these
species the spire is larger and more markedly extend-
ing past the posterior margin of shell, even when these
specimens are smaller in size. In addition, Z. naufraga
and Z. maoria have a less concave anterior margin of
septum than Z. antarctica ; Z. naufraga has a shorter and
wider slit; and Z. reticulata has a larger posterior margin
and stronger keels surrounding the selenizone. Further-
more, the shell sculpture in Z. maoria and Z. reticulata
produces rectangular interspaces, while in Z. antarctica
interspaces are squarish.
Regarding the other living species of the genus,
Zeidora antarctica differs from Z. bahamondei,
Z. lodderae, and Z. tasmanica by having a longer and
narrower shell outline; from Z. calceolina by having
delicate shell sculpture; and from Z. nesta , Z. jlabellum,
Z. galapagensis , Z. bahamondei , Z. milerai, Z neritica,
and Z. bigeloioi by having a wider septum. Z. antarctica
also is distinguished from any other species by its
extremely large size and allopatric geographical distribu-
tion (Table 1 ), since the new species described here pro-
vides the first record for the genus in Antarctic waters.
Thiele (1929) divided Zeidora in two subgenera:
Zeidora sensu stricto and Nesta H. Adams, 1870, a crite-
rion subsequently followed by VVenz (1938), Keen
(1960), and Herbert (1987). The presence of a broad
septum in Zeidora antarctica , clearly placed this species
in the nominotypic snbgenus.
ACKNOWLEDGMENTS
We would like to express our gratitude to Amelia
McLellan and Kathie Way (NHMUK) for sending
photographs of Zeidora naufraga, Z. maoria, and
Z. reticulata-, Yolanda Villacampa (National Museum
of Natural History; Smithsonian Institution; Washing-
ton, DC) for the photographs of the holotype of
Emarginula flabellum ; and the officers and crew of the
2006 BENTART cruise the R/V Hesperides, and
colleagues from the 2006 BENTART cruise, which
was carried out under the support of the Spanish
Government through the Antarctic Program GLC2004-
01856/ANT of the Ministry of Education and Science
(MEC). And we also thank Daniel Geiger for his
review of the manuscript.
LITERATURE CITED
Geiger, D.L. 2006. Southernmost record of Zeidora bigelowi
Farfante, 1947, from Honduras (Vetigastropoda:
Fissurellidae). The Festivus 38 (1): 3-4.
Herbert, D.G. 1987. Taxonomic studies on the Emarginulinae
(Mollusca : Gastropoda : Fissurellidae) of southern Africa
and Mozambique. Hemitonia , Clypidina, Tugali, Scutus,
Zeidora and two species of Emarginula . South African
Journal of Zoology 22: 1-13.
Keen, A.M. 1960. Mollusca I. In: R. C. Moore (ed.) Treatise on
Invertebrate Paleontology. Part I. Geological Society of
America, New York, xxiii + 351 pp.
Kilburn, R.N. 1978. The Emarginulinae ol Southern Africa
and Mozambique. Annals of Natal Museum 23: 431-
453.
Kuroda, T„ T. Habe, and K. Oyama. 1971. The Sea Shells of
Sagami Bay. Maruzen, Tokyo, xi + 249 pp, 46 pis.
Tate, R. and W. L. May. 1901. A revised census ol the marine
Mollusca of Tasmania. Proceedings of the Linnean Society
of New South Wales 26 (3): 344-171.
Thiele, J. 1929. Handbuch der systematisehen Weichtierkunde.
Gustav Fisher Verlag, Jena volume 1, 1134 pp.
Wenz, W. 1938. Gastropoda, Teil I: Allgemeiner Teil und
Prosobranehia I. Handbuch der Palaozoologie 6 (1).
Gebruder Borntraeger, Berlin, 48 pp.
THE NAUTILUS 125(2):83-85, 2011
Page 83
Do Philomycus ccirolinianus (Gastropoda: Philomycidae)
prefer to congregate?
Timothy A. Pearce
Katherine A. Porter
Section of Mollusks
Carnegie Museum of Natural History
Pittsburgh, PA 15213 USA
[email protected]
ABSTRACT
Field observations of land slugs Philomycus carolinianus
(Bose, 1802) together at shelters led us to ask whether they
were attracted to conspecifics versus attracted to a limited
resource (e.g., shelter). Our laboratory experiment offered
three shelters to three slugs in each replicate, with the expec-
tation that slugs would occur together under a single shelter ii
they preferred to be with conspecifics, while slugs would
occur singly under each shelter if they avoided conspecifics.
We found that slugs chose shelters regardless of the presence
of conspecifics, suggesting that their occurrence together in
nature is due to the sharing of limited shelter resources.
Additional key words: land slugs, shelter, limited resource
INTRODUCTION
Animals congregate for many reasons. In some cases,
they benefit from the presence ol others. In other cases,
they occur together in an area because a resource is
present there. Explanations for congregation behavior in
terrestrial mollusks include prevention of water loss
(Dundee et ah, 1975; Cook, 1981; Waite, 1988) and
escape from ground-level heat (Cook, 2001).
In nature, gastropods are commonly associated with
woody debris, and can be found congregated in areas
with large amounts of such debris (Kappes et ah, 2009).
Individuals of species ol slugs in the genus Philomycus
Rafinesque, 1820 are sometimes seen in close proximity
to each other, especially near coarse woody debris. In
some cases, these slugs are found in physical contact with
each other (a phenomenon known as huddling). However,
Philomycus individuals do not always exhibit huddling in
the wild, and the presence of multiple slugs in close prox-
imity is yet to be explained. Two possible explanations are
that individuals of Philomycus species are gregarious (pre-
fer to associate with each other) and that they tend to
congregate at the locations of limiting resources, regard-
less of the presence of other slugs.
Huddling and congregation are not unique to
Philomycus species. Orstan (2007) noted huddling by
individuals of the same and of different species of slugs,
but we do not know whether the same mechanisms
are acting in inter- and intra-specific huddles. In addi-
tion, although we now have better understanding ol the
systematic^ of Philomycidae (Fairbanks, 1986; 1989;
1990; 1993; 1998; Tsai et ah, 2005; Tsai and Wu, 2008),
we still know relatively little about their biology. In this
note, we examine congregation and huddling behavior
among individuals of a single species, the eastern North
American slug Philomycus carolinianus (Bose, 1802).
MATERIALS AND METHODS
Slugs were wild-caught in spring 2009 from the Patux-
ent National Wildlife Refuge, Prince George’s County,
Maryland (39o03' N, 76° 49' W). The slugs were used in
another experiment over the summer, then provided
to us for this study, which was conducted from 27
October to 21 November 2009. Voucher specimens,
preserved in 80% EtOH within a day post mortem,
are deposited at Carnegie Museum of Natural History
(CM 104587).
We prepared three arenas. Each was 44 x 28 x 22.5 cm
high. The arenas were corrugated cardboard boxes, each
lined with a plastic bag and covered with a 1.4 mm mesh
screen. To maintain humidity in the arenas, each screen
was covered with a stack of 12 moistened paper towels.
Each paper towel had a surface area ol 276 cirri.
Each arena floor was covered with soil approximately 1 cm
deep. In each arena, we placed three bark shelters measur-
ing approximately 12 cm long, 10 cm wide, and 1 .5 cm
thick. Each arena also contained a water dish and a food
dish that contained fish food flakes and mushroom slices.
The amounts of food and water provided were ample for
the number of slugs in each arena, ensuring that neither
food nor moisture was limiting. Shelter was the limiting
factor; other than the bark, food dish, and water dish, the
arena was devoid of objects that could function as shelters.
Page 84
THE NAUTILUS, Vol. 125, No. 2
We placed three mature slugs in each arena. For each
replicate, we observed slug positions once daily for six
days. Observations were made during the daytime when
slugs would more likely be resting under shelters. Time
of day when observations were made ranged from 7:42-
21:44 with a mean of 12:55 (95%, Cl 9:00-16:50).
Because we had a limited number of slugs, we re-used
slugs in subsequent trials to maximize the number of
replicates. The assigning of individuals to arenas was
not strictly random. Rather, with the exception of 2
individuals in the last trial, the slugs were grouped in a
manner ensuring that the individuals together in one
trial would not be together in a subsequent trial.
We compared the observed slug positions with a null
model, which assumed a random distribution of slugs
under the shelters. We generated the null model by
determining the 18 possible arrangements of three
slugs under three shelters. This null model predicts
nine instances of singletons (slugs alone under shel-
ters), six instances of pairs (two slugs under the same
shelter), and three instances of triplets (three slugs
under the same shelter). Triplets would be expected to
be more common if slugs are gregarious and less com-
mon if they prefer to be solitary. We used a chi-square
test to determine the statistical significance of the
observations.
RESULTS AND DISCUSSION
Table 1 shows the observed and expected numbers of
shelters with different numbers of slugs. With eight
replicates (a total of 83 observations), we observed 46
instances of slugs alone under shelters, 31 instances of
two slugs under the same shelter, and six instances of
three slugs under the same shelter. We discarded 18
observations in which at least one sing was not under a
shelter or in which a slug was using the food or water
dish as a shelter. We also discarded two replicates in
which one of the slugs died. The observed and expected
values are not significantly different from random [yj =
5.33, 2 degrees of freedom, 0.1>P>0.05).
This result suggests that slugs choose shelters ran-
domly, without regard to whether another slug is present.
Of particular interest is the observed trend for fewer
triplets than predicted by the random model (6 vs. 13.8).
Although this trend is not statistically significant, it does
suggest that these slugs are not gregarious.
Table 1. Number of shelters having 1, 2, or 3 slugs
underneath. y “ analysis indicates the slugs were behaving
randomly (0.1 >P>0.05).
Because these slugs appear to assort randomly,
congregations of slugs found in nature may indicate
the presence of a scarce resource (e.g., shelter) in that
particular location. Therefore, observations of slug hud-
dling could be used as evidence for resource scarcity.
For example, some land slugs appear to cluster to con-
serve moisture (Dundee et al., 1975; Cook, 1981;
Waite, 1988; although see Welsford et ah, 1990). In
this experiment, food and moisture were non-limiting.
A repetition of the experiment in which moisture,
rather than shelter, was the limiting factor might
allow us to study whether individuals of Philomycus
carolinianiis do huddle to conserve moisture. Investiga-
tions in which other resources were limiting could also
address whether huddling occurs due to the scarcity of
other resources.
All of the slugs used in this investigation were mature.
An investigation of the effects of age on congregation
behavior could provide additional data on the be-
havior of Philomycus species. Studies involving species
other than P. carolinianiis could determine whether
other species show similar behaviors.
ACKNOWLEDGMENTS
We are grateful to Megan Paustian for lending us the
slugs to use in these trials. Cagin Unal helped discuss the
design of the experiment and helped set up the trials. An
anonymous reviewer provided helpful comments that
improved the manuscript.
LITERATURE CITED
Cook, A. 1981. Huddling and the control of water loss by the
slug Umax pseudoflavus Evans. Animal Behaviour
29: 289-298.
Cook, A. 2001. Behavioral ecology: on doing the right thing, in
the right place at the right time. In: G. M. Barker (ed.) The
Biology of Terrestrial Molluscs. CABI Publishing, New
York, New York, pp. 447—487.
Dundee, D.S., M. Tizzard, and M. Traub. 1975. Aggregative
behavior in veronieellid slugs. The Nautilus 89: 69-71 .
Fairbanks, H.L. 1986. The taxonomic status of Philomycus
togatus (Pulmonata: Philomycidae): a morphological and
electrophoretic comparison with Philomycus carolinianiis.
Malacologia 27: 271-280.
Fairbanks, H.L. 1989. The reproductive anatomy and taxo-
nomic status of Philomycus venustus Hubricht, 1953
and Philomycus bisdosus Branson, 1968 (Pulmonata:
Philomycidae). The Nautilus 103: 20-23.
Fairbanks, H.L. 1990. Morphological comparisons of the spe-
cies of Megapallifera (Gastropoda: Philomycidae). The
Nautilus 104: 71-75.
Fairbanks H.L. 1993. The reproductive anatomy of Philomycus
sellatus Hubricht, 1972 and Philomycus virginicus
Hubricht, 1953 (Gastropoda: Philomycidae). The Nautilus
107: 9-13.
Fairbanks, H.L. 1998. Clarification of the taxonomic status and
reproductive anatomy of Philomycus batchi Branson, 1968
(Gastropoda: Pulmonata: Philomycidae). The Nautilus
1 12: 1-5.
T.A. Pearce and K.A. Porter, 2011
Page 85
Kappes, H., M. Jabin, J. Kulfan, P. Zach, and W. Topp. 2009.
Spatial patterns of litter-dwelling ta\a in relation to the
amounts of coarse woody debris in European temperate
deciduous forests. Forest Ecology and Management
257: 1255-1260.
Orstan, A. 2007. Contact with an alien. Tentacle 15: 14-15.
Tsai, C.L., II. II. Lin, and S.K. Wu. 2005. Comparison of
four philomycid slugs (Gastropoda: Stylommatophora:
Philomycidae) of Taiwan. Endemic Species Research
7: 41-49.
Tsai, C.L. and S.K. Wu. 2008. A new Meghimatium slug
(Pulmonata: Philomycidae) from Taiwan. Zoological Stud-
ies 47: 759-766.
Waite, T. A. 1988. Huddling and postural adjustments in response
to desiccating conditions in Deroceras reticulatum (Muller).
Journal of Molluscan Studies 54: 249-250.
Welsford, I.G., PA. Banta, and D.J. Prior. 1990. Size-
dependent responses to dehydration in the terrestrial
slug, Limax maximus L.: locomotor activity and huddling be-
havior. Journal of Experimental Zoology 253: 229-234.
THE NAUTILUS 125(2):86-88, 2011
Page 86
Authorship and date of a key South American paper
by Phillip P. King ( 1832)
Eugene V. Goan 1
Santa Barbara Museum of Natural History
2559 Puesta del Sol Road
Santa Barbara, CA 94105-2936 USA
ge necoan @gm ail . com
Richard E. Petit
806 St. Charles Road
North Myrtle Beach, SC 29582-2846 USA
[email protected]
Diego G. Zelaya
Division Zoologia Invertebrados
Museo de La Plata
Paseo del Bosque s/n
1900 La Plata, ARGENTINA
dzelaya@fenym . unlp.edu. ar
ABSTRACT
An important paper describing many species of new marine
and terrestrial mollusks from southern South America was
published in the early 1830s. Its authorship has been attributed
either to King and Broderip or to King alone, and its date has
been given variously as 1830, 1831, or 1832. We here contend
that King alone should be considered its author and that it
should be dated as July 1832.
Additional keywords: Patagonia, Tierra del Fuego, malacologi-
cal literature
INTRODUCTION
At the beginning of the 19th century, a number of expe-
ditions provided the first insights into the knowledge of
the fauna from the southern tip of South America and
the adjacent Antarctic waters. In this regard, the results
of H.M.S. Adventure and Beagle represent a pioneer
contribution regarding mollusks, brachiopods, and bar-
nacles. A paper describing material from this expedition
was published in the penultimate issue of The Zoological
Journal , Volume 5, Part 19, pages 332-349. The signifi-
cance of that paper arises in the descriptions of
67 new species, including 14 species of marine bivalves -
one of them the commercially important scallop Z ygo-
chlamys patagonicus, 24 species of marine gastropods,
2 chitons, 18 terrestrial gastropods, 4 freshwater gastro-
pods, 3 barnacles, and 2 brachiopods. In addition, a new
gastropod genus, Marinula, was introduced. The title of
this non-illustrated paper is:
“Description of Cirrhipeda, Conchifera and
Mollusea, in a collection formed by the officers of
H.M.S. Adventure and Beagle employed between
the years 1826 and 1830 in surveying the southern
coasts of South America, including the Straits of
Magalhaens and the coast ol Tierra del Fuego. By
1 Research Associate
Captain Phillip P. King, R.N., F.R.S., &c., assisted
by W. J. Broderip, Esq. F.R.S., & c.”
It wall be noted that the “authorship” of this paper was
oddly styled, and it has also been assigned various publi-
cation dates, both matters addressed here.
AUTHORSHIP
The inclusion of Broderip seems to be an unusually
placed acknowledgement, but we have seen similar
examples used to emphasize an acknowledgment of a
non-author. It is clear from the content of the article that
King considered himself to be its author. In the second
paragraph of the article, he wrote:
“In the description of the species I have the bene-
fit of the advice and assistance of my friend
Mr. Broderip; and to his knowledge of the subject,
and the attention which he has devoted to my
collection, I owe in a great measure the paper
which I have now the satisfaction of presenting to
the public through the medium of the Zoological
Journal” [emphasis supplied].
In several other places in the introduction and elsewhere
in the article. King referred to the author of the article as
“I", and on p. 342, King again referred to “my friend, Mr.
Broderip”. The running head of the article is “Capt. P. P.
King’s Description of Cirrhipedia, Conchifera, and
Mollusea.”
It is notable that when Broderip had reason to refer to
the species named in this paper, he always showed King
alone as author. For example, in a paper read at the
Zoological Society of London on 29 February 1832,
Broderip (1832: 27) commented under his description
of Chiton setosus that “This species is veiy distinct from
Chit, setiger , King, (Zook Journ. vol. v. p. 338) . . and
under C. frembleii , Broderip (1832: 28) stated differ-
ences between it and “Chit, setiger , King”. In the Penny
Cyclopedia article on Helix, Broderip (1838: 108) men-
tioned Marinula King.
E.V. Coan et ah, 201 1
Page 87
In addition to Broderip, many other authors attributed
the taxa described in this paper to simply “King”, among
them G. B. Sowerby I (1832), Catlow and Reeve (1845),
Agassiz (1848), Carpenter (1857), Iredale (1915), Pfeiffer
(1857), Suter (1913), and Thiele (1929).
On the other hand, d’Orbigny (1834-1847), in his
Voyage clans TAmerique Meridionale , was inconsistent,
crediting some taxa to Broderip and others to King. The
frequent usage of “King & Broderip” appears to be a
rather recent change in the second half of the 20th cen-
tury after Sherborn (1922-1933) credited the species to
“King & Broderip”. Marincovich (1973) used "King"
when referring to the genus Marinula , but “King &
Broderip” in his Literature Cited. Powell (1960) and
Dell (1964) used “King” when referring to some species
and “King & Broderip” when referring to others. The
usage of “King & Broderip” became more common
at the end of 20t1' century, and is often the current usage
(Jonkers, 2003; Osorio, 2002; Pastorino, 2005a, b;
Pastorino and Harasewych, 2000; Reid and Osorio,
2000; Signorelli and Pastorino, 2011; Zelaya, 2005;
among many others).
A modern work using the same type ol assistance
acknowledgment is The American Museum of Natural
History Guide to Shells by W. K. Emerson and M. K.
Jacobson (1976), “with the assistance ol Harold S.
Feinberg and William E. Old, Jr.” The Library ol Con-
gress cataloging data has author as William K. Emerson
with Morris K. Jacobson as joint author, with Feinberg
and Old not mentioned.
Although the International Code on Zoological
Nomenclature’s Article 50.1 (ICZN, 1999: 52) precludes
the use of outside sources to determine authorship, we
take the view that attribution to King is inherent in the
paper, and that attribution to King by other authors, and
especially by Broderip himself, is confirmation ol our
interpretation of the oddly phrased authorship on the
paper. It is therefore our conclusion that King alone
should be regarded as author of the paper and of the
included taxa.
DATE
The issue of The Zoological journal containing this paper
was the penultimate one, and the journal’s operation was
not smooth. There is no real dating on this part of the
volume. The cover of volume 5 is imprinted "From
1832-1834”, and the bottom of the cover is dated 1835.
The Contents page for Part XIX containing this paper is
imprinted “July, 1830-September, 1831 .”, which is obvi-
ously meaningless. This paper and its contained species
have been dated by various authors as 1830, 1831, 1832,
and even 1835.
Pilsbry (1911: 525) seems to be the source ol the
mistaken date of 1830, and this has been followed by
some subsequent authors. A footnote in the King paper
itself (p. 341) notes that, while the paper was being
printed, the September 1831 issue of the Annales des
Sciences Natu relies had arrived describing one ol the
new species, and the type was then altered to accommo-
date the footnote and to change the species name
footnoted. The paper could not thus have appeared until
after September 183 1 .
Evidently, proofs of this paper were made available to
some workers soon after September 1831. For example,
the barnacle Elminius leachii described on page 334 was
figured by G. B. Sowerby I in a work that appeared on 4
January 1832. Sowerby (1832: unnumbered) stated that
“Capt. King has named the species Elminius leachii , see
Zool. Journ. vol. V. p. 334." There is a footnote on page
334 of the Zoological Journal article stating that the spe-
cies had already been named Elminius kingii Gray, per-
haps too late for the text to be changed, a fact not noted
by Sowerby. As noted above, Broderip cited two of King’s
chitons in a meeting in February 1832.
For unknown reasons, this issue was withheld and not
distributed to subscribers until July 1832. In a review
published in November 1832, N. A. Vigors, the editor,
noted that it was “published in July last” along with some
supplementary plates. This is the date given, without
explanation, by Sherborn (1922-1933) in his entries for
the included species. Most subsequent authors have
followed this (e.g., Jonkers, 2003; Pastorino 2005a, b;
Pastorino and Harasewych, 2000; Reid and Osorio,
2000; Signorelli and Pastorino, 2011; Zelaya, 2005;
among others).
This paper was evidently King’s only contribution to
malacology. He published a number of articles on verte-
brates, geography, and meteorology. Most ol his material
from this key invertebrate paper is in The Natural His-
tory Museum in London.
CONCLUSIONS
The authorship of the paper often cited as of “King &
Broderip,” is attributable to onlv P. P. King as are the taxa
described therein. The date of the paper should be cited
as July 1832.
LITERATURE CITED
Agassiz, L. 1848. Nomenclatoris zoologici index universalis.
Jent et Gassman, Soloduri [Solothurn]. x + 1135 pp.
Broderip, W.J. 1832. [. . . Mollusca and Conehifera hitherto
undescribed, which form part of the collection made by
Mr. H. Cuming . . .]. Proceedings of the Zoological Soci-
ety of London, for 1832[2]( 16): 25-33 (21 April) [individ-
ual species descriptions by W. | Broderip and by G. B.
Sowerby I, combined by the Secretary in one text block],
Broderip, W.J. 1838. Helicidae. Pp. 104-111, in: C. Knight,
The Penny Cyclopaedia of the Society for the Diffusion
of Useful Knowledge. C. Knight, London. Vol. 12, 510 pp.
Carpenter, P. P. 1857. Report on the present state of our knowl-
edge with regard to the Mollusca of the West coast of
North America. Report of the British Association for the
Advancement of Science for 1856: 159-368, pis. 6-9.
Catlow A. and L. Reeve. 1845. The conchologist’s nomenclator.
Reeve Brothers, London, [1] + viii + 326 pp.
Page 88
THE NAUTILUS, Vol. 125, No. 2
Dell, R.K. 1964. Antarctic and sub-Antarctic Mollusca:
Amphineura, Scaphopoda and Bivalvia. Discovery
Reports 33: 93-250, pis. 2-7.
Emerson, W. K. and M.K. Jacobson. 1976. The American
Museum of Natural Histoiy guide to shells - Nova Scotia
to Florida. Alfred A. Knopf, New York. 482 + xviii pp.,
46 pis.
ICZN [International Commission on Zoological Nomenclature],
1999. International Code of Zoological Nomenclature,
4th ed. International Trust for Zoological Nomenclature,
London, xxix + 306 pp.
Iredale, T. 1915. A commentary of Suter's “Manual of the New
Zealand Mollusca.” Transactions of the New Zealand
Institute, 47: 417—497.
Jonkers, II. A. 2003. Late Cenozoie-Reeent Pectinidae
(Mollusca: Bivalvia) from the Southern Ocean and
neighbouring regions. Monograph on Marine Mollusca 5:
viii + 1-125.
King, P. P. 1832 (July). Description of Cirrhipeda, Conchifera
and Mollusca, in a collection formed by the officers of H.
M.S. Adventure and Beagle employed between the years
1826 and 1830 in surveying the southern coasts of South
America, including the Straits of Magalhaens and the
coast of Tierra del Fuego [“assisted by W. J. Broderip”].
Zoological Journal 5(19): 332-349.
Marincovich, L. 1973. Intertidal mollusks of Iquique, Chile.
Natural History Museum of Los Angeles County, Science
Bulletin 16: 1-49.
d'Orbigny, A.D. 1834-1847. Voyage dans l’Amerique
Meridionale . . . execute pendant les annees 1826 . . .
1833, .... 5(3)[Mollusques]: xliii + 758, 85 pis. [in Atlas].
Paris (Bertrand) & Strasbourg (Levrault). Pp. 1-48,
73-128, pis. 1, 2, 9-13, 15, 16, 56, 1834 [pis. 1, 2: 14
Nov.]; pp. 49-72, 129-176, pis. 3-8, 17-23, 25, 55, 1835
[pis. 18, 19, 22: 13 March; pi. 4: 18 May; pi. 3: 1 June; pp.
49-72: 23 Nov.]; ; pp. 177-184, pis. 14, 24, 26-28, 30-32,
34, 35, 37, 58, 1836; pis. 33, 36, 1836?; pp. 185-376, pis.
29, 38-52, 57, 1837 [pis. 38, 41: 19 June]; pis. 54, 59-66,
68, 69, 1839; pp. 377-424, pis. 53, 67, 70, 71, 1840; pp.
425-488, pis. 72-76, 80, 1841; pis. 83, 85, 1842; pi. 84,
1842?; pp. 529-600, 1845; pp. 489-528, 601-728, 1846;
pp. 729-758, 1847?; pis. 77-79, 81, 82, 1847).
Osorio R., C. 2002. Moluseos marinos en Chile. Especies de
importancia economica. Universidad de Chile, Facultad
de Ciencias, 212 pp.
Pastorino, G. 2005a. A revision of the genus Trophon Montfort,
1810 (Gastropoda: Muricidae) from southern South
America. The Nautilus 1 19: 55-82.
Pastorino, G. 2005b. Recent Naticidae (Mollusca: Gastropoda)
from the Patagonian coast. The Veliger 47: 225-258.
Pastorino, G. and M.G. Harasewyeh. 2000. A revision of the
Patagonian genus Xymenopsis Powell, 1951 (Gastropoda:
Muricidae). The Nautilus 1 14: 38-58.
Pfeiffer, L. 1857. Catalogue of Aurieulidae, Proserpinidae, and
Truncatellidae in the collection of the British Museum.
British Museum, London, [ii] + 150 pp.
Pilsbry, H.A. 1911. Non-marine Mollusca of Patagonia.
Reports of the Princeton University expeditions to Patago-
nia, 1896-1899 3(5): 513-633, pis. 38-47 + 5.
Powell, A.W. B. 1960. Antarctic and Subantarctic Mollusca.
Records of the Auckland Institute and Museum 5:
1 17-193.
Reid, D.G. and C. Osorio. 2000. The shallow-water marine
Mollusca of the Estero Elefantes and Laguna San Rafael,
southern Chile. Bulletin of the Natural History Museum
of London (Zoology) 66 (2): 109-146.
Sherborn, C.D. 1922-1933. Index Animalium sive index
nominum quae ab A.D. MDCCLVIII generibus et
specibus animalium imposita sunt. Section Secunda. A
kalendis Ianuariis, MDCCCI usque ad finem Deeembris,
MDCCCL. British Museum (Natural History), London.
[Issued in 33 parts: 1, [i]-exxxii, 1-128, 1922; 2, 129-384,
exxxiii-cxxxvi, 1923; 3, 385-640, 1923; 4, 641-943, 1924; 5,
945—1196, 1924; 6, 1197-1452, 1925; 7, [exxxvii]-cxxxix,
1925; 8, 1773-2008, 1925; 9, 2009-2248, 1926; 10, 2249-
2568, 1926; 11, 2569-2880, 1926; 12, 2881-3136, 1927;
13, 3137-3392, 1927; 14, 3393-3746, 1927; 15, 3747-
3970, 1928; 16, 3971-4194, 1928; 17, 4195-4450, 1928;
18, 4451-1690, 1929; 19, 4691-4930, 1929; 20, 4931-
5138, 1929; 21, 5139-5348, 1929; 22, 5349-5701, 1930;
23, 5703-5910, 1930; 24, 5911-6118, 1930; 25, 6119-
6358, 1931; 26, 6359-6582, 1931; 27, 6583-6806, 1931;
28, 6807-7056, 1932; 29, [i]-vii, exxxiii-cxlviii, 1-208,
1932; 30, 209-416, 1932; 31, 417-654, 1932; 32, 655-878,
1933; 33, 879-1098, 1933.]
Signorelli J.H. and G. Pastorino. 2011. Revision of the
magellanic Mactridae Lamarck, 1809 (Bivalvia:
Heterodonta). Zootaxa 2757: 47-67.
Sowerby, G.B., 1. 1832. Genus Elminius. The genera of recent
and fossil shells, 36: [2] pp. + unnumbered plate.
Suter, 11. 1913-1915. Manual of the New Zealand Mollusca.
John Mackay, Wellington, xxiii + 1,120 pp., 1913; Atlas 71
pis. [Atlas, 1915]
Thiele, J. 1929-1935. Handbuch der systematischen
Weiehtierkunde. Gustav Fischer, Jena. 2 vols. [1(1),
1-376 (1929); 1(2), i-vi, 377-778 (1931): 2(3), 779-1,022
(1934); 2(4), i-vi, 1,023-1,154 (1935).]
Vigors, N.A. 1832. Reviews. Art. 1. Catalogue of works on
natural history, lately published, with some notice of those
considered the most interesting to British naturalists. . . .
The Zoological Journal, No. 19. Magazine of Natural His-
tory and Journal of Zoology, Botany, Mineralogy, Geology,
and Meterology 5(29): 648-649.
Zelaya, D.G. 2005. The bivalves from the Scotia Arc islands:
species richness and faunistic affinities. Scientia Marina
69 (Suppl. 2): 1 13-122.
Sponsored in part by the State of Florida, Department
of State, Division of Cultural Affairs, the Florida Arts
Council and the National Endowment for the Arts.
NATIONAL
ENDOWMENT
FOR THE ARTS
INSTRUCTIONS TO AUTHORS
THE NAUTILUS publishes articles on all aspects of the
biology, paleontology, and systematic^ of mollusks.
Manuscripts describing original, unpublished research
and review articles will be considered. Brief articles, not
exceeding 1000 words, will be published as notes and do
not require an abstract. Notices of interest to the mala-
cological community will appear in a notices section.
Manuscripts: Each original manuscript and accompa-
nying illustrations should be submitted to the editor pref-
erably via e-mail or as hardcopy in triplicate.
Text must conform to the dimensions of 8 A x 1 1-inch
paper, double-spaced, and single-column throughout (in-
cluding literature cited, tables, and figure captions). Au-
thors should follow the general recommendations ol Sci-
entific Style and Format — The CSE Manual for Authors,
Editors, and Publishers, available from the Council of
Science Editors at www.councilscienceeditors.org. The
first mention of a scientific name in the text should be
accompanied by the taxonomic authority, including year.
Latinized names and other words to be printed in italics
must be underlined; leave other formatting indications to
the editor. Metric, not English, units are to be used. Geo-
chronologic modifiers should be capitalized only when
units are formally recognized: for instance, use Late Cre-
taceous but early Miocene. Likewise, only modifiers of
formally recognized chronostratigraphic units are capi-
talized: use Lower Jurassic but upper Oligocene.
The sequence of sections should be title page, ab-
stract, introduction, materials and methods, results, dis-
cussion, acknowledgments', literature cited, tables, figure
captions, figures. The title page should include the title,
author’s name(s) and address(es). If corresponding au-
thor is not the senior author, please indicate. The ab-
stract should summarize in 250 words or less the scope,
main results, and conclusions of the article. Abstracts
should be followed by a list of additional key words. All
references cited in the text must appear in the Literature
Cited section and vice-versa. Please follow a recent issue
of THE NAUTILUS for bibliographic style, noting that
journal titles must be unabbreviated. Information on
plates and figures should be cited only if not included
within the pagination of cited work. Tables must be num-
bered and each placed on a separate page. If in doubt,
please follow a recent issue of the journal for sequence of
sections and other style requirements.
Illustrations: Illustrations are rendered eidier at full-
page width (maximum width 17 cm) or column width
(maximum width S.2 cm). Please take these dimensions
into consideration when preparing illustrations. Page-
width illustrations ideally should span the entire width of
printed page (17 cm). “Tall” page-width illustrations
should be avoided, square or “landscape” formats work
better. Please design plates accordingly, such that there
will be enough space left at the bottom of printed page
for plate caption. (Digital technology has made this task
much easier.)
All line drawings must be in black, clearly detailed,
and completely labeled. Abbreviation definitions must be
included in the caption. Line drawings must be high
resolution files at at least 600 dpi (dots per inch) resolution
at actual size. Standard digital formats for line drawings
include .tif, .bmp, .psd, .eps, and .pdf.
Photographs may be submitted in black-and-white or
color, preferably in RGB mode if in color. Standard digi-
tal formats for photographs include .tif, .psd, .jpg, or .pdf.
Photographs must be high resolution files at least 300 dpi
resolution at actual size.
If more than one figure is included in an illustration,
all figures are to be consecutively numbered (Figures 1,
2, 3, ... , NOT Figures 1A, 1B,1C, . . . , NOR 'Plate 1,
Figure 1, . . .). In illustrations with more than one figure,
make sure that blank areas between figures is kept to a
minimum, thereby allowing for more area for each indi-
vidual figure.
Compressed files (e.g., .jpg) may be used to facilitate
transmission of files during original submission, but may
not be acceptable at final submission (see below).
Voucher Specimens: Deposition of the holotype in a
recognized institutional, public collection is a require-
ment for publication of articles in which new species-
level taxa are described. Deposition of paratypes in in-
stitutional collections is strongly encouraged, as is the
deposition of representative voucher specimens for all
other types of research work.
The Editorial Process: Upon receipt, all manuscripts are
assigned a number and acknowledged. The editor reserves
the right to return manuscripts that are substandard or
not appropriate in scope for THE NAUTILUS. Manu-
scripts deemed appropriate for the journal will be sent
for critical review to at least two reviewers. The review-
ers’ recommendations will serve as basis for rejection or
continuation of the editorial process. Reviewed manu-
scripts will be sent back to authors for consideration of
the reviewers’ comments. The revised version of the
manuscript may at this point be considered accepted for
publication by the journal.
Final Submission: Authors of accepted manuscripts are
required to submit a final version via e-mail to the editor
[email protected]. Please do not send low-resolu-
tion or compressed illustration files at this stage. Send any
files larger than 20 Mb on a CD or DVD to the editor.
Proofs: After typesetting, proofs will be sent to the au-
thor. Author should read proofs carefully and send cor-
rections to the editor within 48 hours. Changes other than
typesetting errors will be charged to the author at cost.
Offprints: An order form for offprints wall accompany
the proofs. Offprints will be ordered through the editor.
Authors with institutional, grant, or other research sup-
port will be asked to pay for page charges at the rate of
$60 per page.
© This paper meets the requirements of ANSI/NISO Z39. 48-1992 (Permanence of Paper)
SMITHSONIAN INSTITUTION LIBRARIES
111 n mil li llilillllllllllllllllllllllllllllllllllllllllllllllll
3 9088 01617 9186
'
xWZ-
A quarterly devoted
to malacology.
EDITOR-IN-CHIEF
Dr. Jose H. Leal
The Bailey- Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
BUSINESS MANAGER
Amanda Stirn
Tire B alley- M atthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
EDITOR EMERITUS
Dr. M. G. Harasewyeh
Department of Invertebrate Zoology
National Museum of
Natural History
S nrithsonian Institution
Washington, DC 20560
CONSULTING EDITORS
Dr. Riidiger Bieler
Department of Invertebi'ates
Field Museum of
Natural Histoiy
Chicago, IL 60605
Dr. Arthur E. Bogan
North Carolina State Museum of
Natural Sciences
Raleigh, NC 27626
Dr. Philippe Bouchet
Laboratoire cle Biologie des
Invertebres Marins et Malacologie
Museum National d’Histoire Naturelle
55, me Buffon
Paris, 75005 France
Dr. Robert II. Cowie
Center for Conservation Research
and Training
University of Hawaii
3050 Maile Way, Gilmore 409
Honolulu, HI 96822
Dr. Robert T. Dillon, Jr.
Department of Biology
College of Charleston
Charleston, SC 29424
Dr. Eileen II. Jokinen
8234 E. North Shore Road
Sault Ste. Marie, MI 49783
Dr. Douglas S. Jones
Florida Museum of Natural History
University of Florida
Gainesville, FL 32611-2035
Dr. Harry G. Lee
4132 Ortega Forest Drive
Jacksonville, FL 32210
Dr. Charles Lydeard
Biodiversity and Systematics
Department of Biological Sciences
University of Alabama
Tuscaloosa, AT 35487
Bruce A. Marshall
Museum of New Zealand
Te Papa Tongarewa
PO. Box 467
Wellington, NEW ZEALAND
Dr. James PI. McLean
Department of Malacology
Natural History Museum
of Los Angeles Count)'
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Paula M. Mikkelsen
Paleontological Research
Institution
1259 Trumansburg Road
Ithaca, NY 14850 1
Dr. Diarmaid O Foighil
Museum of Zoology and Department
of Biology
University of Michigan
Ann Arbor, MI 48109-1079
Dr. Gustav Paulay
Florida Museum of Natural Plistory
University of Florida
Gainesville, FL 32611-2035
Mr. Richard E. Petit
P.O. Box 30
North Myrtle Beach, SC 29582
Dr. Gary Rosenberg
Department of Mollusks
The Academy of Natural Sciences
1900 Benjamin Franklin Parkway
Philadelphia, PA 19103
Dr. Angel Valdes
Department of Malacology
Natural History Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Geerat J. Vermeij
Department of Geology
University of California at Davis
Davis. CA 95616
Dr. G. Thomas Watters
Aquatic Ecology Laboratory
1314 Kinnear Road
Columbus, OH 43212-1194
SUBSCRIPTION INFORMATION
The subscription rate for volume
126 (2012) is US $60.00 for
individuals, US $97.00 for
institutions. Postage outside the
United States is an additional US
$10.00 for regular mail and US
$28.00 for air delivery. All orders
should be accompanied by payment
and sent to: THE NAUTILUS, P.O.
Box 1580, Sanibel, FL 33957. USA,
(239) 395-2233.
Change of address: Please inform
the publisher of your new address at
least 6 weeks in advance. All
communications should include both
old and new addresses (with zip
codes) and state the effective date.
THE NAUTILUS (ISSN 0028-1344)
is published quarterly by The Bailey-
Mat thews Shell Museum, 3075
Sanibel-Captiva Road, Sanibel, FL
33975.
Periodicals postage paid at Sanibel,
FL, and additional mailing offices.
POSTMASTER: Send address
changes to: THE NAUTILUS
P.O. Box 1580
Sanibel, FL 33957
THE
CONTENTS
Tore Il0isaeter
Daniel L. Geiger
Kathryn E. Perez
Victor Scarabino
Fabrizio Scarabino
Richard L. Squires
Jonatas Alves
Manuel Haiinovici
M.G. Harasewycb
Richard E. Petit
John K. Tucker
Baldomero M. Olivera
Emilio F. Garcia
Research Note
Arthur E. Bogan
Do Van Tu
N A U T I
L U S
Volume 125, Number 3
September 1, 2011
ISSN 0028-1344
Species of Anatoma (Gastropoda: Anatomidae) in Norwegian and
adjacent waters, with the description of two new species 89
A new species of Praticolella (Gastropoda: Polygyridae) from
northeastern Mexico and revision of several species of this genus 1 13
Ten new bathyal and abyssal species of Scaphopoda from
the Atlantic Ocean 127
A new genus of Cretaceous margaritine gastropod (Turbinidae) from
the northeastern Pacific Ocean 137
Reproductive biology of Octopus tehuelchus d’Orbigny, 1834 (Cephalopoda:
Octopodidae) in southern Brazil 150
Two new species of Admetinae (Gastropoda: Cancellariidae) from
the northeastern Pacific Ocean 159
A new species of Bathytoma (Gastropoda: Borsoniidae) from
the Philippines 164
A new species of Eccliseogyra (Gastropoda: Nystiellidae) from
southeastern Brazil 167
Clarification of the authorship and date of publication of three Asian
species of Unionidae (Bivalvia) 171
THE NAUTILUS 125(3):89-112, 2011
Page 89
Species of Anatoma (Gastropoda: Anatomidae) in Norwegian
and adjacent waters, with the description of two new species
Tore Hoisaeter
University of Bergen, Department of Biology
P.O. Box 7800
NO-5020 Bergen, NORWAY
[email protected]
Daniel L. Geiger
Santa Barbara Museum of Natural History
2559 Puesta del Sol Road
Santa Barbara, CA 93105 USA
[email protected]
ABSTRACT
The species of Anatoma Woodward, 1859 from Norwegian
waters and from the Norwegian Sea are treated taxonomically.
Anatoma crispata (Fleming, 1828) has until quite recently been
regarded as the sole representative of this family in north
European waters, but constant conchological differences make
it evident that at least three species have been lumped under
this name in Norwegian and other Scandinavian literature.
Three species, A. crispata, A. aspera (Philippi, 1844) and A.
tenuisculpta (Seguenza, 1877) are redescribed and two new
species from deep water in the Norwegian Sea, A. schioettei
new species and A. schanderi new species, are described based
on shell characters. The distribution in inshore Norwegian
waters and in the Norwegian Sea is described, and possible
microhabitats suggested. Also geographical variability of con-
chological characters is discussed in some detail.
Additional keywords: Mollusca, Seissurelloidea, Vetigastropoda,
Norwegian inshore waters, bathyal, Norwegian Sea
INTRODUCTION
Until recently it has been universally accepted that
the family Anatomidae is represented in north European
waters by a single species, Anatoma crispata (Fleming,
1828). In a paper, in which also A. crispata was recorded
from Bergen, Loven (1846) described, but did not illus-
trate, Scissurella angulata, from northern Norway.
Except for Loven, no one has questioned that A. crispata
is the only species of the family in Norway, although
several authors remarked that two or more varieties
might be present. All early authors (e.g. Friele, 1874
and Verkriizen, 1875), reported A. crispata with-
out further discussion. However, Jeffreys (1870) and
G.O. Sars (1878), remarked that the specimens found
in Norway might be a larger variety of the British form,
and G.O. Sars mentioned A. aspera and A. angulata
as synonyms. Odlmer (1912) is the first author to clearly
distinguish between three varieties of A. crispata in
northern waters: A. crispata sensu stricto, A. crispata
“var. angulata” Loven, 1846, and A. crispata “var.
aspera,” (= var. paucicostata Jeffreys, 1865) all of which
he recorded from Norwegian waters, but without any
clear differentiation of geographic localities.
Recently, Waren (in Hansson 2003) stated that both
A. aspera and A. crispata are found in western Norway,
and that there is a possibility that a third species is pre-
sent in western Sweden and in northern Norway as well.
For several decades, one of us (T.H.) accumulated
a sizeable material of Anatoma from the coast of Noway.
This material, in addition to material graciously donated
to T.H. (now deposited at ZMBN) by Per Bie Wikander,
material from the H2Deep project, and available
museum lots, has made it possible to reassess the genus
in Nowegian waters and the Norwegian Sea. Constant
conchological differences make it evident that at least
three species have been lumped as Anatoma crispata
in Nowegian and other Scandinavian literature. In
this article, we designate neotypes and redescribe
A. crispata and A. aspera based on material from
the western Mediterranean, the north Atlantic, the Nor-
wegian Sea and Noway. Additionally we resurrect and
redescribe A. tenuisculpta (Seguenza, 1877) based on
material from the western Mediterranean and the
northeastern Atlantic Ocean. Furthermore, we describe
two new species: A. schioettei new species, based on
material from the shelf off East Greenland (75° N)
and a hot vent locality northeast of Jan Mayen, and
A. schanderi new species, from the bathyal and abyssal
of the Nowegian Sea. Finally, the distribution of the
three species in inshore Nowegian waters is discussed.
Since A. crispata is the type species for the genus
Anatoma in the family Anatomidae, it is of particular
importance to unravel the taxonomic problems associ-
ated with this species, which has been misunderstood
for such a long time.
MATERIALS AND METHODS
The geographic area covered is primarily the coast of
Noway, but the availability of additional material from
various parts of the Nowegian Sea (in this context used
as a collective for the Nowegian Sea proper, the Iceland
Page 90
THE NAUTILUS, Vol. 125, No. 3
Sea and the Greenland Sea) allowed for the inclusion
of the entire area between Norway and Greenland as
well. The studv is based on material from five summer
J
cruises along the Norwegian coast in the period 1967 to
1971. These cruises covered most of the coast from
the Russian border to Stadt (70°15/ N to 62° N), and
resulted in 164 specimens and 546 empty shells of spe-
cies of Anatoma. In addition. Per Bie Wikander had
collected 163 specimens (plus 20 empty shells) in the
Skagerrak and Bod0 regions, in the southern and north-
ern part of Noiway respectively. Seventy- four specimens
and 26 shells were collected at various times between
1965 and 2010 near the Biological Stations of the Uni-
versity ol Bergen. A lew samples from the upper slope
collected by Torleiv Brattegard (1 Ipisaeter, 2010) that
contained specimens of Anatoma are included as well.
A few specimens from the Mareano program, and three
small, but most interesting samples from ROV-assisted
sampling of hot vents and other deep-water localities
around Jan Mayen, during the H2Deep program con-
tributed to expand the geographic and bathymetric cov-
erage. The scope of the investigation was further
enhanced by museum material from Hamburg (ZMH)
and Copenhagen (ZMUC) examined. In addition all
material from the four university-based museums in
Norway (TMB, ZMBN, ZMON, ZMT0N) have been
examined. When relevant to our taxonomic goals.
Recent and fossil material from Shetland and the Medi-
terranean was also studied.
The descriptions are primarily based on light micros-
copy (LM) and scanning electron microscopy (SEM).
Standard procedures for SEM were followed (Geiger
et ah, 2007). To get a broader selection of material for
description of variability, measurements were taken
from LAI photographs. Terminology follows Geiger
(2003). Characters found to be of primary value in
distinguishing species were: maximum size, shell shape,
rate of increase in whorl width with growth, umbilicus
width and presence or absence of a funiculus (a spiral
cord in the wall of the umbilicus), the distance between
selenizone and suture for the first few whorls, shape of
aperture, especially inner edge and relation to umbilicus
and any funiculus.
The sculpture is important and sometimes diag-
nostic, but generally rather variable. Details in the
microsculpture of the protoconch and teleoconch I (e.g..
Figure 1) are often important, but usually only visible
in SEAI images, and then only in fresh, uneroded shells.
Abbreviations used in the text are: DLG: Daniel L.
Geiger collection, Los Angeles, USA; DA1NEI: Delaware
Museum of Natural History, Wilmington, USA; JWC:
John Wolff Collection, Lancaster, USA; MNHN:
Museum National d’Histoire Naturelle, Paris, France;
MNW: National Museum Wales, Cardiff, United King-
dom; NHAIUK: The Natural History Museum, London,
United Kingdom; NHMW: Naturhistorisches Museum
Wien, Vienna, Austria; NMR: Natural History Museum,
Rotterdam, The Netherlands; NMSZ: National Museum
Scotland, Edinburgh, United Kingdom; SBMNH: Santa
Barbara Museum of Natural History, Santa Barbara,
USA; SRC: Stefano Rufini Collection, Aguillara, Italy;
TBS: Trondheim Biologiske Stasjon, Norway; USNM:
National Museum of Natural Histoiy, Smithsonian
Institution, Washington, USA; ZAIBN: Zoological Mu-
seum, Bergen, Norway; ZMH: Zoologisehes Museum,
Hamburg, Germany; ZMON: Zoological Museum, Oslo,
Noiway; ZAIT0N: Zoological Museum, Tromsp, Norway;
ZMUC: Zoological Museum, Copenhagen, Denmark;
H2Deep: Ultraslow spreading and hydrogen based deep
biosphere (Programme); Mareano: Marine Areal data-
base for Norwegian waters (Programme).
All material examined and not explicitely stated
to belong to a particular museum collection has been
deposited at the Zoological Museum in Bergen, Nomay
(ZMBN).
SYSTEMATICS
Anatomidae McLean, 1989
Anatoma Woodward, 1859
T\pe Species: Scissurella crispata Fleming, 1828
(by monotypy).
Remarks: Anatoma was long regarded as a subgenus of
Scissurella d’Orbigny, 1824. Schizotrochus Monterosato,
1877 is an objective synonym. In the early 1960s Anatoma
was rediscovered as the correct name for the group,
but it was still regarded as a subgenus of Scissurella.
Powell (1979) seems to have been the first to recognize
that the conchological differences between Scissurella
sensu stricto and Anatoma warranted full generic status
for Anatoma. McLean (1989) introduced the taxon
Anatominae at the subfamilial rank, to which Geiger
and Thacker (2005) assigned full familial rank based on
a molecular phylogenetic study. The family is found
from Antarctica to the Arctic, from the intertidal to 5000
m, but is most common between 20 and 250 m (Geiger
and Sasaki 2009). In inshore Norwegian waters, three
species are found, and two additional ones in the Norwe-
gian Sea.
Anatoma crispata (Fleming, 1828)
(Figures 1-18)
Scissurella crispata: Fleming, 1828: 385, pi. 6, Figure 3.
Scissurella crispata: Forbes and Hanley 1853: 544; Jeffreys
1865: 283; G.O. Sars, 1878 (in part): 126, pi. 8, fig. 7a, b;
Norman, 1879 (in part?): 24; Schneider, 1886: 102; Nor-
man, 1893 (in part?): 360; Friele and Grieg, 1901 (in part):
59; Brogger, 1901 (in part?): 657, pi. 17, fig. 3; Norman,
1902: 357; Friele, 1903 (misidentification?): 15; Odhner,
1912 (in part): 13, pi. 2, figs 25-27; Dautzenberg and
Fischer, 1912: 286; Soot-Ryen 1924: 50; Dautzenberg,
1927: 213; Odhner, 1960: 384; Fretter and Graham, 1976
(in part): 2; Bouchet and Waren, 1979 (misidentification?):
220; Graham, 1988: 60.
Anatoma crispata: Hoisaeter, 1986 (in part): 81 ; Sabelli et al.,
1990 (misidentification?): 12; Smith and Heppell, 1991: 11.
T. Ii0isaeter and D. L. Geiger, 2011
Page 91
Figure 1. Anatoma crispata , neotype. SEM. Shetland,
Great Britain, 60°30' N, 1°15' W (NHMUK, 1849.10.5.5-7).
Scale bar shell = 1 mm; Scale bar protoconch = 100 pm.
Figure 2. Anatoma crispata, Bremnesfjorden, More og
Romsdal county. Noway (63°07' N, 200-180 m), 2.1 mm
diameter. Scale bar protoconch = 400 pm.
Scissurella angulata Loven, 1846: 20 (see below under
A. tenuisculpta) .
Description: (Based mainly on the neotype [Figure 1]
and a specimen from Bremnesfjorden, Norway
[Figure 2]). Shell globular, small to moderate size (to
2.25 mm diameter, neotype 1.83 mm), trochiform,
inflated, wider than tall. As in other species, juveniles
“flatter” than adults. Protoconch of 0.75 whorls, with
coarse floceulent sculpture, no apertural varix, apertural
margin straight to slightly convex. Teleoconch I of 0.75
whorls, approximately 22 fine axial s, weak spiral cord in
position of selenizone. Teleoconch II of little less than
two rapidly increasing, rounded whorls, suture adjacent
to selenizone except near aperture of mature shells where
up to five spirals separate suture and selenizone. Shoul-
der with 60-70 fairly strong axials on body whorl, some-
times rather crowded toward aperture; single spiral
thread at or slightly behind start of selenizone, ca. 12-13
threads at apertural margin of mature shells, lh> to xh
width of axials. No spirals in adsutural 15% of shoulder.
On base, 16-20 spirals cross the up to 65 rather strong
axials, creating a grid-like pattern, approximately one of
six to ten axials disappear at mid-base, remaining axials
spirals into not very wide umbilicus. Rather narrow funic-
ulus joins lower lip at columella starting point. Selenizone
at periphery, of varying width but mostly wide, keels
distinct, growth marks at least partly coordinated with
axials. Margins of slit parallel. Aperture rounded, roof
overhanging.
Operculum (Figure 2): Round, covering aperture, thin,
transparent, multispiral, with central nucleus.
Radula (Figures 3-7): Rachidian tooth trapezoid, cen-
tral cusp isolated, on either side four cusps arranged in
fan shape. Lateral teeth 1-3, similar, innermost of 3-4
cusps largest. Lateral tooth 4 reduced, outermost of four
cusps largest. Lateral tooth 5 enlarged, four cusps on
inner margin, terminal one largest, one cusp on outer
margin. Inner marginal teeth with triangular tip, termi-
nal cusp largest, inner margin with four small cusps,
outer margin with five larger cusps. Outer marginal
teeth spoon shaped, approximately eight fine cusps on
either side.
Differential Diagnosis: Anatoma tenuisculpta reaches
a much larger size than A. crispata (5 mm vs. 2.25 mm)
and is less globular and with more regular sculpture; it has
no funiculus at any growth stage. The protoconch is
smaller (216 vs. 255 pm) and the whorls increase more
slowly. The shoulder is less convex, as is also the base.
Tire edges of the slit and selenizone are also more regular
than in A. crispata, and the slit has slightly converging
margins in mature shells.
Anatoma aspera is taller and has a smaller protoconch
(172 vs. 255 pm) and “tighter” spiral whorls, with a wide-
angled funiculus starting fairly deep inside the umbili-
cus. The suture is significantly below the selenizone.
The selenizone keels are wider, more prominent, and
the axials on the shoulder are stronger, more “costae”-
like.
Anatoma schioettei is more lenticular, has a distinct
space between the start of the selenizone and the suture
of the subsequent whorl, and has about half as many
and more distinct axials.
Anatoma schanderi has a much larger shell (4.5 vs.
2.25 mm), is more turreted, has reticulate protoconch
sculpture, and the axials are weaker and more similar
in strength to the spirals.
Type Material: Whereabouts of Fleming’s syntypes
are unknown (McLean, 1967); they could not be found
in either NIIMUK, NMW, or NMSZ, and are presumed
Page 92
THE NAUTILUS, Vol. 125, No. 3
Figures 3-7. Anatoma crispata , radula, Fleslandsskjaer, Raunefjorden, Hordaland, Norway, 60°18' N, 5°13' E, (DMNH 23176, 1).
3. Whole radula. Seale bar = 200 pm. 4. Whole width of radula. Scale bar - 30 |im. 5. Central field with rachidian tooth (R) and
lateral teeth 1-4 ( LI — 4). Scale bar = 10 pin. 6. Marginal teeth. Scale bar = 10 pm. 7. Lateral tooth 4. Scale bar = 10 pm.
to be lost. Neolype here designated, Shetland, Great
Britain, 60°30' N, 1°15' W, NHMUK 1849.10.5.5-7.
Type Locality: Noss Island [outside Lerwick] in Shet-
land (60° 10' N, 1°00' W), where it was found in shell
sand on the beach after a storm (Jeffreys, 1865).
Other Material Examined: 20/7 specimens/shells
from Skagerrak, 29/15 from western Norway (own mate-
rial), 0/10 (ZMON), 1/1 (ZMBN); 65/307 from middle
Norway (63-65° N) (own material); 152/135 from north-
ern Norway (66-71° N) (own material), 9/41 (ZMON),
4/0 (ZMBN), 4/20 (ZMTo). Material from Shetland
0/37 (NHMUK, MNHN, NMSZ).
Variability: Anatoma crispata has a wide distribu-
tion, both geographical and bathymetrical, and its shell
morphology varies accordingly. Thus it is possible to rec-
ognize certain geographical morphotypes along the Nor-
wegian coast (Figures 8-13, 15 and 17), as specimens
from northern Noiway (67-68° N) are somewhat larger
(to 2.23 vs. 2.03 mm) and much more globular than those
from further south (H/D varies from more than 0.9 to
0.8 or less). The shell morphology ol the neotype (from
Shetland, Figure 1) falls within the variation seen among
16 17
Figures 8-13. Anatoma crispata , six specimens from inshore
Norwegian waters. 8, 11. South coast (58° 15' N, 90—80 and
57 m respectively). 9, 12. West coast (60° 3(7 N, 70-75 and
190 in respectively). 10, 13. North coast (67° 10' N, 30 m). All
specimens to scale, the largest (10) 2.23 mm diameter.
Figures 14-17. Anatoma crispata, four specimens from ca.
62-63° N. 14, 16. Iceland-Faroe Ridge (63°35' N, 12°5P W,
574 m). 15, 17. Coast of M0re og Romsdal (62°28' N,
120-60 m). All specimens to scale, the largest (14) 2.42 mm
diameter.
T. H0isaster and D.L. Geiger, 2011
Page 93
Figure 18. Anatoma angulata , lectotype, here desig-
nated, SEM (SMNH 4394), 2.25 mm diameter. Seale bar
shell = 1 mm; Seale bar, protoconch = 100 pm.
inshore southern Norwegian specimens (Figures 2
and 8-13).
Shells from the southern side of the Iceland-Faroe
ridge (Figures 14 and 16 ) are larger (to at least 2.45
mm) than material from inshore Norwegian waters at
roughly the same latitude (Figures 15 and 17) which do
not surpass 2.25 mm.
Distribution: Based on literature data the species is
widely distributed, from the Mediterranean to the
Barents Sea, from several hundred meters in fjords and
the upper slope, to 10-20 m in northern Norway. It is,
however highly doubtful that Anatoma crispata really
occurs in the Mediterranean, as all Mediterranean spec-
imens previously identified as A. crispata belong to
different species (A. aspera, A. tenuisculpta, A. eximia
(Seguenza, 1877), A. umbilicata (Jeffreys, 1883), A. new
species Geiger, ms), and all illustrations of sufficient
quality show species other than the true A. crispata).
The main distribution is probably the northern part
of the North Atlantic, in special the coast of Norway.
The distribution extends south along the western coast
of Britain and Ireland and farther south, but is insuf-
ficiently documented south of Ireland.
In material examined, there are specimens from
12-15 m (Vefsnfjorden, 65° 52' N) and 20-10 m
(Trondheimsleia, 63°24' N) to 848 m (upper slope at
68° 39' N, Mareano) and an empty shell from 1083 m
(on the slope at 69° N, Mareano). Inshore, it is found
down to 200-180 m in Bremnesfjorden, (Figure 2) and
190 m (Hjeltefjorden, 60° 33' N) and empty shells at 680
m in Korsfjorden (60° 08' N). The majority of living spec-
imens have been taken between 70-50 m in southern
and western Norway, and 40-25 m in northern Norway.
Remarks: Anatoma crispata is the first described
species of the family, and has consistently been con-
fused with a host of other species worldwide (e.g., the
Australian A. australis (Medley, 1903) and the north-
eastern Pacific Thieleella kelseyi (Dali, 1905): see Geiger
and Jansen 2004a, Geiger and McLean, 2010, and
also A. atlantica Bandel, 1998: see Tunnell et al. 2010)
and in north-European waters with at least two other
species treated here. Beginning with Jeffreys (1877),
a number of species have been described from various
deep water expeditions in the North Atlantic, but, until
recently, few attempts have been made to subdivide
the ubiquitous “A. crispata ” on the shelf/upper slope of
mainland Europe. The first may have been Dautzenberg
(1927) who decided that the available evidence favored
A. aspera to be a distinct species rather than just a
variety of A. crispata. Nevertheless, until around 2000,
most checklists still listed A. crispata as the only member
of the European marine fauna, sometimes in addition
to the deep water species A. umbilicata (Jeffreys, 1883)
another mostly misidentified species (see entry for this
species below).
In summaiy, the identity of A. crispata is highly
confused, both regionally as well as globally. Additionally,
A. crispata is the type species of the genus Anatoma ,
but the whereabouts of Fleming’s syntypes is unknown.
Accordingly, we designate here a neotype with the
explicit intent to stabilize the nomenclature of the taxon.
The specimen selected is from as close to the orig-
inal type locality as possible (Shetland Islands) and cor-
responds to Fleming’s (1828) description and illustration
as well as possible. It is a well-preserved specimen with
the protoconch. The specimen is at 1.83 mm slightly
larger than Fleming’s measurement of 1/15" [ = 1.67 mm].
Given the equally contentious identity of A. angulata
(see also under A. tenuisculpta below), we designate
herein the sole surviving syntype (SMNH 4394) of the
species as the lectotype (Figure 18), with the explicit
purpose of nomenclatural stabilization of this taxon, in
case non-conspecific syntypes should be located.
The present work documents that both A. aspera and
A. tenuisculpta are distinct from A. crispata , and that
these three species are all members of the Norwegian
fauna. Even A. crispata sensu stricto seems to be a vari-
able taxon, with a veiy wide distribution, both geo-
graphically and bathymetrically. In Norwegian waters,
it dominates the samples from northern Norway (north
of 64°N). Most (but not all) of the live-caught specimens
from this part of the coast are from shallow (10-25 m),
inshore, hard-bottom, environments. Museum-material
documents it from the eastern, cold-water Barents Sea
(71°42' N, 271 m, -1.4°C) (ZMBN 21014), and Bokfjord
in S0r-Varanger (15-10 m) (ZMT0 St. 4, 24/6 1937),
as well as from Vads0 in Varangerfjorden (ZMON D
391). Southward, it is found around the Skagerrak coast,
at least east to 9° E, near Ris0r. Hansson (2003) and
Waren (pers. comm.) report that, in the last few decades,
tins species has become very scarce on the west coast
of Sweden, after having been regularly collected in
Page 94
THE NAUTILUS, Vol. 125, No. 3
earlier years. It is unclear whether this is the case also for
the south coast of Norway. A number of the spec-
imens from the Skagerrak coast were collected by Per
\V ikander in 1986-1988 (see further below under
Remarks for A. aspera).
Anatoma aspera (Philippi, 1844)
(Figures 19-33)
Scissurella aspera Philippi, 1844: 160, pi. 25, Figure 17.
Scissu reiki aspera: Weinkauff, 1862: 349; Munier-Chalmas,
1862: 396; Hidalgo, 1867: 144; Norman 1888: 21; Odhner,
1960:385,387.
Scissurella erispata var. aspera : Jeffreys, 1883: 88; Odhner,
1912: 13, pi. 2 fig. 25.
Schizotroclius asper: Monterosato, 1884: 39; 1890: 143.
Scissurella ( Schizotroclius ) aspera : Dautzenberg, 1927: 213.
Anatoma aspera: Anistratenko and Starobogatov, 1997: 76, fig. 4;
Ardovini and Cossignani, 2004: 19; (misidentified: is A.
tenuisculpta their A. erispata is A. aspera ); Hoisaeter,
2009: 20.
Anatoma erispata Giannuzzi-Savelli et ah, 1994: 13
(is A. aspera).
Scissurella erispata var. paucicostata Jeffreys, 1865: 284
[Figure 27 below].
Description: (Based mainly on neotype (Figure 19)
and specimen from Raunefjorden, Hordaland county,
(Figure 20)). Shell globular, of medium size (to 3.3 mm
diameter). Height equal to or slightly less than diameter.
As in other species, juveniles “flatter” than adults.
Protoconch (Figures 21-22) of 0.75 whorl, with wide,
open, irregular sculpture; varix present (in some spec-
imens apparently doubled), barely connected to embry-
onic cap. Teleoconch I of 0.75-1 whorl, 20 (or more)
Figure 19. Anatoma aspera , neotype, Terreti - Cellantoni
Bridge, 567 m above sea level. Pleistocene epibathyal facies,
muddy clay, Italy, 38° 07' N, 15°43' E, SBMNH 149681,
2.66 mm diameter.
axials, often partly eroded in larger shells, interaxials
smooth except for strong spiral cord in position of
selenizone (may also be eroded in larger shells).
Teleoconch II up to 314 rapidly increasing whorls, with
5-12 spirals on base, visible between suture and
selenizone. Shoulder with up to 65-67 high, crest-like
axial costae on body whorl, additional fine axials on
keel of selenizone; at least 15 very fine spirals in
interaxials, an order of magnitude finer than axials, and
not crossing the latter. On base, 25-30 spirals cross up to
90 slightly sinusoid axials creating a grid-like pattern
(axials dominating but finer and denser than axials on
shoulder); some axials disappear at midbase; remaining
axials spiral into wide, deep umbilicus. Characteristic,
almost triangular, funiculus departing eolumellar lip at
roughly 40-45° near upper end of latter. Selenizone at
periphery or a little above, wide (15-20% whorl height),
keels distinct, somewhat flaring, growth marks not coor-
dinated with axials. Margins of slit parallel. Aperture
round, eolumellar lip somewhat flared, partly obscuring
the umbilicus. Shell grayish white, empty shells often
glassy, transparent, often with blackish “deposit” in some
of cavities created by grid-like sculpture on base. “Dirty"
aspect of specimen in Figure 20 largely representative
of Norwegian specimens.
Operculum: Round, covering aperture, thin, transparent,
multispiral, with central nucleus.
Radula (Figures 23-26): Rachidian tooth with central
cusp strongest, curved arrangement of 3-4 cusps on
each side. Lateral teeth 1-3 similar, apical cusp stron-
gest, 3—4 on outer edge. Lateral tooth 4 smaller, apical
Figure 20. Anatoma aspera , Liholmsrennen, Raunefjorden,
Hordaland county, (60°18' N, 70-55 m), 5 mm diameter. Scale
bar protoconch = 100 pm.
T. Hpisaeter and D.L. Geiger, 2011
Page 95
Figures 21-22. Anatoma aspera , protoconchs. 21. Northern Tyrrhenian Sea, Italy. 70-100 m (DLG 311, 6). 22. Liholmsrennen,
Raunefjorden, Hordaland, Norway, 60° 18' N, 5° 09' F,, 70-55 nr. Seale liars - 50 pm.
Figures 23-26. Anatoma aspera , radula, Liholmsrennen, Raunefjorden, Hordaland, Norway, 60° 18' N, 5°09' E, 70-55 m.
23. Central field. 24, 25. Marginal teeth. 26. Outermost marginal teeth. Scale bars 23, 25 = 20 pm; 24, 26 = 10 pm.
cusp strongest, 3 smaller cusps on inner margin. Lat-
eral tooth 5 elongated, apical cusp largest, approxi-
mately 6 cusps on inner edge. Inner marginal teeth
inequilaterally triangular, apical cusp largest, 3 on inner
margin, 4-5 on outer edge, outer marginal teeth with
spoon-shaped tip. Outermost marginal teeth paddle-
shaped with many small bristles at distal edge; no food
groove. Radular interlock of central field moderate.
Differential Diagnosis: Anatoma tennisculpta is
larger than A. aspera (5 vs. 3.3 mm) and wider at same
height, and has much narrower space between the
suture and the selenizone at any given number of whorls;
the former has a much finer axial sculpture, and more
regular and prominent spiral sculpture. The distance
between axials is more or less the same above and below
the selenizone in A. tennisculpta and with less dominat-
ing axials on the shoulders. In A. tennisculpta , the keels
of the slit and selenizone are less prominent, and the
width of the selenizone is about 20% smaller. There is
no funiculus in the narrower umbilicus. The shell is often
yellowish gray-white although this varies in preserved
material. The axial sculpture on the base is evenly
rounded, and the base is sloping more gradually down
from the selenizone.
Anatoma crispata is smaller (2.25 vs. 3.3 mm), more
globular, and somewhat wider at same height; the axial
sculpture on the shoulder is less dominating and the axial
sculpture on shoulder and base is equally well devel-
oped. On early whorls, the suture is immediately below
Page 96
THE NAUTILUS, Vol. 125, No. 3
the selenizone, whereas in large specimens it is less than
half the selenizone width. The keels of the selenizone
are not as prominent and the selenizone is narrower.
The protoconch is larger and the whorls increase more
rapidly in width. The umbilicus is narrower and with
a distinct funiculus starting at lower end of umbilical lip.
Figure 27. Holotype of Anatoma crispata “var. paucicostata ,”
USNM 181580. Scale bar shell = 1 mm; Scale bar protoconch =
100 pm.
Anatoma schioettei has a much smaller (2.15 vs. 3.3
mm) shell, is much more disc-shaped, and has fewer axials
that are crossed by almost imperceptible spirals.
Anatoma schanderi is larger (4.5 vs. 3.3 mm) has
weaker axial sculpture that is approximately as strong
as the spirals, sculpture on shoulder and base are approx-
imately equally developed, and the protoconch has retic-
ulate sculpture.
The radula ol A. aspera is similar to the one of
A. tenuisculpta and A. schanderi, in that the rachidian
has a dominating central cusp with three smaller ones
on each side, and wide lateral teeth 1-4 each with seven
long and narrow cusps, the innermost dominating.
Type Material: Whereabouts unknown (not in Ham-
burg), presumed to be lost. Neotype is here designated,
Terreti-Cellantoni Bridge, Italy, 38°07/ N, 15043/ E, 567 m
above sea level. Pleistocene, epibathyal facies, muddy
clay, SBMNH 149681.
Type Locality: Punta Pezzo 13 km north of Reggio,
Calabria, across the Strait of Messina from Sicily. Fossil
of Pleistocene age from shelf deposits.
Other Material Examined: 42/52 specimens /shells
of own material, 1/13 from the collections of ZMON,
6/9 from ZMBN, 1 shell from Trondheim Biologiske
Stasjon, 0/1785 from throughout its range in various
collections.
Variability: Figures 28-33 illustrate some of the vari-
ability of the species along the coast of Noiway. The
32
Figures 28—33. Anatoma aspera , six specimens from the coast of Norway. 28, 31. Raunefjorden, Hordaland county (60° IS7 N,
70-55 m and 60° 17' N, 70-80 m). 29, 32. North of Kirkelandet, More og Romsdal county (63° 10' N, 145 m). 30, 33. Mouth of
Andfjorden, Steinva?r- revet, Nordland county (69°13' N, 370 m). All specimens to scale, the largest (29) 3.3 mm diameter.
T. H0isaeter and D. L. Geiger, 2011
Page 97
neotype (Figure 19) and the holotype ot A. crispata “var.
paucicostata” (Figure 27) from Shetland further testify
to the morphological diversity of this species. The main
variability seems to be associated with whorl expansion
rates. Thus H/D ratios vary between 0.90 and 1 .08
in Norwegian specimens of roughly the same size. The
relative steepness of the shoulder (Figure 29 vs. 30) con-
tributes to the different appearances of the shells as well.
Further the relative strength of spirals and axials on the
base varies (compare Figures 28 and 32). Three empty
shells found around 69° N (Figures 30 and 33) have
an extreme shape with the body whorl dominating
completely, a wide selenizone and a longer more
“ crispata ” like funiculus than in the forms found further
south along the coast. Norwegian specimens generally
reach a large)- size than their Mediterranean counter-
parts, with maximum measured diameter of Mediter-
ranean shells at 2.4 mm. The selenizone is generally
wider and more open in Mediterranean specimens (see
Figures 19 and 20).
Distribution: According to the literature and avail-
able museum material, mainly Mediterranean but also
from the lower shelf and upper slope north along
the Portuguese, Spanish and French coasts, and off
the Irish and British western coasts. There are several
lots from Rockall Trough between 550 to 680 m, a single
lot from Porcupine Bank at 773 m, and a single specimen
from the lower shelf north of the Faroes (250-400 m).
Based on examined material, the species is found
in Norway from Mosterhavn in Hardangerfjorden
(59°42; N) to Andfjorden (69° 15' N), but with a signifi-
cant gap in distribution between 64°-69° N. (Possibly
some of the 37 records of Anatoma crispata in Sneii
et al. (2005) reporting the results from BIOFAR could
represent A. aspera ).
Remarks: The fossil assemblage described by Philippi
(1844) is most likely a mixture of species of Pliocene
to late Pleistocene age. This may be inferred from the
frequent and sharp changes in depositional characters
and fossil content due to strong Plio-Pleistocene tecton-
ics at the location (Barrier, 1987). Thus, it is not unrea-
sonable to accept Philippi’s name for the Recent species
discussed here. One of the leading fossils in the assem-
blage is in fact Modiolula phaseolina (Philippi, LS44),
which is regarded in Norway as a “carpeting” species,
creating a preferred substrate for a number of species
at intermediate depths (50-200 m) in the fjords. The
three inshore species of Anatoma discussed here are
often found together with this bivalve. Anatoma aspera
has been recognized as a valid Recent species in the
Mediterranean by most conchologists. Weinkauff (1862)
reported it from “Alger; tres-rare”; Munier-Chalmas
(1862) reported it also from Alger (may be the same
record) and, surprisingly, from “Berghen, (Norwege)”;
Hidalgo (1867) found a single, empty, but well pre-
served shell in the stomach of the fish Peristedion
cataphractum (Linnaeus, 1758) near Mahon in Menorca
(Balearic Islands, Spain). Later, Monterosato (1884)
claimed that it was known from many localities in the
Mediterranean, in contrast to A. crispata , which he
claimed was scarce in the Mediterranean and the
Adriatic Sea. Monterosato (1890) reported it without
further comments as a member of the deep muddy
bottom fauna near Palermo. (See also remarks above
on possible confusion of A. tenuisculpta with A.
crispata).
During the 1860s and 1870s, the species was not
reported from the Atlantic, and |effreys (1865: 285)
clearly had not seen it when he wrote: “Believing the
S. aspera of Philippi to be the same species as
S.angulata of Loven, and that the latter is merely a large
form of S. crispata,...". He thus set a pattern for
A. aspera to be considered a variety of A. crispata. That
Jeffreys was not familiar with Philippi’s species is evi-
dent from his naming of a new variety of A. crispata
“var. paucicostata” in the same work: “Spire more
raised, and the ribs on the upper side much fewer than
usual” (Figure 27, holotype). This variety was based on
material from Shetland. Jeffreys (1877: 234) stated
“I regard S. aspera of Philippi as a variety of the pre-
sent species [i.e. S. crispata ]. The height of the spire is
an unreliable character”. Later (Jeffreys 1883:88), he
synonymized the two varieties, “S. angulata of Loven
and S. aspera of Philippi are varieties [of A. crispata]-,
the latter corresponds with my variety paucicostata .”
During the 1890s, A. aspera was reported from fairly
deep water (1200-1400 m) in several localities in the
southern North Atlantic (e.g., Jeffreys, 1883; Locard,
1899). Some considered it to be a distinct species,
others as a variety of A. crispata. Dautzenberg (1927),
although recognizing a number of gradually converging
conchological characters, regarded it as a valid species
with a more southern distribution than A. crispata.
Dautzenberg (1927: 214) arguments for accepting it as
a valid species (reversing his opinion in Dautzenberg
and Fischer 1912): . .car Yaspera est constamment
plus petit, sa spire est beaucoup plus elevee, ses tours
sont etages et ses plis longitudinaux plus accuses.”
[“because aspera is consistently smaller, its spire is much
more elevated, its whorls are stepped and its longitudi-
nal folds are more prominent”].
Most non- Mediterranean authors (G.O. Sars, 1878;
Norman, 1879; Dautzenberg and Fischer, 1912 chose
to follow Jeffreys rather than Monterosato and later
Dautzenberg; Odhner (1912), and most later authors
either mention A. aspera as a variety of A. crispata, or
report A. crispata as the only species found in northeast
Atlantic waters (e.g., Fretter and Graham, 1976, Smith
and Heppell, 1 99 1 ) . This tradition has also been
adopted by most recent Mediterranean authors (Sabelli
et al., 1991, citing Schiro, 1986). Clear evidence of the
confusion is found in Giannuzzi-Savelli et al. (1994), in
which illustrations of A. aspera are misidentified as
A. crispata.
In discussing the Anatoma spp. collected by die
Swedish Josephine Expedition in 1869, Odhner (1960)
Page 98
THE NAUTILUS, Vol. 125, No. 3
mentioned A. asp era (as a full species) from Josephine’s
Bank (ea. 380 km due west of the southern tip of Por-
tugal, 200-935 m depth), in addition to three West
Indian localities ranging from 180-720 m depth. These
records from moderately deep water are supplemented
by three records by Dautzenberg (1927) from around
the Azores and the Canaries at 1230-1350 m. We have
not been able to locate any references to A. aspera as
a full species from northern waters in more recent
literature.
Anatoma aspera thus seems to be known as a
Recent species from three or four different geo-
graphic/bathymetric zones, the Mediterranean in mod-
erately deep water (20-1200 m: collection records
DLG, MNHN) in the southern part of the North
Atlantic on or near seamounts, from 200 m to 4400 m
(collection records RMNPI from Azores), and in Nor-
wegian inshore waters [plus the record of S. “var.
paucicostata” from Shetland by Jeffreys (1865)].
A statement that indicates that the material from
the southern part of the North Atlantic might be
specifically different from our northern form, is that
according to Dautzenberg (1927: 214 [translated
from French]) “ aspera is consistently smaller [than
A. crispata]”, which does not fit the Norwegian mate-
rial. The Norwegian shells of A. crispata never
reaches the size (maximum diameter 2.4 mm) of a
fully grown A. aspera (maximum diameter at least
3.3 mm). Mediterranean specimens, however, seem
generally to be smaller than Norwegian specimens
(to 2.5 mm).
In Norwegian waters, the species is definitely less
common than A. crispata , and is mainly a southern
form. Except for three shells from a Lophelia reef at
69° 14' N, we have no records of specimens from north
of 64'' 40' N. Two shells from the collection of the Zoo-
logical Museum in Tromsp, from respectively Lofoten
and Bjarkoy (ca. 69° N) may also belong to this species.
The species is rarely found shallower than 50 m or
deeper than 1 50 m, and the blackish “deposit” on all or
part of the shell (Figure 20) indicates that its microhab-
itat is somehow associated with blackish, maybe anoxic,
sediment.
It is perhaps of importance that in three recent
(Sep.-Oet. 2007) attempts to obtain some new material
from one of the most reliable localities from the 1960s,
only specimens of A. aspera have been found, and only
two specimens at that, whereas more than 30 specimens
of all three species were collected in a single sample in
the 1960s.
Given the confusing identities of the specific epithets
crispata and aspera , representing species for which
no type material is extant, it is important to stabilize
both taxa by designating neotypes. We designate here a
neotype for A. aspera, with the explicit intention of
taxon stabilization. As discussed above, the species was
described based on Pleistocene fossil material and is
widely recognized as extending its temporal range into
the Recent. We have selected a fairly well-preserved
fossil specimen from as close as possible to the original
type locality.
Anatoma tenuisculpta (Seguenza, 1877)
(Figures 34^7)
Scissurella tenuisculpta Seguenza, 1877: 273, pi. 16, Figure 29.
Scissurella tenuisculpta: Monterosato 1890: 143; Vazzana,
1996: 150, Figure 13.
Anatoma tenuisculpta: Lozouet 1986: 114.
Scissurella crispata auct. not Fleming, 1828: Loven, 1846: 20;
Jeffreys 1870: 444; Friele 1874: 15; G.O. Sars 1878 (in part):
126; Norman 1879 (in part?): 24; 1893(in part?): 360; Friele
and Grieg (in part): 59; Br0gger(in part?) 1901: 657; Odhner
1912 (in part): 13; Grieg 1914: 76; Hubendick and Waren
1974: 25; Fretter and Graham 1976 (in part): 2.
Scissurella crispata var. angulata auet. not Loven, 1846:
Odlmer I960: 384.
Scissurella argutecostata Seguenza, 1877: 273, pi. 16, Figure 30.
Scissurella funnazzensis de Gregorio, 1889: 13, pi. 1, fig. 9a-d.
Anatoma umbilicata auct. not Jeffreys, 1883.
Anatoma n.sp. Hoisaeter 2009: 21.
Description: (Largely based on neotype. Figure 34,
and specimen from Tomfjorden, Norway, Figure 35
and from Rovdefjorden, Norway, Figure 36). Shell large
(to 5.0 mm diameter), trochoid, biconicai, wider than
high, particularly in juveniles. Protoconch of slightly
more than 0.75 whorls, with very fine flocculation;
apertural varix not connected to embryonic cap,
apertural margin slightly sinusoid. Teleoconeh I of 0.5 to
0.65 whorls, with 17-30 fine axial cords, often partly
eroded, spiral cord in position of selenizone. Teleoconeh
Figure 34. Anatoma tenuisculpta, neotype, SEM, Terreti-
Cellantoni Bridge, 567 m above sea level Pleistocene
epibathyal facies, muddy clay, Italy (38°07' N, 15043/ E),
SBMNH 149680, 3.55 mm diameter.'
T. Hpisaeter and D.L. Geiger, 2011
Page 99
Figure 35. Anatoma tenuisculpta , Tomfjorden, Nordland county, Norway (66° 15' N, 380-300 nr), 4.1 mm diameter. Scale bar
protoconch = 100 pm.
II up to three whorls, suture approximately one to
three selenizone widths below selenizone (one to three
spirals between suture and selenizone), convex shoul-
der with 89-90 axials on body whorl (5 mm speci-
men); spirals starting with one median spiral between
axials 4 and 5, after two axials, one new spiral on each
side of first (all three on slightly concave lower part of
shoulder), number of spirals increasing rapidly to 8-10
on next half whorl, then gradually to 17-18 spirals at
aperture; spirals one order of magnitude finer than
axials, not crossing axials completely, but creating a
series of small nodules on axials of body whorl.
Adsutural spiral-free band not much wider than dis-
tance between spirals. Base slightly convex, with 28-30
spirals crossing approximately 130 (5 mm specimen)
only slightly stronger axials, creating regular grid of
rectangular “pits”; these axials descending into fairly
wide, deep umbilicus. Umbilicus open, without funic-
ulus. Selenizone at periphery, narrow, keels distinct,
axial lamellae distinct at least partly coordinated with
axials. Margins of slit mostly parallel but slightly con-
verging towards end. Aperture round; lower, inner lip
llared, especially in juveniles. Columellar lip evenly
rounded. Snails collected alive with translucent, yel-
lowish hue, with rust-colored deposits in pits of sculp-
tured surface.
Operculum (Figure 40): Round, thin and transparent,
multispiral with central nucleus.
Radula (Figures 37-39): Rachidian tooth trapezoid,
apical cusp largest, five cusps on each side. Lateral teeth
1-3 similar, innermost lateral tooth with five cusps,
innermost largest. Lateral teeth 2 and 3 similar with each
four equal-sized cusps. Lateral tooth 4 reduced, narrow
with a single cusp. Inner marginal teeth with triangular
tip, apical cusp largest, 5-6 cusps on each side. Outer
marginal teeth with spoon shaped tip, many fine bristles.
Radular interlock of central field moderate.
Gut content (Figure 41): Amorphous matter.
Differential Diagnosis: Aruitoma aspera is pro-
portionally taller and smaller than A. tenuisculpta
(3.3 vs. 5 mm), with much coarser and less regular
axial sculpture, and less prominent spiral sculpture on
the shoulder. There is a pronounced gap between the
suture and the selenizone above, particularly in larger
specimens. The selenizone is wider and the margins of
the slit are not converging. It has a wide-angled funiculus
deep inside the wide umbilicus. The curvature of both
shoulder and base is more convex, meeting the lower
selenizone keel at nearly a right angle.
Page 100
THE NAUTILUS, Vol. 125, No. 3
Figure 36. Anatoma tenuisculpta , SEM. Specimen from Rovdefjorden, More og Romsdal county, Norway (62°12' N, 200-150 m),
3.8 mm diameter. Scale bars shell = 1 mm; Scale bar protoconch = 100 pm.
Figures 37—41. Anatoma tenuisculpta, 3.8 mm diameter. SEM. Radula, operculum and fecal pellet. A specimen from
Rovdefjorden, M0re og Romsdal county, Norway (62012/ N, 200—150 m). 37. Entire radula. Scale bar = 200 pm. 38. Central field.
Scale bar = 20 pm. 39. Marginal teeth. Scale bar = 10 pm. 40. Operculum. Scale bar = 1 mm. 41. Gut content of amorphous matter.
Scale bar = 100 pm.
T. H0isaeter and D.L. Geiger, 2011
Page 101
45 46 47
Figures 42-47. Anatoma tenuisculpta, six specimens from the coast of Norway. 42. Straumsberget, Korsfjorden (60° 10' N, .'BOO-
ISO m) 45. Raunefjorden, Hordaland county (60° 17' N, 60-80 m). 43. Rovdefjorden (62° 12' N, 200-150 m). 46. Breisunddjupet
(62°28' N, 120-60 m). More og Romsdal county. 44, 47. Tomfjorden, Nordland county (66° 15' N, 380-300 m). All specimens to
scale, the largest (43) 4.2 mm diameter.
Anatoma crispata is smaller (2.25 vs. 5 mm), more
globular, has a distinct funiculus, and more rapidly
increasing whorls. The suture is adjacent to the
selenizone of previous whorl. Teleoconch I has fewer
and stronger axials. The shoulder is more convex with
stronger, more irregular and strongly curved axials; spi-
rals on the shoulder are fewer but more prominent, and
with a wide adsutural sector devoid of spirals. The base
has more widely spaced axials and spirals creating a grid
with larger, almost square pits. The aperture has a less
flaring lower and inner lip.
Anatoma schioettei is much smaller (2.15 vs. 5 mm)
has a more elevated overall shell shape, has about half as
many axials that are not crenulated, and the spirals are
barely perceptible.
Anatoma schanderi is more turreted, has a protoconch
with reticulate sculpture, the axials are much weaker,
and about as strong as the spirals.
The radula of A. tenuisculpta differs from that of
A. crispata mainly in having a broader rachidian tooth
with 11 cusps, of which the central one is the longest,
but is not isolated.
Type Material: Unknown whereabouts, presumed to
be lost. Neotype, here designated, Terreti-Cellantoni
Bridge, 567 m above sea level Pleistocene epibathyal
facies, muddy clay, Italy, 38°07' N, 15°43' E (DLG
1421, 6), SBMNH 149680.
Type Locality: Pliocene/Pleistocene deposits near
Reggio Calabria, southern Italy.
Other Material Examined: 92/80 specimens /shells
of own material, 32/72 from the collections of ZMON,
22/38 from ZMBN, 3/12 from ZMT0 and 7/0 from
TBS. From other collections: Norway (NPIMUK, 1):
Drobak, 59°40' N, 10°38' E (USNM 181590, 119;
USNM 181591, 34; USNM 181589, 8); 60-130 m,
Raunefjord, 60°16' N, 5°09' E (NMSZ 1973.59.1, 5);
West of Ireland and Great Britain: 765 m, Rockall
Trough, off W Scotland, 55°44' N, 16°07' W (NMR
993000033717, 32); 560 m, Rockall Trough, off
western Scotland, 55°49' N, 15°08' W (NMR
993000033720, 6); 587 m. West of Rockall Trough,
55°30' N, 15° 48' W (DLG 1217, 1); Southern North
Atlantic: 621-786 m, Josephine Bank, Azores, 36°40'
N, 14° 15' W (USNM 181618, 1); 1920 m, Challenger
Station SE342, 39°0T N, 10°40' W (NMSZ
1994128.60109, 8: complete); 1818 m, off W Portugal,
40°N, 9° 15' W (USNM 181602, 6); 2500 m, Chal-
lenger Station ES347, 41°38' N, 11°20' W (NMSZ
1994128.60110, 18: complete); 543m, Bahia de Cadiz,
Spain, 35°30' N, 6°08' W (NMR 993000033757, 12);
Mediterranean; 350 m, Fiumicino, Roma, 41°42' N,
12° E (NMR ex 993000033735, I); 400 m, Capraia,
43° 03' N, 9°54' E (SRC, 1); 70-100 m. Northern
Tyrrhenian Sea (SRC, l). Palermo, 38°08' N, 13°23'
E (ZMUC, 3).
Page 102
THE NAUTILUS, Vol. 125, No. 3
Variability: In the Norwegian material the only sig-
nificant variability seems to be difference in shape
(Figures 42-47). This is partly due to change with
growth, older specimens always being taller than youn-
ger ones, but comparison of shells in Figures 43 and 46
shows that shells of same size within a population may
also differ. No geographical trends in the Norwe-
gian material are evident. Shells from the Mediterra-
nean agree in all significant respects with the
Norwegian material.
Distribution: The majority of records are from the
coast and fjords of Norway, but a few museum spec-
imens indicate that it can be found in moderately deep
water (60-800 m) on the shelf and upper slope of the
northeast Atlantic ocean, possibly from the Faroe
Islands and southward to west of Gibraltar, with various
deep-water localities farther south. A veiy few records
are from Italian waters, 70-400 m. The species is prob-
ably overrepresented in museum material from Noiway
because of its size. With a single exception, a few shells
from Drobak in Oslofjorden, all museum specimens
are from western and northern Norway. In the mate-
rial from ZMBN (22/38 speeimens/shells), records of
A. tenuisculpta are from five to ten times more frequent
than each of the other two inshore species. Our own
material indicates that it is far less common in Norwe-
gian waters than A. crispata , of which we have three
times as many specimens and six times the number of
empty shells. The confirmed latitudinal distribution is
from 67°10' N, south to Korsfjorden (60° 10' N). The
few shells from museum collections show that there
is (or was) an isolated (?) population near Drobak and
scattered records north to Lofoten (68° 25' N) and south-
ern Troms county (68°50' N). The main depth distribu-
tion in Norwegian fjords is 80-200 m, with a few
finds up to around 50 m (50-25 m dredge haul) and
down to a little more than 300 m (380-300 m). A couple
of empty shells from a fjord bottom at 680 m indicate
that it might have been living even deeper than 380 m.
Remarks: This is the species called Anatoma n. sp. in
Iloisaeter (2009). Despite it having been figured and
described repeatedly from Norwegian waters, the spe-
cies has never been properly identified. This is partly
due to the confusion surrounding Scissurella angulota
Loven, 1846, which was accepted by most authors as
the name for this form, either as a lull species or as a
form of A. crispata. Loven (1846) described but did not
illustrate Scissurella angulata from northern Noiway in a
paper in which he also recorded A. crispata from Ber-
gen. This indicates that he did observe differences that
he regarded to be of specific value. His diagnosis in Latin
(four lines) is not detailed enough to let us decide which
of his two species is the real A. crispata. Lucidly, one ol
two syntypes is in SMNII, and SEM ol this specimen
(Figure 18 above) clearly shows that what Loven
regarded as the new species S. angulata in fact is a
specimen of A. crispata .
The species is thus in need of another name.
Anatoma richardi (Dautzenberg and Fischer, 1896),
A. josephinae (Odhner, 1960), A. umbilicata (Jeffreys,
1883), and A. tenuis (Jeffreys, 1877) are all species
described from deep water (360-2650 m) in the North
Atlantic. None of these names has ever been used for
the “large” Norwegian species, and studies of the
type material have eliminated all of them (Geiger,
unpublished data). However, Seguenza (1877)
described three species of “ Scissurella ” from Pleisto-
cene/Pliocene deposits from the Reggio Calabria
region in southern Italy (northern shore of the Mes-
sina Strait). Two of these, S. tenuisculpta and
S. argutecostata, have shell morphologies indistin-
guishable from our Norwegian form. Later (Gregorio
1889), described a species, S. funnazzensis from 140-
1 80 m depth off Sicily. Examination ol his illustrations
shows that this species is indistinguishable from
Seguenza’s two fossil “species”. Waren (pers. comm.)
studied material of S. tenuisculpta from the type local-
ity (any types have most likely been destroyed during
one of many earthquakes in the region during the first
half of the last century; Waren, 1980) and considers
specimens from these deposits indistinguishable
from Recent specimens from Mediterranean and Nor-
wegian waters. We agree and apply the first reviser’s
principle in selecting tenuisculpta as name for the spe-
cies. We cautiously apply this species epithet to the
Norwegian material. We designate here a neotype
(Figure 34) for A. tenuisculpta with the explicit inten-
tion of taxon stabilization.
Starting with |effreys (1865), many authors have
regarded Loven’s A. angulata as a variety of A. crispata ,
“As I suspected, S. angulata of Loven is a large form of
this species [A. crispata ]” (Jeffreys 1870: 444). Jeffreys,
familiar with the British forms of A. crispata , got
acquainted with the large Scandinavian “variety” on a
dredging excursion to Oslofjorden (Drobak), and prob-
ably assumed that the form described as new by Loven
was this large form. Friele (1874), G.O. Sars (1878),
Norman (1879, 1893), Schneider (1886) all accepted
A. angulata as a form or variety of A. crispata (mostly
implicitly as they did not necessarily mention
A. angulata , although, judging from museum material,
they certainly were mainly studying A. tenuisculpta).
Both G.O. Sars (1878), and Norman (1893) remarked
that the Norwegian form of A. crispata attains a much
larger size than the British form of the species. Norman
did not mention Loven’s species, but G.O. Sars
followed Jeffreys and synonymized both A. aspera and
A. angulata with A. crispata, and even ventured the
fanciful hypothesis that the British specimens studied
were all j uveniles. Monterosato (1890), in his survey
of the molluscs of the depths of the waters of Palermo,
discussed both S. tenuisculpta and S. angulata, the
latter based on the description and illustration in
G.O. Sars (1878). Monterosato left no doubt that he
regarded the large form from Nonvay as a species sep-
arate from A. crispata , and that it should be identified
T. H0isseter and D.L. Geiger, 2011
Page 103
as S. angulata Loven. He compared the fossil, S.
tenuisculpta with S. affinis O.G. Costa (which he syn-
onymized with S. funnazzensis de Gregorio, 1889) and
consequently regarded (Monterosato, 1890: 143) the
large Norwegian species (“The largest European spe-
cies and probably the largest known species, living or
fossil, confused by all with S. crispatus”) as distinct
from S. tenuisculpta. The only comment on S.
tenuisculpta is its “restricted umbilicus”.
The first author to seriously discuss the relationship
between the three forms from Scandinavia was Odhner
(1912: 13), who provided the following description of
Scissurella crispata var. angulata: “Shell less depressed
(than S. crispata s.s.); whorls more flattened above;
body-whorl therefore more angulated; aperture = 2/3
the spire; H. 4.2, D. 5 mm; whorls 4 3/4 - var. angulata
Loven, 1846." This description undoubtedly refers to
our A. tenuisculpta. Odhner, however was not consis-
tent in his concepts of “angulata” and “crispata" . In
Odhner (1960) he again referred to A. crispata var.
angulata when describing his species A. josepliinae.
By including specimens from Trondheimsfjorden and
Bohuslan (western Sweden) under the var. angulata
umbrella, he demonstrates that his idea of the variety
was not in accordance with tenuisculpta. Loven's orig-
inal material from “Finmark” (might be from anywhere
in northern Noiway, not necessarily in Finnmark
county) consisted of two specimens (the only remaining
shell is designated by us as lectotype, illustrated in
Figure IS above), both of which were studied by
Odhner (1912); Loven gave the maximum diameter as
2.4 mm (corresponding height 1.8 mm), quite different
from the 5 mm he gave as the diameter in the diag-
nosis for A. crispata “var. angulata.”
In more recent literature from the northeastern
Atlantic, several illustrations of A. crispata are based
on A. tenuisculpta. This is also true for the drawing in
Hubendick and Waren (1974) from the Bergen area,
western Noiway, and the one in Fretter and Graham
(1976) and thus also Graham (1988), which is the
drawing by Poul Winther based on another shell from
the Bergen area. Fretter and Graham (1976) also
presented two SEM images of the spire of what is
actually a specimen of A. tenuisculpta from the Bay of
Biscay.
In Noiway, Anatoma tenuisculpta is often found
(alone or with A. crispata and/or A. aspera) at interme-
diate depths, from 50 m downwards, at least down to 460
m (Trondheims-fjorden; Norman, 1893). The substrate
varies, but when a mixture of silt, shell gravel and small
stones (and often with an abundance of Modiolula
phaseolina ) is present, the chances of finding this species
are good. As late as June 2010, eight specimens were
found in outer Korsfjorden (60°08' N, 255-289 m). The
depth distribution of the three species is discussed fur-
ther in the Discussion below.
Anatoma schioettei new species
(Figures 48-60)
Description: (Largely based on holotype. Figure 48).
Shell of moderate size (to 2.15 mm diameter),
trochiform, stepped. Protoconch of 0.75 whorls, loose
flocculent sculpture with some of the flocculae orga-
nized into a distinct spiral on top of protoconch and
another, smaller and indistinct spiral near the inner part
of the protoconch. No apertural varix, apertural margin
straight, clearcut. Teleoconch I of ea. 0.75 whorl, with
approximately 15 axial cords, (weak) spiral cord in posi-
tion of selenizone. Teleoconch II of up to 2 whorls,
suture one to two selenizone widths below selenizone.
Shoulder slightly convex, strong axial cords, approxi-
mately 30-35 on first teleoconch II whorl. Weak spiral
threads starting late, with a single thread increasing
gradually to three to five near aperture. Base with same
axial sculpture as on shoulder, 30-55 per whorl, one out
of five or six fading out near middle of base. Around 16
weak spiral cords on base, getting gradually weaker
towards the periphery. Umbilicus open, wide, distinct
narrow funiculus. Aperture rounded oblong. Selenizone
at peripheiy, keels moderately elevated, weak.
Radula (Figures 49-53): Rachidian tooth trapezoid,
central cusp largest, four cusps in arc on each side of
tip. Lateral teeth 1-3 similar, apical cusp largest, 4-5
progressively smaller cusps on outer edge of tip. Lateral
tooth 4 reduced, hook-shaped, with 1-2 cusps on outer
edge. Lateral tooth 5 enlarged, apical cusp largest, 6-7
cusps along inner edge, 2-3 along outer edge. Inner
marginal teeth with triangular tip, apical cusp largest,
4-5 cusps on each side of tip. Outer marginal teeth with
spoon-shaped tip, many small cusps along edge. Outer-
most marginal teeth paddle-shaped with many fine bris-
tles along tip. Radular interlock of central field
moderate.
Figure 48. Anatoma schioettei new species, holotype, SEM,
from 749-774 m, off Greenland, 75°0T N, 12°38' W (ZMH K-
42704), 2.15 mm diameter. Scale bar shell = 1 mm; Scale bar
protoconch = 100 pm.
Paw 104
O
THE NAUTILUS, Vol. 125, No. 3
Figures 49-53. Anatoma schioetfei new species, 2.15 mm diameter, radula and operculum. Specimen from 749-774 m, Greenland,
75° OP N, 12°28' W (ZMPI K-42705). 49. Entire radula. Scale bar = 200 pm. 50. Central field. Scale bar = 20 pm. 51. Lateral tooth 5
and marginal teeth. Scale bar - 10 pm. 52. Outermost marginal teeth. Scale bar = 10 mm. 53. Operculum. Scale bar = 1 mm.
Figure 54. Anatoma schioettei new species, Trollveggen vent
field just north east of Jan Mayen, 71° 18' N, 5°47' W, 574 m,
1.95 mm diameter. Scale bar protoconch = 100 pm.
Differential Diagnosis: Anatoma crispata has whorls
that are closer to the selenizone of the previous whorl,
has at least twice as many axials, crossed by stronger
spirals, and has a more narrow umbilicus.
Anatoma tenuisculpta is much larger (5 vs. 2.15 mm),
has suture closer to the selenizone of the previous
whorl, has at least twice as many axials, which have a
crenulated appearance due to the crossing spirals, and
lacks a funiculus.
Anatoma aspera has a taller overall shell, has stronger
axials on the shoulder, and lacks a funiculus.
Anatoma schanderi has a taller shell with the base
visible between suture and selenizone at an angle
towards the spindle, is much larger (4.5 vs. 2.15 mm),
spirals and axials of approximately equal strength, and
a protoconch with more regular net sculpture.
The radula of A. schioettei is similar to the one of
A. crispata , narrow necked rachidian with an isolated
central cusp with three smaller cusps on each side. Lat-
eral teeth 1-3 similar, each with three strong cusps. Lat-
eral tooth 4 narrow with only one cusp. Lateral tooth 5
wide with at least seven cusps of which no. six from
center is the strongest.
Type Material: Holotype, ZMH K 42704, Paratypes
ZMII K 42705-42710, Z'MUC GAS-427, 428.
Type Locality: 749-774 m, upper slope off East
Greenland, 75°0T N, 12°38' W.
Other Material Examined: Three specimens from
574 nr, H2Deep ROV dive 22-2008, the Trollveggen vent
field just NE of Jan Mayen, 7TT8' N, 5°47' W; 70 m,
Greenland, 76°33' N, 69°23' W (ZMUC, 3: complete);
100-110 m, Greenland, 76°33' N, 69°0' W (ZMUC, 1:
complete); 197-198 m, Greenland, 75°01' N, 13°48/ W
(ZMUC, 1, L complete) (ZMUC - GAS - 427, 428).
Etymology: Named after Tom Sehi0tte of ZMUC. lie
generously provided material that he had been working
on himself, which provided the radulas for the two new
species.
Variability (Figures 55-60): Number and density of
axials vary, as does the presence or distinctness of spirals
on the shoulder, normally three but sometimes five weak
spirals are present on the middle of the shoulder. The
T. H0isaeter and D.L. Geiger, 2011
Page 105
58 59 60
Figures 55-60. Anatoma schioettei new species, six specimens from the northern Norwegian Sea. 55-57. Three (LM) from the
Trollveggen vent field, 574 m. 58-60. Three (SEM) from the upper slope off northeast Greenland, 749-774 m (ZM1I K - 42705—
42710.). Scale bars all = 1 mm.
spirals are always much weaker than the axials, and at
times only visible under very high magnification.
Distribution: The main distribution, judged by the
limited material available, appears to be the shelf and
upper slope off northeast Greenland, but as the two
records from northern Baffin Bay show, it probably has
a wide distribution in Arctic waters. As shown below,
variants of the species may extend to “shallow” water
hot vents near Jan Mayen, and to the upper slope off
western Norway (ca. 62° N).
Remarks: Two “forms” of this species appear to be
present in the Norwegian Sea, one on the upper slope
oil Greenland, at a depth from around 70 to 750 m at 75°
N (Figures 58-60), the other one at the “Trollveggen”
vent locality just northeast of Jan Mayen at 71°18' N,
at 574 m (Figures 54, 55-57). The main shell differences
appear to be erosion and deposit of dark brown and
black particles (microbes?) on shell surface.
In contrast to other known vent faunas, the vent
faunas on the two investigated vent fields in the Norwe-
gian Sea seem to be recruited from the surrounding soft
bottom. Thus, two or three species of the skeneid gastro-
pod Skenea are very similar to upper slope species on
the “Trollveggen” hot vent, while the single Skenea spe-
cies found on a much deeper hot vent locality in the
same area, is similar to a species living on the adjacent
soft bottom (Iloisaeter, unpublished). Whether or not
the two “forms” are distinct species is impossible to
ascertain from our material, but these subtle morpholog-
ical similarities make it hard to support description of
two new species (see the discussion below on why we
accept A. aspera and A. tenuisculpta as Recent species
although based on fossil types.) Anatoma spp. are not
unknown from hot vent environments, as shown by the
Japanese A. fujikurai Sasaki, Geiger and Okutani, 2010.
Anatoma cf. schioettei
(Figures 61-67)
Anatoma crispata (in part): Heisaeter 2009: 21; 2010:
240, fig. 6A.
On the upper slope off Norway, an Anatoma (Figures 61
and 62) was found that was originally classified as a
somewhat deviant “form” of A. crispata (see H0isaeter
2010). Altogether four specimens and seven shells of
this form were found in a dredge haul from 543 m and
one specimen from 602 m, presumably from sandy/
muddy sediment. On closer inspection (especially from
SEM illustrations), the specimens turned out to be
more similar to A. schioettei than to A. crispata. This
similarity is based on a turreted and rather lenticular
shell shape, and a protoconch that is pretty similar in
the two forms. The protoconch is scattered with small
irregular flocculae that merge onto a continuous spiral
line on top of the protoconch in both forms. In addition
the protoconch is in both cases terminated in a clean,
straight apertural margin. This as opposed to the single
irregular varix in A. schanderi , the “double” varix in
A. aspera and the gradual transition between the two
parts of tire shell in A. crispata.
The main difference from A. schioettei sensu strieto is
the strength of the axials, which can be variable in other
species. Radulae are similar but the number and shape
of the cusps on the raehidian and the laterals are dif-
ferent, A. cf. schioettei have more cusps on each tooth,
and the cusps are generally less pointed than those of
Page 106
O
THE NAUTILUS, Vol. 125, No. 3
Figure 61. Anatoma cf. schioettei from upper slope off the
Norwegian Trough, 62°20' N, 543 m, 2.4 mm diameter. Scale
bar = 200 pm.
Figure 62. Anatoma cl. schioettei , upper slope off the Nor-
wegian Trough, 62°20' N, 543 m, 1.7 mm diameter. Scale bar =
100 pm.
A. schioettei. That this aberrant form have supernumer-
ary lateral teeth (six instead of live) might be just an
individual aberration.
Remarks: Tl te distribution of this form is far from the
known distribution of A. schioettei sensu stricto. The
upper slope off Norway has a gastropod fauna apparently
heavily influenced by the fluctuating temperature of the
bottom-near water (Hpisaster, 2010). The relationship of
the fauna is with conspecifics or closely related species
on the Faroe-Shetland Ridge or on the shelf/upper slope
north of the Faroes. In this case the shelf/slope off
Greenland, both East and West Greenland, also seems
to be inhabited with a species closely related to a species
from the upper slope off Norway.
Anatoma schanderi new species
(Figures 68-83)
Description: (Largely based on holotype, Figure 68).
Shell fragile, of medium to large size (to 4.5 mm diam-
eter), trochiform, bieonical, stepped. Protoconch of
0.75 whorls, reticulate sculpture (Figure 69), with dis-
tinct apertural varix, apertural margin straight.
Teleoconch I comprising almost a full whorl, with
approximately 30 axial cords, strong spiral cord in posi-
tion of selenizone. Teleoconch II of up to 2.5 whorls,
suture lightly impressed, well separated from
selenizone by ca. 2 widths of selenizone (Figures 69
and 83). Shoulder convex, numerous and fairly weak
axial cords, approximately 65-70 per whorl in fully
grown specimens. Four to five rather indistinct spiral
threads on middle of shoulder. Basal sculpture domi-
nated by strong, widely spaced spiral cords, sometimes
getting more conspicuous towards umbilicus, crossed
by fine axial threads (Figures 68 and 69). Most axial
threads fade away towards umbilicus, but 10-12 strong
spiral cords continue into it (Figure 69). Umbilicus
open, wide; funiculus narrow, indistinct. Aperture
rounded-oblong, baso-adumbilical region flared.
Selenizone slightly above periphery, keels of moderate
strength.
Radula (Figures 70-75): Rachidian tooth trapezoid,
central cusp largest, 7-8 cusps in straight line on each
side. Lateral teeth 1-3 similar, apical cusp largest, 4-5
cusps along outer edge of tip. Lateral tooth 4 reduced,
hook-shaped. Lateral tooth 5 enlarged, apical cusp larg-
est, 5-6 cusps along inner edge, 3-4 cusps along outer
edge of tip. Inner marginal teeth with oval tip, apical
cusp largest, 6-10 cusps along each side. Outer marginal
teeth with spoon-shaped tip, many fine bristles along
edge. Outermost marginal teeth paddle-shaped, with
many fine bristles along tip. Radular interlock of central
field moderate.
Differential Diagnosis: Anatoma crispata is smaller
than A. schancleri (2.25 vs. 4.5 mm), has more pro-
nounced axial sculpture, has a distinct funiculus, and
the pi otoconch has floeeulent sculpture.
Anatoma aspera is smaller (3.3 vs. 4.5 mm), has a
taller, more turreted shell, and has much stronger axial
sculpture on the shoulder.
Anatoma tenuisculpta grows somewhat larger (5.5 vs.
4.5 mm), has an overall more disc-shaped shell, and the
axial s are stronger with a crenulated appearance due to
the crossing spirals.
Anatoma schioettei is much smaller (2.15 vs. 4.5 mm)
has much more distinct axial s, and the protoconch has
floeeulent sculpture.
T. Heisaeter and D.L. Geiger, 20] 1
Page 107
Figures 63-67. Anatoma ef. schioettei, radula from specimen in Figure 62. 63. Entire radula. Scale bar = 1 mm. 64. Central field
enlarged. Scale bar = 100 pm. 65. Inner marginal teeth. Scale bar — 20 pm. 66. Outer marginal teeth. Scale bar = 10 pm.
67. Outermost marginal teeth. Scale bar = 20 pm.
Type Material: Holotype ZMBN 87296; four
paratypes ZMBN 87297-87298.
Type Locality: The southern margin of the Greenland
Basin (73° 34' N, 7°50'-8°01' E) in the Norwegian Sea,
2560-2580 m. In a sample of semi-lithified sediment.
(PI2Deep ROY sample 7-2008.)
Other Material Examined: A fragment from
II2Deep ROY Dive 1, 2430 nr, near the Schultz Massif,
Figure 68. Anatoma schanderi new species, holotype
(ZMBN 876296), southern margin of the Greenland Basin,
73°34' N, 7°50,-8°01' E, Norwegian Sea, 2560—2580 m, 2.5 mm
diameter. Scale bar protoconch = 200 pm.
73°39' N, 07°47.5' E; 1509-1525 m, off eastern Green-
land, 74° 54' N, 1 2° 30' W (ZMUC, 20); 749-774 m,
Greenland, 75°01' N, 12°38' W (ZMUC, 20); 120 m,
10-15 km NW of Digby Neck, Nova Scotia, Canada,
44°36' N, 65°45' W (JWC 7286, 1).
Etymology: Named after Professor Christoffer
Schander from the University of Bergen, who recognized
the significance of what now are the type specimens
during sorting of material.
Figure 69. Anatoma schanderi new species, off eastern
Greenland, 74°54' N, 12°30' W (ZMUC, 20), 1509-1525 m,
4.4 mm diameter. Scale bar shells = 1 mm; Scale bar
protoconch = 100 pm. Radula shown in Figure 70.
Page 108
THE NAUTILUS, Vol. 125, No. 3
Figures 70-75. Anatoma schanderi new species, radula and operculum from specimen shown in Figure 69. 70. Entire radula.
Scale bar = 1 mm. 71. Central field enlarged. Scale bar = 100 pm. 72. Inner marginal teeth. Scale bar = 20 pm. 73. Outer marginal
teeth. Scale bar = 10 pm. 74. Outermost marginal teeth. Scale bar = 20 pm. 75. Operculum. Scale bar = 1 mm.
79 80 81
Figures 76-81. Anatoma schanderi new species, 76-78. Three paratypes from the southern margin ol the Greenland Basin,
73°34' N, 7o50'-8°0F E, in the Norwegian Sea, 2560-2580 m. 79-81. Three specimens from the slope off East Greenland, ca. 1520
m. Scale bars = 1 mm.
Variability (Figures 70-75): Due to their fragility,
the deep water paratypes are all poorly preserved, but
what remain of the shells indicate that the variability is
slight. Material from most other localities seems to fall
within the range of variation of the type material. Only
the relative strength ol axials and spirals on the base
varies somewhat. The selenizone ol the specimen from
Canada (see below) is wide and with a very narrow keel,
and the shell is also more globular than the rest. It is
impossible to tell if this is of taxonomic importance
however (due to geographical isolation or just individual
variation).
T. H0isaster and D.L. Geiger, 2011
Page 109
82 83
Figures 82-83. Anatoma schanderi, top whorls. 82. Paratype in Figure 76. 83. Specimen from the slope off Eastern Greenland,
ca. 1520 m. Scale bars = 200 pm.
Distribution: Except for the single record from 120
m, Nova Scotia, Canada all material of this species are
from rather deep water (750 to ca. 2600 m) in the Green-
land Sea (the northwestern part ol the Norwegian Sea.)
The record from Canada indicates that the species has a
mainly northwest Atlantic distribution, rather than being
a purely deep water form.
Remarks: The reticulate pattern on the protoconch
would have placed this species, according to the
accepted generic taxonomy, in the genus Thieleella
Bandel, 1998. For the propose ol this revision, we have
decided to include Thieleella as a synonym of Anatoma.
Figures 82-83 shows the uppermost whorls of two shells,
LM photo at left and SEM photo at right. It illustrates
that in spite of the lack of microscopic details in tire LM
photo, it is still possible to recognize some of the most
important distinguishing characters without using SEM
imaging.
Anatoma umbilicata (Jeffreys, 1883)
Scissurella umbilicata Jeffreys, 1883: 88-89, pi. 19, figs. 1-la.
In Hoisaeter (2009) Anatoma cf. umbilicata is listed
representing a specimen from the Norwegian Sea deep
slope just north of the Faroes at 2222 m. The shell was
very deteriorated and not suited for photography. In view
ol the presence of A. schanderi in this general area,
the determination is quite dubious and needs verification.
Anatoma umbilicata is a mostly misidentified species.
For instance, Sabelli et ah, (1990), Gianuzzi-Savelli et al.
(1994), and Adrovini and Cossignani (1999) record
A. crispata and A. umbilicata as the only two species
from the Mediterranean. The latter two references
present respectively good quality SEM images and
photographs, which make clear that both species
were misidentified. We base our species concept of
A. umbilicata on all extant type material examined by
SEM (DLG, unpublished data).
DISCUSSION
After Geiger started looking closer at details on shells
of Anatomidae from various parts of the world (Geiger,
2003; Geiger and Jansen, 2004a, b; Geiger, 2006a; Zelaya
and Geiger, 2007; and Geiger and MacLean, 2010), it
has become increasingly evident that the supposedly
wide ranging A. cristata is a complex of several species.
As demonstrated above, the complex is represented
by three species in inshore Norwegian waters. The nam-
ing of these three species has not been straightforward
though, as a number of early names, subsequently partly
relegated to synonymy, are available for the species.
Anatoma crispata was described from beach drift after
a storm on small Noss Island just outside Lerwick on
Shetland (Jeffreys, 1865: 285). Comparison with spec-
imens from Shetland and our selection of neotypes have
provided convincing arguments for assigning this
name to the smallest of the three Norwegian species.
For one of the remaining two species we have accepted
the previously introduced name of a Pleistoeene/Plio-
cene fossil from southern Italy, and for the last one we
have resurrected the name of another fossil from about
the same deposits.
The allocation of Recent specimens to species previ-
ously known only from the fossil record is always a tricky
matter, and, when as in this case, the number of
recorded specimens from the intervening localities
(between the Mediterranean and Norway) is limited,
this is even more problematic. There are examples in
which extant marine species are known to have survived
morphologically unaltered since the Pleistocene (and
even the Pliocene, i.e., more than two million years).
In Anatomidae, such an example is Anatoma lyra (Berry,
1947) described from the lower Pleistocene of Los
Angeles, California, USA. Its holotype is indistinguish-
able from Recent material at the SEM level, including
live-collected specimens (DLG, unpublished data).
The synonymy of Mediterranean Pleistocene fossils with
Recent North European inshore species represent a spe-
cial case. As the various glacials forced boreal species
living in the fjords of Norway in the warmer interglacials,
to migrate south along the European shelf and slope,
some of them were trapped in the Mediterranean, where
they today are known as Pleistocene fossils. Some, but
not all, succeeded in migrating north again to Norwegian
waters when water temperatures increased, while others
remained in the Mediterranean and evolved into “sister”
species. Which of the fossils are genetically similar
Page 110
THE NAUTILUS, Vol. 125, No. 3
enough to be regarded as conspecific with the forms
today living in Norwegian fjords is an open question,
but as long as there are Recent specimens both in the
Mediterranean and in Noiway, the question might be
settled by molecular genetic investigations. If there is a
continuous distribution of the morphospecies from Nor-
way to the Mediterranean Sea close to the fossil deposits,
this might also be a reasonable justification for accepting
the name of the fossil. Those conditions seem to be met
both with A. aspera and A. tenuisculpta.
Anatoma aspera has been accepted, mostly as a vari-
ety of A. crispata , by most modern authors as a form or
species with a mainly south European distribution. Fur-
ther research might demonstrate that differences
between the Mediterranean and the north European
populations are of a magnitude necessitating specific
separation, in which case the name A. paucicostata
(Jeffreys, 1865) is available. About the same argument
holds for A. tenuisculpta, but in this case no synonym
based on Recent material from the North Atlantic is
available.
Within Anatomidae, recently elevated to full family
rank (Geiger and Jansen, 2004a; Geiger 2006a), three
genera, Anatoma Woodward, 1859, Thieleela Bandel,
1998, and Sasakiconcha Geiger, 2006 have been
accepted by Geiger and collaborators (e.g., Geiger
2006b; Geiger and McLean, 2010; Zelaya and Geiger,
2007) as well as some other authors (e.g., Marshall,
2002). Of these, Anatoma and Thieleella are distin-
guished by a single character, the microsculpture on
the protoconch, invisible except under veiy high magni-
fication (i.e. under SEM). Thus Thielleella is character-
ized by a reticulate pattern, while Anatoma is either
smooth or with flocculent pattern. Of the five species
treated here, A. schanderi has a typical Thieleella reticu-
late pattern, while both A. crispata and A. tenuisculpta
have protoconchs with veiy dense flocculation. Anatoma
schioettei and A. aspera have protoconch microsculpture
somewhat intermediate between these extremes, with
a very open flocculation where some of the flocculae
link together in an irregular reticulation (Figures 22
and 48). For the purpose of this revision we therefore
include Thieleella as a synonym in Anatoma. This is
done mainly for practical reasons, as specimens studied
only by LM or specimens with worn protoconchs are
impossible to place in the correct genus il the Anatoma/
Thielleella dichotomy is retained.
The species of Anatoma all seem to occupy specific
microhabitats although they often occur together
in sledge or dredge hauls. Thus two of the inshore
species co-occur in several samples and all three
inshore species have been found together (alive) in two
of our samples from western Noiway. Anatoma crispata
is found all around the Norwegian coast (and beyond),
in depths from 10 to at least 200 m inshore (at least to
1000 m on the upper slope), and in temperatures from
+ 12°C to -1.4°C. It appears to be associated with
clean, hard bottom habitats and is often (in Noiwegian
waters) accompanied by species such as Gibbula
tumida (Montagu, 1803), Margarites striata (Leach,
1819), Lacuna vincta (Montagu, 1803), and Pusillina
inconspicua (Alder, 1844).
Anatoma aspera is found occasionally in waters not
deeper than 40 nr, it has its main distribution in depths
between 60-100 m, but with records also from dredge
hauls taken from 260 to 180 m. The conspicuous break
between 64°40/ N and 69° N in the otherwise largely
continuous distribution along the coast may provide
support for the theory that A. aspera is mainly a southern
species, having invaded the Noiwegian coast at around
63° N and from there spread northward and southward.
The shells (not in very well preserved condition, Fig-
ures 30 and 33) found at 69° 14' N at the considerable
depth of 370 m, might be remnants of a separate invasion
farther into the north. Anatoma aspera is (in Norwegian
waters) most often found in, or near hypoxic, blackish
mud, and is often found accompanied by Puncturella
noachina (Linne, 1771), Melanella lubrica (Monterosato,
1890), Trophonopsis barvicensis (Johnston, 1825), and
several pyramidellids, especially Chrysallida eximia
(Jeffreys, 1849).
Anatoma tenuisculpta is the inshore Noiwegian spe-
cies living deepest, being usually found between 150-
300 m, but with occasional records from 50 m and as
deep as 500 m. This seems to agree with the known
distribution (based on scattered museum material) along
the lower shelf/upper continental slope of the northeast
Atlantic, from the Faroes south to Gibraltar. Anatoma
tenuisculpta is (in Norwegian waters) most commonly
found on mixed bottoms often with some shells of
Modiolula phaseolina, silt and shell gravel. Common
accompanying gastropods are Trophonopsis barvicensis
(Johnston, 1825), Teretia teres (Reeve, 1844), Spirotropis
modiolus (de Cristofori and Jan, 1832) and (in the M0re
og Romsdal part of the distribution) Solariella amabilis
(Jeffreys, 1865).
Except for its part-time association with hot vent
habitats, A. schioettei seems to be most common in
upper slope habitats in the western part of the Noiwe-
gian Sea, at depths of 200-800 m. The bottom substrate
is presumably silt or ooze, and the temperature is proba-
bly fluctuating between positive and negative values. The
only Anatomidae known from hot vents in the Noiwe-
gian Sea most likely belong to this species as well.
Anatoma schanderi has (with a single exception, see
above) so far only been found in the bathyal parts of the
Norwegian Sea, from 1500-2600 m, where the bottom
substrate may be semi-Iithified and the temperature is
constant at — 0.9°C.
The conclusion in Geiger and Sasaki (2009) that no
members of Scissurellidae occur in these northern lati-
tudes, neither in shallow nor in deep water, is supported
by this revision. The five species of Anatoma are, on the
other hand, nicely distributed on various depth zones so
that the whole depth spectrum seems to be occupied
by this family of gastropods.
The large majority of museum-material from south of
62° N in Norway belong to A. tenuisculpta. This may be
T. H0isaeter and D.L. Geiger, 2011
Page 111
partly because this species is appreciably larger than
the other two species, especially A. crispata , but we
regard it as unlikely that this should be the only reason.
Thus we conclude that this species is (or has been) the
main representative of the genus in western Noway,
becoming gradually less common further north along
the coast. It is not known from the Norwegian south
coast or the Swedish west coast (A. Waren, pers. comm.).
(A notable exception is the occurrence of A. tenuisculpta
at Dr0bak in Oslofjorden).
ACKNOWLEDGMENTS
We would like to thank the following for providing
material; Anders Waren, Jon-Arne Sneli, Jon Kongsrud,
Christoffer Schander, Per Bie Wikander, Mans Tore
Rapp (H2Deep), Mareano, Tom Schiotte (ZMUC), Ole
Tendal (ZMUC), Katie Way and Andreia Salvador
(NHMUK), Anita Eschner (NHMW), Sankuie Pye
(NMSZ), and Angelika Brandt (ZMH).
LITERATURE CITED
Anistratenko, V.v. and Y. I. Starobogatov. 1997. Which species
of Scissurella (Gastropoda: Pleurotomariiformes) inhabits
the Black Sea? Vestnik Zoologii 31: 75-77.
Ardovini, R. and T. Cossignani. 2004. West African Seashells
(including Azores, Madeira and Canary Is.). L’Informatore
Piceno, Ancona, 319pp.
Barrier P, 1987. Stratigraphie des depots pliocenes et
quaternaires du Detroit de Messine. Documents et
Travaux de 1'IGAL, 11, 59-81.
Bouchet. P. and A. Waren. 1979. The abyssal molluscan fauna
of the Norwegian Sea and its relation to other faunas.
Sarsia 64: 211-243.
Brogger, W. C. 1901. Om de Senglaciale og Postglaciale
Nivaforandringer i Kristianiafeltet (Mollusk Faunaen).
Norges Geologiske Undersogelse 31: 1-732, 19 pis.
Dautzenberg, P. 1927. Mollusques provenant des campagnes
scientifiques de Prince Albert ler de Monaco dans 1’Oeean
Atlantique et dans le Golfe de Gascogne. Resultats des
Campagnes Scientifiques du Prince de Monaco 72, 400 pp.
Dautzenberg, P. and H. Fischer. 1912. Mollusques provenant
des campagnes de I’Hirondelle et par la Princesse-Alice
dans les Mers du Nord. Resultats des Campagnes
Scientifiques du Prince de Monaco 37, 629 pp., 11 pis.
Fleming, J. 1828. Remarks on the genus Scissurella of
M. d'Orbigny, with a description of a Recent British spe-
cies. Memoirs of the Wernerian Natural History Society
6: 384-387.
Forbes, E. and S. Hanley 1853. A History of British Mollusea
and their Shells. Vol. 2. John van Voorst, London, 557
pp., 133 pis.
Fretter, V. and A. Graham. 1976. The prosobranch molluscs
of Britain and Denmark. Part 1-Pleurotomariacea,
Fissurellacaea and Patellaeea. Journal of Molluscan Stud-
ies, Supplement 1: 1-37.
Friele, H. 1874. Oversigt over de i Bergens omegn
forekommende skaldaekte Mollusker. Christiania
Videnskabs-Selskaps Forhandlinger 1873: 1-24.
Friele, H. 1877. Tungebevaebningen hos de norske Rhipidoglossa.
Arehiv for Mathematik og Naturvidenskab 2: 199-217.
Friele, H. and J. Grieg 1901. Mollusea III. -The Norwegian
North -Atlantic Expedition, 1876-1878 7(5):1-129.
Friele, H. 1903. Mollusken der ersten Nordmeerfahrt des
Fisehereidampfers “Michael Sars" 1900 under Leitung
von Herrn Dr. Johan Hjort. Bergens Museums Aarbog
3: 1-18, pis. 1-4.
Geiger, D.L. 2003. Phylogenetic assessment of characters
proposed for the generic classification of Recent
Seissurellidae (Gastropoda: Vetigastropoda) with a descrip-
tion of one new genus and six new species from Easter
Island and Australia. Molluscan Research 23: 21-83.
Geiger, D.L. 2006a. Eight new species of Seissurellidae and
Anatomidae (Mollusea: Gastropoda: Vetigastropoda) from
around the world, with discussion of two new senior syno-
nyms. Zootaxa 1128: 1-33.
Geiger, D.L. 2006b. Sasakiconcha elegantissima new genus
and species (Gastropoda: Vetigastropoda: Anatomidae?)
with disjointly coiled base. The Nautilus 120: 45-51.
Geiger, D.L. and P. Jansen. 2004a. Revision ol the Australian
species of Anatomidae (Gastropoda: Vetigastropoda).
Zootaxa 435: 1—35.
Geiger, D.L. and P. Jansen. 2004b. New species of Australian
Seissurellidae (Mollusea: Gastropoda: Vetigastropoda)
with remarks on Australian and Indo-Malayan species.
Zootaxa 714: 1-72.
Geiger, D.L. and J.H. McLean. 2010. New species and records
of Seissurellidae and Anatomidae from the Americas
(Mollusea: Gastropoda: Vetigastropoda). Zootaxa 2356: 1-35.
Geiger, D.L. and T. Sasaki. 2009. New Seissurellidae and
Anatomidae from Manazuru, Sagami Bay, and Okinawa,
Japan (Mollusea: Gastropoda: Vetigastropoda). Molluscan
Research 29: 1-16.
Geiger, D.L. and C.E. Thacker. 2005. Molecular phylogeny of
Vetigastropoda reveals non-monophyletie Seissurellidae,
Trochoidea, and Fissurelloidea. Molluscan Research
25: 47-55.
Geiger, D.L., B.A. Marshall, W. F. Ponder, T. Sasaki, and
A. Waren. 2007. Techniques for collecting, handling, and
preparing small molluscan specimens. Molluscan
Research 27: 1-50.
Giannuzzi-Savelli, R., F. Pusateri, A. Palmeri, and C. Ebreo.
1994. Atlas of Mediterranean Sea Shells, Volume 1.
La Conchiglia, Rome, 125 pp.
Graham, A. 1988. Molluscs: Prosobranch and Pyramidellid Gas-
tropods (Second Edition). Linnean Society, London, 662pp.
Grieg J. 1914. Bidrag til kundskapen om Hardangerfjordens
fauna. Bergens Museums Aarbok 1913 (1): 1-147.
Hansson, II. G. 2003. Faktablad: Anatoma crispata. ArtDatabanken
2003-09-10. www.tmbl.gu.se/pdi7Artfaktablad/Artf%20Anato
ma%20crispata.pdi
Hidalgo, J.G. 1867. Catalogue des Mollusques testaces marins
des cotes de l’Espagne et des lies Baleares. Journal de
Conchyliologie 15: 1-163, pi. 12.
1 loisaeter, T. 1986. An annotated check-list of marine molluscs
of the Norwegian coast and adjacent waters. Sarsia
71: 73-145.
Hoisseter, T. 2009. Distribution of marine, benthic, shell
bearing gastropods along the Norwegian coast. Fauna
Norvegiea 28: 5-106.
Hoisaeter, T. 2010. The shell-bearing, benthic gastropods
on the southern part of the continental slope off Noiway.
Journal of Molluscan Studies 76: 234-244.
Page ] 12
THE NAUTILUS, Vol. 125, No. 3
Hubendick, B. and A. Waren. 1974. Smasnackor fran svenska
vastkusten 6. Slaktena Emarginula, Lacuna, Natica,
Philbertia, Lora m. fl. Arstryck Goteborgs Naturhistoriska
Museum 1974: 25-32.
Jeffreys, J.G. 1865. British Conehology or an Account of the
Mollusca which now Inhabit the British Isles and the
Surrounding Seas. Vol. III. John Van Voorst, London, 393
pp., 8 pis.
Jeffreys, J.G. 1870. Norwegian Mollusca. Annals and Magazine
of Natural History (4)5: 438-448.
Jeffreys, J.G. 1877. New and peculiar Mollusca of the
Patellidae and other families of Gastropoda procured in
the 'Valorous' Expedition. Annals and Magazine of Natu-
ral History (4)19: 231-243.
Jeffreys, J.G. 1883. On the Mollusca procured during the
Lightning’ and Porcupine’ Expeditions, 1868-70. Part
VI. Proceedings of the Scientific Meetings of the Zoologi-
cal Society' of London for the year 1883: 88-115.
Locard, A. 1899. Les Coquilles Marines an Large des Cotes
de France. J.-B. Bailliere et fils, Paris, 198 pp.
Loven, S. 1846. Index Molluscorum Litorae Scandinaviae
Oceidentalia Habitantium. Norstedt, Holmiae, 50 pp.
Lozouet, P. 1986. Les Gastropods Prosobranches de l'Oligo-
cene superieur du Bassin de l’Adour (Systematique,
Paleoenvironnements, Paleoelimatologie, Paleobio-
geographie). Diploma Thesis, Eeole Pratique des
flautes Etudes, Paris, 475 pp., 34 pis.
Marshall, B.A. 2002. Some Recent scissurellids form the
New Zealand region, and remarks on some scissurellid
genus group names (Mollusca: Gastropoda). Molluscan
Research 22: 165-181.
McLean, J.H. 1967. West American Seissurellidae. The Veliger
9: 404-410.
McLean, J.H. 1989. New slit-limpets (Scissurellacea and
Fissurellaeea) from hydrothermal vents. Part 1. Sys-
tematic description and comparison based on shell
and radular characters. Contributions in Science of
the Los Angeles County Museum of Natural History
407: 1-29.
Monterosato, T. di. 1884. Nomenclatura generiea e specifica di
alcune Conehiglie Mediterranee. Virzi, Palermo, 152 pp.
Monterosato, T. di. 1890. Conehiglie della profundita del
mare di Palermo. Naturalista Siciliano, Palermo, 9:
140-151.
Munier Chalmas, E. 1862. Description dune nouvelle
Scissurella, suivie de la liste monographique des especes
eonnues de ee genre. Journal de Conchyliologie 10:
391-397.
Norman, A.M. 1879. The Mollusca of the fiords near Bergen,
Norway. Journal of Conehology 2: 8-77.
Norman, A.M. 1888. Museum Normanianum, or A Catalogue
of the Invertebrata of Eruope and the Arctic and North
Atlantic Oceans, which are contained in the collection
of the Rev. Canon A. M. Norman, M.A., D.C.L., F.L.S.
IV. Mollusca Marina. V. Brachiopoda. Privately Published,
Durham. 30 pp.
Norman, A.M. 1893. A month on the Trondhjem Fiord. Annals
and Magazine of Natural History Series 6, 12: 341-367, pi. 16.
Norman, A.M. 1902. Notes on the natural history of East
Finmark (Mollusca). Annals and Magazine of Natural
History Series 7, 10: 341-361.
Odhner, N.H. 1912. Northern and Arctic invertebrates in
the collection of tire Swedish State Museum. V.
Prosobranchia. 1. Diotoeardia. Kungliga Svenska
Vetenskapsakademiens Handlingar 48: 3-92, pis 1-7.
Odhner, N.H. 1960. Mollusca. Reports of the Swedish Deep-
Sea Expedition 2: 367—400, pis 1-2.
Philippi, R.A. 1844. Enumeratio Molluscorum Siciliae. Vol. 2.
Halle, 303 pp.
Powell, A.W.B. 1979. New Zealand Mollusca. Marine, Land
and Freshwater Shells. Collins, Auckland, 500 pp.
Sabelli, B., R. Giannuzzi-Savelli, and D. Bedulli. 1990. Annoted
Check- List of Mediterranean Marine Mollusks, Volume 1.
Libreria Naturalistiea Bolognese, Bologna. 348 pp.
Sasaki, T., D.L. Geiger and T. Okutani 2010. A new species of
Anatoma (Vetigastropoda: Anatomidae) from a hydrother-
mal vent field in Myojin Knoll Caldera, Izo-Ogaswara Arc,
Japan. The Veliger 51: 63-75.
Sars, G.O. 1878. Bidrag til Kundskaben onr Noreges Arktiske
fauna I. Mollusca Regionis Arctricae Norvegiae. Christia-
nia, Bregger. 466 pp., 52 pis.
Schiro, G. 1986. Seissurellidae viventi nel Mediterraneo. La
Conchiglia 18(204-205): 22-23.
Schneider, J.S. 1886. Undersogelser af dyrelivet i de
arktiske fjorde. III. Troms0sundets molluskfauna. Tronrs0
Museums Aarshefter 8: 45-112.
Seguenza, G. 1877. La Formazioni Terziarie nella Provineia di
Reggio (Calabria). Reale Aecademia Dei Lincei, Serie 3a-
Memorie della Classe di seienze fisiche, matematiehe e
naturali 6: 416 pp., pis 1-17.
Smith, S.M. and D. Heppell. 1991. Checklist of British marine
Mollusca. National Museums ol Scotland Information
Series 11: 1-114.
Soot-Ryen, T. 1924. Faunistische Untersuehungen im
Ramfjorde. Troms0 Museums Arshefter 45: 5-106, 5
maps, tables.
Tunnell, J.W. Jr., ). Andrews, N.C. Barrera, and F. Moretzsohn.
2010. Encyclopedia of Texas Seashells: Identification,
Ecology, Distribution, and History. Texas A&M University
Press, College Station, 512 pp.
Vazzana, A. 1996. Malacofauna batiale del Pleistocene
Inferiore del Vallone Catrica (Reggio Calabria, Italia).
Bolletino Malacologico 31: 143-162.
Verkriizen, T.A. 1875. Bericht iiber einen Schabeausflug im
Sommer 1874. Jahrbueher der Deutschen Malakozoo-
logischen Gesellschaft 8: 82-100.
Waren, A. 1980. Marine Mollusca described by John Gwyn
Jeffreys, with the location of the type material. Concho-
logical Society' of Great Britain and Ireland, Special Pub-
lication 1: 1-60, pis 1-8.
Weinkauff, H.C. 1862. Catalogue des coquilles marines
recueillies sur les cotes de l’Algerie. Journal de
Conchyliologie 10: 301-371.
Zelaya, D.G. and D.L. Geiger. 2007. Species of Seissurellidae
and Anatomidae from sub-antarctic and antarctic waters
(Gastropoda: Vetigastropoda). Malacologia 49: 393-443.
THE NAUTILUS 125(3): 1 13-126, 201 I
Page 113
A new species of Praticolella (Gastropoda: Polygyridae) from
northeastern Mexico and revision of several species of this genus
Kathryn E. Perez
Department of Biology
University of Wisconsin at La Crosse
La Crosse, WI 54601 USA
[email protected]
ABSTRACT
A new species of polygyrid land snail of the genus Praticolella
from northeastern Mexico is described. This species has
established invasive populations in the United States and
Caribbean and has been confused with P. griseola and
P. berlandieriana. The new Praticolella species is similar to
P. griseola , but differs in being larger, having a more robust,
depressed shell with white pigmentation, a flattened wide body
whorl, and a more oval-shaped aperture. The range of these
two species does not appear to overlap with P. berlandieriana ,
which is restricted to central, north, and east Texas. These two
species are also circumscribed and their taxonomic history is
reviewed. This new taxonomy was established using mitochon-
drial 16S rDNA and cytochrome e oxidase subunit-I sequences
as well as geometric morphometric examination ot the shells ot
each species.
Additional keywords: Mollusca, Invasive species, snail, mito-
chondrial DNA analysis, mitochondrial 16S rDNA, cytochrome
e oxidase, geometric morphometric analysis
INTRODUCTION
Praticolella von Martens, 1892 is a genus of polygyrid
land snails found throughout the southeastern United
States (USA), Mexico, and South to Central America
(Pilsbry, 1940). Praticolella is currently composed of 15
recognized species (Pilsbry, 1940; Hubrieht, 1984), nine
of which are species of conservation concern having
global heritage ranks of Gl, G2, or G3, indicating they
are considered critically imperiled, imperiled, or vulner-
able (Master, 1991; NatureServe, 2005). This paper aims
to distinguish among several morphologically similar
species of land snail in the genus Praticolella .
Species in Praticolella possess highly variable mor-
phological characteristics often used in their taxonomy:
the openness of the umbilicus; degree of depression
of the spire; and the pattern of pigmented bands on
the shells. This has led to disagreements about taxonomy
of species in the genus (von Martens, 1890-1901;
Singley, 1893; Pilsbry, 1940; Cheatum and Fullington,
1971; Neck, 1977; Hubrieht, 1984). The last taxonomic
revision of the United States species was by Pilsbry
(1940) but excluded the five nominal Mexican taxa; these
Mexican taxa were last revised by von Martens (1890-
1901).
Praticolella griseola (Pfeiffer, 1841) is the only mem-
ber of the genus currently considered to be introduced
or invasive in the United States (USA) (Dundee, 1974;
Robinson, 1999). Individuals identified as P. griseola
have been recorded in the southeastern USA and the
Caribbean since the 1920s. In addition, the United
States Department of Agriculture (USDA) routinely
intercepts P griseola traveling with shipping trade.
This paper provides the means to distinguish several
morphologically similar species of Praticolella , at least
two of which regularly travel with shipments of fruit and
greenhouse plants. The data presented here will make
evident that other Praticolella species also need taxo-
nomic attention, but this paper focuses on P. griseola
and the species which must be considered to sort out
the taxonomy of the invasive Praticolella species. These
include: P. griseola , P. berlandieriana (Moricand, 1833),
and P. strebeliana (Pilsbiy, 1899). In this study, I use 16S
rDNA (16S) and cytochrome c oxidase subunit I (COI)
mitochondrial DNA and shell geometric morphometric
analysis to provide the basic taxonomic and phyloge-
netic information necessary for taxonomy, conservation,
and management of these invasive mollusks and native
congeners.
MATERIALS AND METHODS
Table 1 lists specimens examined for DNA analysis, col-
lection sites, latitude and longitude, and museum acces-
sion numbers of all specimens (also shown in Figure 1).
Specimens examined in this study are deposited in the
Academy of Natural Sciences of Philadelphia. Additional
specimens for morphometric analysis (also listed in
Table 1) were borrowed from the Florida Museum ol
Natural History, Gainesville; American Museum of Nat-
ural Histoiy, NewYork; Museum d'Histoire Naturelle,
Geneva; and Field Museum of Natural Histoiy, Chicago.
Page ] 14 THE NAUTILUS, Vol. 125, No. 3
Table 1 . I joeality information and museum number for specimens sequenced for DNA analysis followed by locality information
and museum number for additional lots included in morphometric analysis. In these additional lots all adult, complete shells were
photographed and included in morphometric analysis. ANSP numbers beginning with “A” represent lots preserved in alcohol.
Latitude and Longitude presented in decimal degrees.
from Guadalupe Canoeing 9 km N
New Braunfels, Comal Co. TX
“Habite le Mexique, dans la province MHNG 37027
de Texas.”
( Continued )
Figure 1. Map of specimens used for DNA analysis and
additional localities of specimens used for morphometric
analysis.
Individual sequences are available on Genbank, 16S:
DQ085935-DQ086020, COI: DQ086021-DQ086095.
Outgroups were included from other members of the
Polygyrini (Emberton, 1995), specifically, Polygyra
cereolus (Miihlfeld, 1816) and Polygyra septemvolva
(Say, 1818).
Molecular Data Analysis: Total genomic DNA was
extracted from several milligrams of tissue digested with
CTAB lysis buffer and purified through standard phenol-
chloroform procedures (Palumbi et al., 1991). Degenerate
primers (5' - YR M CTGTTTAWC AAAAAC AK-3' and 5'-
CCGGTCTGAATCC AGATCAB GT-3' ) were designed
from the Palumbi et al. (1991) primer pair and Genbank
sequences that amplified a ~450 bp fragment of the mito-
chondrial 16S gene. The Folmer et al. (1994) primers
were used to amplify a ~600 bp fragment of the mito-
chondrial cytochrome oxidase c subunit I gene (COI)
gene. Fragments were amplified by PCR, purified
through gel extraction, and sequenced using BigDye 3. 1
chemistry on an ABI 3100 automatic genetic analyzer.
Specific protocols for amplification and sequencing can
be found in Perez et al. (2005).
Sequences were assembled in Sequencher™ 4.0.5
(Gene Codes Corporation, Ann Arbor, MI) or Geneious
Pro 3.5.6 (Drummond et al., 2006) and aligned in Muscle
(Edgar, 2004). Garli 0.951 (Zwickl, 2006) was used to
carry out maximum likelihood (ML) estimation of rela-
tionships. The ML analysis was carried out using Garli s
default settings, as was an additional 100 replicate boot-
strap analysis.
Shell Morphometric Analysis: In total, 237 spec-
imens representing the following five species were exam-
ined: P. berlandieriana (46 specimens), “P. g riseola"
Cameron County (32), P. gri.seola (68), Praticolella new
species (described below) (85), P. strebeliana (5) (Speci-
mens used for DNA are listed in Table 1). We had diffi-
culty in identifying to species specimens without living
tissue for sequencing (shell-only specimens). Therefore,
only a limited number of individuals from museum col-
lections could be used for morphometric analysis, in
addition to the individuals for which we gathered
sequence data for morphometric analysis; this number
mostly includes additional individuals or shell-only
collections from the same locality as individuals with
sequenced DNA. Color images were captured with a
tripod-mounted. Canon PowerShot S3IS digital camera.
Twenty-five landmarks (Figure 2) were digitized using
tpsDig 1.31 (Rohlf, 2001).
Geometric morphometries analyses were carried out
using the Integrated Morphometries Package, this
includes the programs CoordGen, PCAGen, CVAGen,
TwoGroup, and Regress 6 listed below (IMP software
suite; Sheets, 2003) were used to examine shape varia-
tion through principal component analysis (PCA) and
canonical variance analysis (CVA). PCA is a technique
for simplifying descriptions of variation among individ-
uals, while CVA simplifies descriptions of differences
between pre-determined groups (Zelditeh et al., 2004).
In traditional morphometric analysis, PCA generally suf-
fers from the overwhelming influence of size across the
newly generated axes. However, geometric morphomet-
ric analysis eliminates size as a factor, yielding examina-
tions of shape solely. In PCA, no a priori assumptions
are needed to group individuals. In contrast, CVA
determines the set of axes that best discriminates
between groups; therefore an a priori assumption
of group membership is necessary. For CVA analysis,
Page 116
THE NAUTILUS, Vol. 125, No. 3
Figure 2. Praticolella mexicana individual (#436) from 15 km
SW of Linares, Nuevo Leon, (ANSP 426031) Mexico showing
landmarks used in the morphometric analysis. This individual
used in both DNA and morphometric analyses.
individuals were grouped according to the clades identi-
fied by the molecular analysis.
Landmark coordinates were imported into CoordGenGl
and converted to Procrustes distances using least squares
Procrustes superimposition methods. A MANOVA carried
out in SYSTAT 8.0 was used to examine differences
in shape between species. Pairwise comparisons between
all populations were performed in TwoGroup6c with
Bonferroni correction to determine if there were sig-
nificant shape differences. A PCA was performed with
PCAGenGg on die data with a posteriori groups assigned
by locality. A CVA was also performed using CVAGen6h
with groups defined by the clades from the DNA analysis.
The difference in shape between each species was exam-
ined di rectiy using Regress6.
Abbreviations and Text Conventions: MHNG =
Museum d’Histoire Naturelle, Geneva; LMNH = Lield
Museum of Natural History; ANSP = Academy of Natu-
ral Sciences of Philadelphia (ANSP numbers beginning
with “A” represent lots preserved in alcohol); USDA =
United States Department of Agriculture; GM = geo-
metric morphometric analysis; PCA = principal com-
ponent analysis; MANOVA= multivariate analysis of
variance. Latitude and Longitude presented in decimal
degrees.
RESULTS
Molecular Phylogeny: Maximum likelihood analysis
of 417 bp of 16S and 493 bp of COI yielded a single tree
(Ligure 3). Praticolella new species (to be described
below) comprised a well-supported monophyletic elade.
Many individuals included in this clade were initially
identified as P. berlanclieriana due to their geographic
location in northeastern Mexico. Some individuals in this
clade were from invasive populations (Bahamas and
Llorida) or United States Department of Agriculture
(USDA) interceptions and were initially identified as
P. griseola, which is well known as invasive. The DNA
tree also shows monophyletic lineages from both near
Victoria, Tamaulipas, and near Mante, Tamaulipas.
These are herein considered part of Praticolella new
species , but further work is needed to examine popula-
tion level versus species level differences among these
lineages.
Individuals conforming to the moiphology of P. griseola,
including topotypic material, form a clade (100% boot-
strap support; labeled P. griseola on Ligure 3) that has
deep subdivisions between different populations in
the mitochondrial DNA and includes an individual from
an invasive population in Lake County, Florida. The
P. griseola clade is resolved as sister (75% bootstrap
support) to a monophyletic group ol individuals from Soto
la Marina, Tamaulipas. Individuals from a small, morphol-
ogically unique, disjunct population of P. griseola were
sampled in this study and are called here: “P. griseola ”
Cameron Co. (Pilsbry, 1940; Rehder, 1966). This popula-
tion formed a distinct clade separate from P. griseola , but
due to poor support in tins portion of the tree, relation-
ships remain uncertain.
Individuals from as close to the type locality of
P. berlanclieriana as could be determined (details below,
within 30 km) form a clade sister to other Texas
Praticolella species (84% bootstrap), including individ-
uals of P. trimatris Hubrieht, 1983, P. pachyloma (Menke
in Pfeiffer, 1847) and P. taeniata Pilsbry, 1940.
Shell Morphometric Analysis: Differences in shell
shape in Praticolella were assessed using GM (Figure 3).
Shell variation is traditionally quantified through
straight-line shell measurements and ratios and used to
distinguish between individuals and populations at the
species level (e.g., Heller et ah, 2005; Tanaka and M aia,
2006). Recently, GM has been employed in examinations
of snail shells, both to provide direct size-free analyses of
shell shape and to answer broader evolutionary questions
(Pfenninger and Magnin, 2001; Conde-Padin et ah,
2007; Hayes et ah, 2007).
The first PCA axis (PCI) explained 31.5% of the vari-
ation, the second (PC2) explained 15.3%, and the third
(PC3), 13.1%. A MANOVA on the PCA scores found a
significant difference among groups ( Hotelling- Lawley
Trace =2. 01 2, F-Statistic=30.669, df=15, 686, p<0.000).
Pair-wise comparisons of all species assessed by
Goodall’s F test showed that snails from each species
had significantly different (p<0.01) shapes.
Each species was compared pairwise using TwoGroup
to carry out Goodall’s F-test. Pairwise comparisons were
followed by a Bonferroni correction. This analysis found
that each of the species’ means are significantly different
(p<0.001 in all cases). The lectotypes (ANSP 411457 and
77128) of Praticolella strebeliana are distinct on the first
three PC axes (Figure 4) with the highest difference in
mean value from the other species (Distance in mean
value from P. griseola= 0.0967; P. berlanclieriana = 0.0916;
K. E. Perez, 201 1
Page 1 1 7
W
P 8®eamTarccoC t55
,.r P. fejKtscsSIcmNPcEarfe, IC4t?
1 — P fe?seBB?iraKPipenta\«4tr
R flavescens
1ST
■ P. foKMTO? ten S Tanqpxhe. VC 420
• P. feexsm Tarpon. C 154
•56
100
10D
r P. JueflR TMP *34
; P jnSeOES J mfKZ. TW3 133
• P yss&is vtsmz. VC 435’
64
99
75
f— R aim’s Veras®. VC 43ff
1 P <r3«& ft Versa®. VC 4? 1
* **■*$»!«* VC «8
W1 RgwH&Tste NL«9
P psesG 9 km N Papsrria, VC 415
— P griseeis like Go, FI 38?
P. grisaola
100
R sp.t9kre ESafe la Msma«6
P. sp. 12 km E. Set 'a Mima 405
P.sp 1 5 km E. Set Is Mima 454
P. sp. 19 km £. Set a Mima 455
” P. so 19 fen E Son ds b Mirra 32£
P sp. 19 km £ Soto da a Mima 453
ICO
94
66
66
P. matim .
P 005S®S3
P moats Arafeuie. Mi 4 19
R mteara Quite. ML 325
P. metcaes USOA-Owi’tM Rap;Mc 1394
P mkara BaJ.Gnrd tersr ip
r- P .wit ana ftil Sara Capsn I3fe
'74 - p menasa USOA-Otmnjan Sarsist 1 38:
P micas USQMknirian RepMc 1392
P msassBel. GratCama* 1397
P. rxnxm fkk Srsad Ceptn 1400
P. msa» Hal. Grans Capa* 14CS
P nai USOMOawian Rapte 13®
P. mema Hal. Grand Caraae t#2
P .i*»s*b HeB. Grate Capias ‘401
*— P. meiians 2 la M Ajua Sura, SIP 259
P. maneam 3.wSr San P.idrgs, COM4 241
R mataas 2 ten M Jtes Sam. St? M
P ".aocaiaySOA-DenrscanSafofcfe 133$
R Jis«csf» IIitK Ajpa Baani &P 292
R memsa USOft-fesa 1311
P. mss5*0iaite,Nl3S5
P. sraheass 2«'ia, 1*1 356
P. weom 15 tea Sil of Imres. H IS*
■ P. memia iftfetep. TX 133
5 c mewara 2 km M Ajui Sura St? 371
• Pi^a»s3myS04-P»|!asso,TX31
P mtaeta Sat Rafael V€ €7
P ssmm 2 km N km Bsm SLPM
r P. sp. 5 km E C'adamfciB. Hi5 245
} ?. sp 5 fas E € feshd Visor a. TUP 244
P.sp. 5 ten £ Cuial \5cfetia. IMP 2§
.. liteM Mates. TM> 323
' 20 ton N Minx .TVP4K
lit X Marie. 7WP 141
P. mexicana
99
-PtteeKSlCS
■P (safes 458
•P.irrritB 12?
Psp.Tmm,Sl?321
P. trimatris
W
93
52
I 'PpKsk’CatBioOrTX 1# _
1 r V gssestf CaiwaCo. TX 14J P gnseola Cameron Co.
’• *- *p, .Iran’ Sens® C* IX 153
R^H«yjiCo.Tx4S
64
109
92
• P. taaisa 2 ter S Sar< FsrateB TVP 132
r P. ip. Riwtrdiia , TX 15!
Rpa^feaiRapitei^TX 14*
— P i*ria«faaa12fknS£8toTt4f?
• P ksfeteeat 9 fan M Ste* Sourfeis TX 43?
5 kfat&mm 5 fan fs Braisieis TX 433'
eo
103?
8?P P.sp. Cans Pm}, IX 311
P. S3 Cirp P*ry. TX 153
Rr P. ante 5 kn S E Ttea ’J.hs IX 422
9e- r uiclte 5 kn RE Tre? Risers tl 42'
Pa. 2 te S S» Fenarte: . IMP 131
P. berlandtenana
South Texas Clade
HTp tei*2ta SSaFenaife TVF 253
6&’ P S»ijj}2 kt S Sn F«mt TMP257
75\
66
Figure 3. Molecular phylogeny of Praticolella. Maximum likelihood phylogram based on 16S and COI mitochondrial DNA.
The species discussed in this paper are marked by grey boxes. Numbers on branches are ML bootstrap values. Outgroups not
shown.
Page 118
THE NAUTILUS, Vol. 125, No. 3
-o.l -0.05 0 0.05 0.1 -0.07 -0.02 0.03 0.08
Figure 4. Principal component axes 1, 2, and 3. Percentages indicate the percent of the variance explained by each axis. Large
symbols represent group means: Praticolella mexicana (•); P. berlandieriana (0); P. griseola (□); “P. griseola” Cameron Co (A)
P. strebeliana (+).
-0.01 0 0.01 -0.01 0.00
Figure 5. Canonical axes 1, 2, and 3. Discriminant scores calculated to maximally separate the tive species. Left: the first and
second canonical axes. Right: the second and third canonical axes. Large symbols represent group centroid. Praticolella mexicana (•);
P. berlandieriana (0); P. griseola (□); "P. griseola” Cameron Co (A) P. strebeliana (+).
Praticolella new species =0.0723). Although the species
are significantly different, visual examination of Figure 4
shows there is a great deal of overlap in the shape
variation present in each species. Praticolella new spe-
cies is the most distinct in shape (Distance in mean
value from P. griseola =0.0448; P. berlandieriana =0.0590;
P. strebeliana =0.07 23), but Praticolella new species,
P. griseola and P. berlandieriana also have a great deal
of overlap in shape (Figure 4; Distance in mean
value=0.0518). CVA of each population yielded four
distinct axes (p< 0.05) where all centroids were sig-
nificantly different from each other (Figure 5). The
resulting plot of CV 1 and CV 2 shows very little overlap
among species, although a few individuals of P. griseola
(three of 64) overlap into the new species’ shape space.
One individual of Praticolella new species grouped with
P. griseola. The plot of CV2 and CV 3 widely separate
P. strebeliana and P. griseola from the other species.
Finally, “P. griseola” Cameron Co. is significantly differ-
ent from the other species and distinct from P. griseola
and Praticolella new species in all analyses. Figure 6
shows how shell shape differs from Praticolella new
K.E. Perez, 2011
Page 119
Figure 6. Change in shell shape between species. Lett: Shape change to P. berlandieriana from P. mexicana. Right: shape change
to P. griseola from P. mexicana. Shape change is exaggerated 3X by vector arrows to ease interpretation.
species to P. berlandieriana and (left) and from
Praticolella new species to P. griseola (right).
SYSTEMATICS
Family Polygyridae Pilsbry, 1930
Genus Praticolella von Martens, 1892
Dorcasia Binney, 1878: 356.
Praticola Strebel and Pfeiffer, 1880: 38.
Praticolella von Martens, 1892: 138.
Type Species: Praticolella ampla (Pfeiffer, 1866), by
original designation.
Diagnosis: Shell small, globose to slightly depressed
with a conic spire of 4.5 to 5.75 whorls. Aperture either
slightly or greatly reflected and without denticles. Nar-
rowly umbilieate (Pilsbry, 1940). Penial diverticulum
long and at least twice the volume of the penis
(Emberton, 1995). Bifurcate or trifurcate penial retrac-
tor muscle (Emberton, 1995).
Distribution: United States: Florida, Georgia, Ala-
bama, Mississippi, Louisiana, North Carolina, Texas,
Mexico south to Panama, Caribbean islands.
Praticolella mexicana new species
Figures (7-13)
Praticolella berlandieriana (Moricand, 1833): Fischer and
Crosse, 1872: 256-257; Vanatta, 1915: 194, fig. 1 (genitalia);
Pilsbry, 1940: 695, fig. 427a; Rehder, 1966: 290-291, fig. 20;
Correa-Sandoval, 1993: 685; Correa-Sandoval, 1996: 137;
Correa-Sandoval, 1999: 15; Correa-Sandoval, 2000: 493;
Correa-Sandoval and Castro, 2002: 238.
Praticolella griseola Pfeiffer, 1841: Robinson, 1999: 415.
Description: Shell umbilieate, globose to somewhat
depressed-globose. Lip thin, reflected to slightly cover
umbilicus. Banding extremely variable, ranging from
unbanded brown shell, unbanded white shell, to having
O
nine complete and incomplete bands, radiating lines of
white pigment, and streaks of white pigment on body
whorl. Umbilical whorls with line growth lines but no
spiral striae and usually brown/gray colored with no
white pigment, shiny. Average shell height=7.57,
width = 10.87, umbilicus width=0.69 mm, 5-5.6 whorls
(Table 2).
Type Material: Ilolotype ANSP 426031, 27 May
1992, Ned E. Strenth (Figures 7-10). Paratypes ANSP
426032 and alcohol-preserved specimens ANSP A22101.
Other material examined: Hidalgo, Hidalgo Co. TX, 21
Sept. 1991, Ned E. Strenth (Figure 11), ANSP 426020;
College of the Bahamas Research Station, Staniard
Creek, Andros Island, Bahamas, 20 May 2005, K. E.
Perez, ANSP A22090 (Figure 12); Canoas, San Luis
Potosf, Mexico, 23 July 2002, K.E. Perez. J.B. Pollock,
ANSP 426026 (Figure 13).
Type Locality: 15 km SW of Linares, Nuevo Leon,
Mexico, in grass next to small stream where MX 58
to Caja Pinta runs along stream, 24.757331 N,
-99.658111 W.
Distribution and Habitat: Widely distributed in
northeastern Mexico and south Texas on the eastern side
of the Sierra Madre Oriental. There may be native
populations in south Texas, though the collections exam-
ined were all from disturbed habitat or greenhouses.
United States Department of Agriculture (USDA) often
intercepts this species at the Texas/Mexico border. Intro-
duced populations were found in Florida, Bahamas,
Grand Cayman Island, Dominican Republic, Haiti, and
Cuba. Several USDA interceptions were from Jamaica
and Turkey. The native range of this species is most
likely northeastern Mexico, north and east of the Sierra
Madre Oriental. First, the basal lineages in this clade
are all found in this region of Mexico. Second, collec-
tions from this region of Mexico predate the collection
of this species in the Caribbean or Florida. This species
was first reported as introductions collected in dis-
turbed habitats of Florida in the early part of the
1900’s.
The preferred diet of this species is unknown; however,
it has been found on ornamental (greenhouse) plants and
Page 120
THE NAUTILUS, Vol. 125, No. 3
Figures 7-13. Shells ol Praticolella mexicana new species. 7-10. Holotype, SW of Linares, Nuevo Leon, Mexico, 27 May 1992,
Ned E. Strenth, ANSP 426031; side, top, and basal views of the shell and embryonic whorls, w=9.58 mm, h =6.59 mm, 5.25 whorls.
11. ANSP 426020, Hidalgo, Hidalgo Co. Texas, w= 10.59, h=7.46, 5.25 whorls, 21 Sept. 1991, Ned E. Strenth coll. 12. ANSP A22090,
College of the Bahamas Research Station, Staniard Creek, Andros Island, Bahamas, w= 10.57, h=7.63, 5.25 whorls, 20 May 2005,
K.E. Perez coll. 13. ANSP 426026, Canoas, San Luis Potosi, Mexico, w=9.79 mm, h=7.1S mm, 5.25 whorls, 23 July 2002, K.E. Perez,
J.B. Pollock colls.
Table 2. Shell measurements for the three species of Praticolella . Only adult shells with a full lip were measured: P. berlandieriana
(n=24), P. griseola ( n = 36 ) , P. mexicana (n=37). Values present, from top, range, mean and standard deviation. Abbreviations: h: shell
height; w: shell width; aph: aperture height; apw: aperture width; umb: umbilicus width; # of whorls - number of whorls.
is common in sugarcane, citrus, mango, banana, aloe, and
papaya plantations (USDA interception records). The
USDA has intercepted this species on shipments of
mangos, papayas, ornamental plants, and furniture. These
snails possess many of the typical characteristics of
invasive snail species, such as living at high population
densities in shrubs, tall grass, and under trash. This spe-
cies is often found climbing walls and grass.
K.E. Perez, 2011
Page 121
Etymology: Named in reference to the native distri-
bution of this species in Mexico.
Taxonomic Remarks: Praticolella mexicana is similar
to P. griseola , but differs in being larger, having a more
robust, depressed shell with white pigmentation, a flat-
tened wide body whorl, and a more oval-shaped aper-
ture. Figure 6 (right) illustrates the difference in shape
between P. mexicana and P. griseola. The body whorl of
Praticolella griseola (Figure 14) is more rounded with a
rounded aperture. The insertion of the peristome is
much closer to vertical in P. griseola and horizontal in
P. mexicana. Praticolella berlandieriana is distinguished
from P. mexicana by having a taller, much thicker,
heavier shell and widely expanded lip (Figure 6 left
and 20).
Praticolella strebeliana was included in this study as
it was described from Diente Mine near Monterrey,
Nuevo Leon Mexico (Pilsbry, 1899) within the range ol
collections of P. mexicana. This species was described
as completely brown with no bands; however, because
occasionally P. mexicana individuals have no bands
(populations from Hidalgo, Texas are all bandless with
a brown base color), I thought it necessary to con-
sider P. strebeliana as potentially having priority before
naming this new taxon (P. mexicana). Therefore, to test
whether P. strebeliana was an appropriate name,
Praticolella specimens from Diente, the type locality of
P. strebeliana , were collected for both DNA and morpho-
metric analyses. Several collecting attempts at the type
locality yielded no unbanded shells fitting the descrip-
tion of P. strebeliana. All individuals sequenced from ibis
locality are within the P. mexicana clade. Therefore, I have
no DNA evidence to distinguish P. strebeliana. However,
morphometric analysis of the type specimens (ANSP
77128 and 411457) of P. strebeliana showed that they
were veiy distinct from P mexicana , P. berlandieriana ,
and P. griseola (Figures 4 and 5). Praticolella strebeliana
has a frosted, corneous shell that is more globose than
P. mexicana , as well as a downward tilted lip and greater
degree of contraction behind the lip. Based on the differ-
ences in shell morphology and morphometric analysis
I am considering P. strebeliana distinct from P. mexicana.
In texture and coloration ol the shell, P. strebeliana is
more similar to P. flavescens than the other Texas or
Mexican taxa.
Praticolella griseola (Pfeiffer, 1841)
Helix cicercula Ferrusae in collection = griseola according to
Pfeiffer 1848, 1: 337.
Bradi/baena pisam Beck, 1837: 18 ( nomen nudum.)
Helix griseola Pfeiffer, 1841: 41; Pfeiffer, 1848: 337.
Helix albocincta Binney, 1851: 109, 128.
Helix albo-zonata Binney, 1857: pi. 49, tig. 2.
Helix albolineata Gould in Binney, 1857: 34.
Helix splendidula Anton, 1839: 36. ( nomen nudum).
Dorcasia griseola Pleilfer, 1841; Binney, 1878: 348, tig. 231
(jaw), pi. vii, fig. v (teeth).
Helix berlandieriana var. griseola Pfeiffer, 1841; von Martens,
1892: 140, pi. 7, figs. 15-17.
Helix ( Praticola ) griseola (Pilsbry, 1891): 313.
Praticolella griseola Pilsbry, 1940: 690-692, tig. 425.
Description: Praticolella with a robust, umbilicate,
depressed-globose shell. Number of pigmented bands
on body whorl ranges from 1 to 8 with most shells having
2 or 3. Most individuals possess a complete cinnamon
colored mid-body whorl band. Aperture lunate to round
with a thin reflexed lip. Shell obliquely striate. Average
shell height=9.65, width=6.91, umbilicus width =0.71
mm, 4.75-5.5 whorls (Table 2).
Type Material: Syntypes, 6 individuals, Mexico. Natu-
ral History Museum of London 20110179. Figures 14-19.
Distribution and Habitat: Pfeiffer (1841) gave the
type locality of P. griseola as Veracruz. This species is
native to Veracruz and southern Tamaulipas and has also
been introduced to South Florida and New Orleans,
Louisiana. Due to restriction of populations in the
Yucatan and Guatemala to disturbed areas, it is consid-
ered invasive there as well (Harry, 1950). However,
native populations in Guatemala have not been ruled
out by this data. The complete range of this species will
need further work to be hilly circumscribed. Specimens
labeled P. griseola in museum collections are often
P. mexicana.
Taxonomic Remarks: Praticolella griseola was de-
scribed by Pfeiffer (1841) in a short paragraph without
illustration. The specimens are attributed to Hegewisch,
referring to the physician and botanical collector
Dr. Ernst Friedrich Adoph Ilegewisch, who lived in
Oaxaca, Mexico, around 1836-1840 (Pritzel, 1864).
Pfeiffers primary collection (collection 532) was lost with
the destruction of the Stettin Museum (Dance, 1986).
However, some Pfeiffer material resides in the Natural
History Museum in London (NHMUK) including a lot
of 6 specimens labeled H. griseola Mexico Pfr in
Pfeiffer’s handwriting (handwriting identified by Jona-
than Ablett, Curator of Non-Marine Mollusca and
Cephalopoda, NMHUK, pers. comm.). These specimens
were also labeled “M.C.” indicating they came from the
Hugh Cuming collection. While it is not possible to con-
clude that these specimens were from the original type
series, Pfeiffer’s handwriting on the label indicates they
are probable syntypes.
In the phylogenetic tree (Figure 3), topotypic spec-
imens conforming to the original description of
P. griseola formed a monophyletic lineage with individ-
uals from an introduced population in Florida as well as
specimens from the coastal plain of Veracruz and north
into Tamaulipas.
Praticolella griseola has been the subject of much
taxonomic contention. Von Martens (1890-1901) and
Singley (1893) stated that II. griseola and H. (Praticolella)
berlandieriana are connected by many intermediate
forms and cannot be maintained as distinct species.
Page 122
THE NAUTILUS, Vol. 125, No. 3
Figures 14-19. Shells of Praticolella griseola. 14-19. Syntypes, Mexico, Pfeiffer material, H. Cuming Collection MNHUK
20110179. 14-17. Side, top, and basal views ol the shell and embryonic whorls. Scale bar — 1 mm (Figure 14). 18. Side view of
additional shell from same lot. 19. Side view of additional shell from same lot.
However, Pilsbry (1940) found no connecting links
between P. griseola and P. berlandieriana and further pro-
posed that they formed an ecological pair with P. griseola
living in warmer more humid regions, and P.
berlandieriana living in cooler, semiarid country. How-
ever, Cheatum and Fullington (1971) stated, without
presenting evidence, that, tine to interbreeding, in a large
assortment of shells representing all species (meaning all
species present in south Texas) from the same geographic
area it is difficult to determine where one species ends
and another begins.
Praticolella griseola has been suggested to be made up
of a number of well-characterized “races” living in a
variety of habitats and climates (Rehder, 1966; Neck,
1977). Rehder's (1966) “races” of P. griseola , included
the populations around Veracruz, Mexico and a second
race comprised of a small, unique, disjunct population in
Cameron County in south Texas. Individuals from this
“race” were sampled in this study and are referenced
herein as “P. griseola" Cameron Co. (Pilsbry, 1940;
Rehder, 1966). These snails have a thinner lip and a
dark-colored basal whorl. Taxonomic placement of this
population is outside of the sampling and scope of this
study, but the mitochondrial DNA results indicate that it
is distinct from P. griseola and from other nearby
Praticolella species and remains to be described.
K.E. Perez, 201 I
Page 123
Praticolella griseola has deep subdivisions between
different populations in the mitochondrial DNA analysis.
The individuals from Jimenez in particular are distinctive
in morphology as well in that they have a slightly heavier
lip and more solid shell. They also have more regular
spiral striae on the embryonic whorl than typical
P. griseola.
Praticolella berlandieriana (Moricand, 1833)
Helix ( Helicogena ) berlandieriana Moricand, 1833: 537, pi. 1,
fig. 1.
Helix berlandieriana Moricand, 1833: Leidy in Binney, 1851:
255, pi. 8, fig. xi.
Dorcasia berlandieriana (Moricand. 1833): Binney, 1878: 347.
Praticolella berlandieriana (Moricand, 1833): Pilsbry & Ferriss,
1906: 12,5-126, figs. 1 and 2; Pilsbry, 1940: 694-697, fig 427b
(shell); Webb, 1967: 133-136, figs. 12-17.
Description: Shell solid, narrowly umbilicate, glo-
bose-depressed with a low conic spire. Color white to
gray to light buff, frequently with a gray band above the
periphery; other bands or colored streaks common.
Embryonic whorls glossy, sometimes gray to light brown,
sometimes with fine spiral lines; later whorls weakly stri-
ate. Body whorl rounded at the periphery, somewhat
contracted behind the lip. Lip white, widely expanded.
strongly thickened within (Figures 20-23). Average shell
height=10.49, width=8.16, umbilicus width=0.85 mm,
5-5.5 whorls (Table 2).
Type Material: Syntypes MI1NG 37027, “Habite le
Mexique, dans la province de Texas” (Moricand, 1833)
Distribution and Habitat: Edwards Plateau biotic
province (Blair, 1950), central Texas, extending north to
Arkansas. In mesquite or grassy areas, often found under
trash and on roadsides.
Taxonomic Remarks: Praticolella berlandieriana was
described by Moricand (1833) referring to specimens
with the locality noted as “Texas” collected by Jean Louis
Berlandier, a botanist from Geneva who collected botan-
ical specimens in Mexico. Berlandier collected inten-
sively in Bexar and Comal counties as well as along the
road to Gonzales, Texas in the spring of 1828 (Geiser,
1948).While it is not possible to know exactly where
within this region Berlandier collected these shells, I am
treating specimens collected for DNA analysis from
Texas, North of the Balcones Escarpment, NE of the
San Antonio area (New Braunfels and Blanco River
collections) as the best possible representatives of this
species. This highway route follows the historical road
Figures 20-23. Shell of Praticolella berlandieriana , ANSP 426024, 9 km N of New Braunfels, along the Guadalupe River, Comal
Co. TX; side, top, and basal views of the shell and embryonic whorls. w=10.06, h=8.28, 5.5 whorls, 1 July 2004, K. E. Perez coll.
Page 124
O
THE NAUTILUS, Vol. 125, No. 3
between San Antonio and Gonzales. DNA sequence
analysis resolves these individuals of P. berlandieriana as
a separate unique lineage; other individuals from Mexico
that have been treated as nominal P. berlandieriana have
been herein assigned to other species in the genus.
Von Martens (1890-1901) treated P. berlandieriana as
part of the Mexican fauna and identi fied its range as Texas
and much o( northern Mexico. He also considered this
species to be synonymous with P. griseola as reflected in
his extensive synonymy. Rehder (1966) attempted to dis-
tinguish P. griseola from P. berlandieriana and restricted
P. berlandieriana’s range to central Texas through south-
ern Tamaulipas, Mexico. Hubricht (1983) considered
P. berlandieriana to have specific rank; however, he con-
sidered this species to be of ancient hybrid origin derived
from a combination of lineages of P. pachyloma and
P. Candida. Mitochondrial DNA does not support this
conclusion (Figure 3).
Praticolella berlandieriana has been considered to
have a large range, from central Texas to central Mexico
(Pilsbry, 1940; Rehder, 1966; Cheatum and Fullington,
1971). This species was then considered restricted to
central Texas by Neck (1977) and Hubricht (1983); how-
ever, the name has continued to be applied to Mexican
species with individuals identified as P. berlandieriana
reported by Correa-Sandoval (1993; 1999) from Nuevo
Leon, Tamaulipas, and San Luis Potash However, the
lack of any individuals further south than central Texas
forming a clade with P. berlandieriana indicates that
these Mexican records most likely represent P. mexicana
new species or other undescribed Mexican Praticolella.
All the Praticolella in south Texas (all into other clades
(Figure 3: south Texas Clade, “P. griseola " Cameron
County, or P. trimatris ) Therefore, it appears that the
distribution of P. berlandieriana should be restricted to
central, east, and north Texas.
The internal anatomy of an individual of
P. berlandieriana from Comal County, Texas, near the
type locality as described in this paper, was figured in
Webb (1967). Praticolella berlandieriana is also figured
(Vanatta, 1915) from a specimen from Victoria, Tamauli-
pas but this illustration does not represent true
P. berlandieriana.
DISCUSSION
This study is the first to use molecular data to examine
and delineate species boundaries in the family
Polygyridae. DNA sequences for 16S and COI were
used to estimate relationships within the genus
Praticolella with emphasis on Praticolella griseola and
the species taxonomically confused with it. This analysis
provides an evolutionary framework lor further inter-
and intraspecific studies within Praticolella as well as
providing some baseline for management efforts ol the
several invasive Praticolella species.
Accurate identification and the continuing deposition
ol species in natural history collections are of primary
importance for management of invasive species. Predi-
ctions of how newly introduced organisms may be capa-
ble of surviving or altering habitats or ecosystems cannot
be made unless the species in question has been identi-
fied accurately. Attempts to control spread or population
growth of these species is hindered because information
on ecology of the introduced species within its native
range cannot be gathered or used without a correct
identification. In the opposite case, data gathered in
the newly introduced environment cannot be used
by workers in areas where they have been introduced
previously.
Molecular analyses found several exclusive lineages
of snails that had previously been treated/identified
as P. griseola. There are multiple invasive lineages of
Praticolella in the USA, and the majority of individuals
encountered both in established populations and inter-
cepted by US DA are P. mexicana from trade goods
shipped from the Caribbean. This result indicates most
of the propagnle pressure for Praticolella mexicana
invasion is actually via secondary invasion through the
Caribbean, not coastal Mexico as previously thought.
This species also appears to be starting to establish
populations worldwide with the first US DA interceptions
from Turkey in 2009 (USDA Interception Number:
APHTX062722570001 ).
Along with the discoveiy of multiple lineages of inva-
sive species, this analysis also highlighted populations of
P. griseola from south Texas, from a population disjunct
from the rest of the species distribution by ~300 km.
This population had long been regarded as a distinct
“race” of P griseola (Rehder, 1966; Neck, 1990); how-
ever, this study indicates this lineage is distinct and veiy
limited in distribution.
In addition to the Cameron County, Texas lineage the
molecular results of this study uncovered several veiy
distinct lineages that cannot confidently have an avail-
able name applied. This includes the lineage sister to
P. griseola from the Soto la Marina, Tamaulipas (TMP)
area. Considered part of P. mexicana are two populations
that form unique exclusive lineages, from near Ciudad
Mante, TMP, and near Ciudad Victoria, TMP. Additional
sampling will be required to determine the extent of the
distribution of these lineages and their specific status.
It is outside the scope of this paper and the available
collection materials to circumscribe these species, but
these molecular data suggests that there is much
undescribed diversity within Praticolella .
The life-history characteristics of Praticolella lend this
group of snails to an invasive life-style. They thrive in
disturbed habitat, living at high population densities in
shrubs, tall grass, and agricultural lands; consequently
they frequently travel on citrus, vegetables, and orna-
mental plants. These species share a morphological
type characterized by multiple color bands on the shell.
These shell banding patterns have been proposed to be
an adaptation for snails that climb up vegetation, thus
providing camouflage from bird predators (Johnson,
1980), an alternative has been proposed that bands
K.E. Perez, 2011
Page 125
provide thermal control by reducing radiative energy
absorption (Burla and Gosteli. 1993). This characteristic
is therefore likely to be convergent and not taxonomi-
eally useful, although it has been used extensively in
previous taxonomy ol Praticolella.
ACKNOWLEDGMENTS
This work is only possible due to collections by Ned
E. Strenth and T. Glenn Littleton. The following indi-
viduals provided training, assistance, and/or help with
lab and fieldwork: S.A. Clark, F. Fontanella, K. Gallant,
D. Garate, B. Henry, J. Laurila, T.G. Littleton,
L. McCutchen, R. Minton, T.A. Pearce, J.B. Pollock,
N.E. Strenth, F.G. Thompson, ). Walker, and R. Werren.
Mexican specimens were collected under permit 7146 to
Dr. Alfonso Correa Sandoval, Universidad National
Autonoma de Mexico at Victoria. Many specimens were
provided by D. Robinson, P. Marquez, and F. Zimmer-
man at USDA. Museum specimens were loaned by
| ocher i Gerber, FMNII, Paul Callomon, ANSP, John
Slapcinsky and Fred Thompson, Florida Museum of
Natural History. Praticolella griseola images were
provided by Jonathan Ablett, MNHUK. Financial sup-
port was provided by NSF-IGERT (DGE-9972810 to
A.K. Ward), the University of Alabama, the SPIRE
program at UNC-Chapel Hill (NIGMS-MORE division -
GM 00678), Duke University, and a Faculty Research
Grant, University of Wisconsin at La Crosse. Research
funding for collections or museum collections work was
provided by the Texas Academy of Science, Malacological
Society of London, Conchologists of America, American
Malacological Society, American Museum of Natural
Histoiy, and Delaware Museum ol Natural Histoiy.
LITERATURE CITED
Anton, II. E. 1839. Verzeichniss der Conchylien. Welehe sick in
der Sammlung. Eduard Anton, Halle, 110 pp.
Beck, II. II. 1837. Index Molluseorum Praesentis Aevi Musei
Principis Augustissimi Christiani Frederici. 127 pp.
Binney, A. 1851. The Terrestrial Air-breathing Mollusks of
the United States and the Adjacent Territories of North
America. Vol. 1. Charles C. Little and James C. Brown,
Boston, 366 pp.
Binney, A. 1857. The Terrestrial Air-breathing Mollusks of
the United States and the Adjacent Territories of North
America. Vol. 2. Charles C. Little and James C. Brown,
Boston, 362 pp.
Binney, W.G. 1878. Terrestrial Air-Breathing Mollusks of the
United States and Adjacent Territories of North America.
Vol. 5. Welsh, Bigelow & Co., Cambridge, 221 pp.
Blair, W. F. 1950. The biotic provinces of Texas. Texas Journal of
Science 2: 93-117.
Burla, PI. and M. Gosteli. 1993. Thermal advantage of pale
coloured morphs of the snail Arianta arbustoram
(Helieidae, Pulmonata) in alpine habitats. Ecography 16:
345-350.
Cheatum, E.P. and R.W. Fullington. 1971. The aquatic and
land Mollusca of Texas. Bulletin of the Dallas Museum of
Natural History I, part 1: 1-74.
Conde-Padin, P, J.W. Grahame and E. Rolan-Alvarez. 2007.
Detecting shape differences in species of the Littorina
saxatilis complex by morphometric analysis. Journal of
Mollusean Studies 73: 147-154.
Correa-Sandoval, A. 1993. Caracoles terrestres (Molluca:
Gastropoda) de Santiago, Nuevo Leon, Mexico. Revista
de Biologia Tropical 41: 683-687.
Correa-Sandoval, A. 1996. Caracoles terrestres (Mollusca:
Gastropoda) de Iturbide, Nuevo Leon, Mexico. Revista
Biologia Tropical 44: 137-142.
Correa-Sandoval, A. 1999. Zoogeografia de los gastropodos de
la region oriental de San Luis Potosi. Revista de Biologia
Tropical 47: 493-502.
Correa-Sandoval, A. 2000. Gastropodos terrestres del norte de
Veracruz, Mexico. Acta Zoologica Mexicana 79: 1-9.
Correa-Sandoval, A. and R.R. Castro. 2002. Gastropodos
terrestres del sur de Tamaulipas, Mexico. Acta Zoologica
Mexicana 86: 225-238.
Dance, S.P. 1986. A history of shell collecting. E.J. Brill-Dr. W.
Baekhuys, Leiden, 265 pp.
Drummond, A.J., B. Ashton, J. Heled, M. Kearse, R. Moir, S.
Stones-Havas, T. Thierer, and A. Wilson. 2006. Geneious
v2.5.4. Available from http://www.geneious.com
Dundee, D.S. 1974. Catalog of introduced molluscs of eastern
North America (North of Mexico). Sterkiana 55: 1-37.
Edgar, R.C. 2004. MUSCLE: multiple sequence alignment
with high accuracy and high throughput. Nucleic Acids
Research 32: 1792-1797.
Emberton, K.C. 1995. When shells do not tell: 145 million years
of evolution in North Americas Polygyrid land snails, with
a revision and conservation priorities. Malacologia 37:
69-110.
Fischer, P. and PI. Crosse. 1872. Mission Seientifique au Mexique
et dans L'Amerique Centrale. Etudes sur les mollusques
terrestres et fluviatiles du Mexique et du Guatemala. I. Part
I. Imprimerie Nationale, Paris, pp. 153-304.
Folmer, O.M., W. Black, R. Hoeh, R.A. Lutz, and
R. Vrijenhoek. 1994. DNA primers for amplification of
mitochondrial cytochrome c oxidase subunit I from
diverse metazoan invertebrates. Molecular Marine Biol-
ogy Biotechniques 3: 294-299.
Geiser, S.W. 1948. Naturalists of the Frontier. 2nd ed. South-
ern Methodist University, Dallas, 341 pp.
Harry, I4.W. 1950. Studies on the nomarine Mollusca of the
Yucatan. Occasional Papers of the Museum of Zollogy,
No. 524. University of Michigan, Ann Arbor, 34 pp.
Hayes, D.M., R.L. Minton, and K.E. Perez. 2007. Elimia
comalensis (Gastropoda: Pleuroceridae) from the Edwards
Plateau, Texas: multiple unrecognized endemics or native
exotic? The American Midland Naturalist 158: 97-112.
Heller, J., P. Mordan, F. Ben-Ami, and N. Sivan. 2005.
Conchometrics, systematics and distribution of Melanopsis
(Mollusca: Gastropoda) in the Levant. Zoological Journal of
the Linnean Society 144: 229-260.
Hubrieht, L. 1983. The genus Praticolella in Texas
(Polygyridae: Pulmonata). The Veliger 25: 244-250.
Hubrieht, L. 1984. Hybridization in the land snails of Eastern
United States. Gastropodia 2(2), 20; 2(3), 21.
Johnson, M.S. 1980. Association of shell banding and habitat in
a colony of the land snail Theba pisana. Heredity 45: 7-14.
Master, L. L. 1991. Assessing threats and setting priorities for
conservation. Conservation Biology 5: 559-563.
Moricand, S. 1833. Note sur quelques especes nouvelles de
eoquilles terrestres. Memoires de la Societe Physique et
d'LIistoire Naturelle, Geneve, 6: 537.
Page 126
THE NAUTILUS, Vol. 125, No. 3
NatureServe. 2005. NatureServe Explorer: an online encyclo-
pedia of life [web application]. Version 4.4. Available at
http ://www. natureserve . org/ explorer.
Neck, R.VV. 1977. Geographical range of Praticolella griseola
(Polygyridae): correction and analysis. The Nautilus 91:
1-4.
Neck, R.W. 1990. Ecological analysis of the living mollusks
of the Texas panhandle. American Malacological Bulletin
8: 9-18.
Palumbi, S.R., A.P Martin, S. Romano, VV.O. McMillan, L.
Stice, and G. Grabowski. 1991. The Simple Fool’s Guide
to PCR. Special Publication of the Department of Zool-
ogy. University of Hawaii, Honolulu, 45 pp.
Perez, K.E., W.F. Ponder, D.|. Colgan, S.A. Clark and C.
Lydeard. 2005. Molecular phylogeny and biogeography of
spring-associated Hydrobiid snails of the Great Artesian
Basin, Australia. Molecular Phylogenetics and Evolution
34: 545-556.
Pfeiffer, L. 1841. Symbolae ad Historian! Heliceorum. I.
Casselis, 100 pp.
Pfeiffer, L. 1848. Monographia heliceorum viventium. I. E. A.
Broekhaus, Leipzig, 484 pp.
Pfeiffer, L. 1866. Beschreibung neuer Landschnecken.
Malakozoologisehe Blatter 13: 78.
Pfenninger, M. and F. Magnin. 2001. Phenotypic evolution
and bidden speciation in Canclidula unifasciata ssp.
( Helicellinae, Gastropoda) inferred by 16S variation and
quantitative shell traits. Molecular Ecology 10: 2541-2554.
Pilsbry, II. A. 1891. Land and Fresh-water Mollusks Collected
in Yucatan and Mexico. Proceedings of the Academy of
Natural Sciences of Philadelphia 43: 310-314.
Pilsbry, H.A. 1899. Descriptions of new species of Mexican
land and freshwater mollusks. Proceedings of the Acad-
emy of Natural Science of Philadelphia 51: 391-402.
Pilsbry, H.A. and J.H. Ferriss. 1906. Mollusea of the south-
western states. Proceedings of the Academy of Natural
Sciences of Philadelphia 58: 125-126.
Pilsbry, PL A. 1930. Anatomy and relationships of some Ameri-
can Helicidae and Polygyridae. Proceedings of the Acad-
emy of Natural Sciences of Philadelphia 82: 310-321.
Pilsbry, H.A. 1940. Land Mollusea of North America (north of
Mexico). Vol I, Part 2. Academy of Natural Sciences of
Philadelphia, 994 pp.
Pritzel, G. 1864. Einige Berichtigungen za den Materialien
zu cinem Verzeichuiss der jetzt lebenden botanischen
Schriftsteller. (Linnaea Bd. XIX. Heft 2. p. 146-192).
Linnaea 19: 447—464.
Rehder, H.A. 1966. The non-marine mollusks of Quintana
Roo, Mexico with the description of a new species of
Drymaeus (Pulmonata: Bulimulidae). Proceedings of the
Biological Society of Washington 79: 273-296.
Robinson, D. G. 1999. Alien invasions: the effects of the global
economy on nonmarine gastropod introductions into the
United States. Malaeologia 41: 413^138.
Rohlf, F.J. 2001. Tps Dig 1.37. Department of Ecology and
Evolution, State University of New York, Stony Brook,
NY. Available from Stonybrook Morphometries: http://
lite.bio.sunysb.edu/morpli/.
Sheets, H.D. 2003. Integrated Morphometries package (IMP).
Software distributed by the author at www2.canisius.edu/
~sheets/morphsoft.html.
Singley, J.A. 1893. A preliminary list of the land, fresh-water,
and marine Mollusea of Texas. Fourth Annual Report
Geological Survey of Texas. Contributions to the Natural
History of Texas. Part 1: 299-343.
Strebel, H. and G. Pfeiffer. 1880. Beitrag zur Kenntniss der
Fauna mexikanischer Land- und Siisswasser-Conehylien.
|. J. Kerbst, Hamburg, 144 pp.
Tanaka, M.O. and R.C. Maia. 2006. Shell morphological varia-
tion of Littorina angulifera among and within mangroves
in NE Brazil. Hydrobiologia 559: 193-202.
Vanatta, E.G. 1915. A revision of the genus Praticolella von
Martens 1892. Proceedings of the Academy of Natural
Sciences of Philadelphia 67: 197-210.
von Martens, E. 1890-1901. Biologia Centrali-Americana.
R. H. Porter, and Dulau and Co., London, 706 pp.
Webb, G.R. 1967. Erotology of three species of Praticolella,
and of Polygyra pustula. The Nautilus 80: 133-140.
Zelditch, M.I.. 1) I.. Swidersld, H.D. Sheets and W.L. Fink.
2004. Geometric morphometries for biologists: a primer.
Elsevier Academic Press, San Diego, 443 pp.
Zwickl, D.|. 2006. Garli: Genetic algorithm approaches for
the phylogenetic analysis of large biological sequence
datasets under the maximum likelihood criterion. The
University of Texas at Austin. Available from: http://garli.
googlecode.com/.
THE NAUTILUS 125(3): 127-136, 201 1
Page 127
Ten new bathyal and abyssal species of Scaphopoda
from the Atlantic Ocean
Victor Scarabino
Museum national d'Histoire naturelle
Departement Systematique et Evolution
Case postale 51, 55 rue de Buffon
F-75231 Paris eedex 05, FRANCE
and
Museo Nacional de Historia Natural
Montevideo, URUGUAY
[email protected]
Fabrizio Scarabino
Museo Nacional de Historia Natural
C. C. 399. C. P. 11.000
Montevideo, URUGUAY
[email protected]
ABSTRACT
Ten new species of Scaphopoda (one of the Order Dentaliida
and nine of the Order Gadilida) from bathyal and abyssal
depths in the North Atlantic Ocean, Caribbean Sea, and north-
ern Brazil are described. The material was collected during
diverse expeditions carried out by European and American
research institutions. The new species are named as, in the
order Dentaliida: Laevidentalium abyplaine new species;
and in the order Gadilida: Pulselliim filifonne new species,
Striopulsellum sandersi new species, Striopulsellum knorr
new species, Striopulsellum atlantis new species, Cadulus
unilobatus new species, Gadila celtica new species, Gadila
cretea new species, Chistikovia atlantica new species and
Siphonodentalium coronation new species. These findings con-
firm that the deep-water realm, even in regions historically
considered as well known, are far from being adequately
inventoried.
Additional keywords: Mollusea, deep-sea, new species, geo-
graphic distribution
INTRODUCTION
The scaphopod fauna recorded from the Atlantic Ocean
includes some 132 species. Ninety of them are distrib-
uted over the western areas (including the Caribbean
Sea to Sub-Antarctic waters) and 42 were reported from
the eastern side (including the Mediterranean Sea and
West Africa). Seven species are considered to have
amphi- Atlantic distribution. For the northwestern Atlan-
tic and Caribbean, the first comprehensive revision was
published by Henderson (1920). Subsequent taxonomic
arrangements and some new species descriptions did not
substantially modify their number. In the northeastern
Atlantic region, since early discoveries, the number of
species remained notably stable. More than 85% of spe-
cies (36) were described during the 19th Century. The
most prolific authors at the time were Jeffreys (1877,
1883) who described nine species, M. Sars (1859, 1865)
and Loeard (1897), who described lour. More recently,
Nickles (1955, 1979) described twelve new species from
western Africa, but, for the northeastern region, it was
not until 1979 that a new species, Siphonodentalium
laubieri, was described from bathyal depths of the Nor-
wegian Sea (Bouchet and Waren, 1979). Later, Scarabino
(1986 a, b) described respectively two other abyssal
species: Wemersoniella turnerae and Annulipulsellum
euzkadii (both amphi-Atlantie, see Caetano et ah, 2006).
Those papers also include two other new species,
described from the abyssal realm of the Argentinian
Basin (from 5332-5781 m): Wemersoniella duartei and
Costentalina vemae. Detailed information on localities
and type depositories of the species registered for this
large region is given in Steiner and Kabat (2004).
During revision of bathyal and abyssal collections in
localities of the Atlantic Ocean, a surprising number of
new species (one belonging to Dentaliida and nine to
Gadilida) were identified and are described here. Five
of them were collected only in the North and central
Atlantic basins, two have amphi- Atlantic distribution
and three come from diverse localities of the western
Atlantic such as the Puerto Rico Trench and northern
Brazil basins. The Atlantic deep-sea records mentioned
for Chistikovia Scarabino, 1995 and Striopulsellum
Scarabino, 1995 genera given by Scarabino (1995: 323,
327) refers to the species here recorded. The finding of
the ten new species here described confirm that the
deep-water realm, even in regions historically consid-
ered as well known, are far from being adequately
inventoried.
MATERIALS AND METHODS
The material was collected during oceanographic cruises
carried on by European and North American institu-
tions. The first group were mostly French and made in
Page 128
THE NAUTILUS, Vol. 125, No. 3
the Gulf of Gascony: Biogas I-XII (1972-1981) and
Incal (1973); off Portugal and Spain: Abyplaine (1982);
North Atlantic: Noratlante (1969); off Azores: BiAgoRES
(1971) and in the Verna Trench: Biovema (1977), all
IFREMER/MNHN. Additional European materials
came from expeditions of the R/V Ingolf (1895)
(ZMUC) and B/V Princesse-Alice II (1911) (MOM).
North American cruises, all WHOI, were carried out in
the Puerto Rico Trench: R/V Knorr cruise 25 (1972),
Blake Plateau and North American Basins: R/V Knorr
cruise 35 (1973), R/V Chain, cruises 50 and 106 (1965,
1972); and the Pernambuco Trench: R/V Atlantis II
cruise 31 (1967). The total represents 56 localities in
depths from 1456 to 5875 m, 40 of which carried out
below 4000 m depth.
For further information on the expeditions Abyplaine
(1982); BiAgoRES (1971), Biogas I to XII (1972-1981),
Biovema (1977), Incal (1973) and Noratlante (1969),
see http://www.ifremer.fr/biocean/acces_fr/data_fr.htm;
R/V Atlantis II; R/V Chain and R/V Knorr (WHOI)
between 1967 and 1972, http://www.whoi.edu/; Ingolf,
1895 in: Results of the Danish Ingolf- Expedition,
Copenhagen; R/V Princesse-Alice II (1911) Results of
the scientific campaign of the Prince of Monaco, vol 89.
Radula: As stated in Scarabino and Scarabino (2010),
the scaphopod radula is large enough to facilitate visu-
alization of the different teeth of that convey taxonomic
information. The radula is especially useful in taxa of
the Order Gadilida, in which the small raehidian teeth
are always covered by the laterals. The pictures shown
in this article correspond to elements of medial rows;
this is done to avoid illustration of used teeth and not
yet fully formed (young) teeth. SEM images were proc-
essed in the Sendee Commun de Microscopie
Electronique des Laboratoires des Sciences de la Vie
(MNHN, Paris).
Shell: Shell descriptions are based on the holotypes
and radula on holotypes, paratypes or selected spec-
imens as noted in the text. Live collected specimens are
indicated as (lv) and shells as (dd). Shell measurements
are expressed in millimeters and include: length (L);
maximum diameter (Max); distance of point of maximum
diameter to anterior aperture (Dmax); diameter of oral
aperture (Oap); maximum curvature (Arc); distance of
point of maximum curvature from the apex (Lare); apical
aperture diameter (Apd). For shells with oval cross-
section, maximum and minimum values are included in
Max and Oap. Maximum length of specimens other than
the holotypes are indicated in the remarks.
Abbreviations: Institutional abbreviations used in
the text are: AIM: Auckland Institute and Museum,
Auckland; ANSP: Academy of Natural Sciences, Philadel-
phia; NI4MUK: The Natural History Museum, London;
IFREMER: Institute F rangais de Recherche pour
I Exploitation de la Mer, France; MCZ: Museum of Com-
parative Zoology, Harvard University; MNHN: Museum
national d’Histoire naturelle, Paris; MOM: Musee
Oceanographique de Monaco; QM: Queensland Museum;
USNM: National Museum of Natural Histoiy, Washington,
DC; WHOI: Woods Hole Oceanographic Institution,
Woods Hole; SAM: South Australian Museum, Adelaide;
SMHN: Naturhistoriska Riksmuseet, Stockholm; ZMB:
Museum fur Naturkunde, Berlin; ZMO: Zoologisk
Museum, Universitetet i Oslo, Oslo; ZMUC: Zoologi-
cal Museum University of Copenhagen, Copenhagen.
SYSTEMATIC S
Class Scaphopoda Broun, 1862
Order Dentaliida da Costa, 1776
Family Dentaliidae (Children, 1834)
Genus Laevidentalium Pilsbry and Sharp, 1897
Laevidentalium abyplaine new species
(Figures 1-5)
Description: Shell 43.3 mm long, slender, faintly
curved, porcelain white, subtle longitudinal threads near
apex. Sides irregularly outlined by well-defined growth
lines. Cross section slightly dorsoventrally compressed in
anterior 3/4, circular toward posterior aperture. Apex
oblique, with ring-shape callus and lumen circular.
Radula (Specimen from type locality): Raehidian teeth
strong, curved, with strongly granulose anterior surface;
lateral teeth solid, with short but strong cusps and irreg-
ular grooves, anterior part of head smooth; marginal
short almost straight.
Type Material: Holotype (lv) MNHN 24331 and
2 paratypes (lv) MNHN 24332.
Measurements of Holotype: L 43.3, Max 3. 3/3. 4,
Apd 0.9, Arc 1.65, Larc 14.
Type Locality: Off Portugal, 39° 59. 5' N, 15°00.2'
WA39°59.2' N, 15°02.T W, 5330 m (Abyplaine stn CP 14).
Ollier Material Examined: Abyplaine, stn CP 13,
40°00.8' N, 15°05' W-39°59.2' N, 15°05' W, 5270 m,
4 dd, 1 lv; stn CP 14, 39°59.5' N, 15°00.2' W-39°59.2'
N, 5°02.T W, 5330 m, 5 lv (holotype and 2 paratypes),
12 dd; stn CP 15, 39°59.5' N, 15°00.2/ W - 39°59.2' N,
15°02.T W, 5320 m, I dd; stn CP 19, 43°00.T N, 15°53.T
W-42°59.T N, 14°02.9' W, 5280 m, 10 dd; stn CP 20,
42°59.7' N, 14°07.2' W-42°58.8' N, 14°05.4' W, 5260 m,
8 dd; stn CP 21, 42°57.7' N, 13°59.2' W - 42°58' N,
14°44.0' W, 5260 m, 5 dd; stn CP 23, 44°39.9' N,
1 7° 55. 9' W - 44°42.8' N, 17°57.5/ W, 4990 m, 3 dd; stn
DS 09, 40° 00' N, 15° 03' W, 5320 m, 4 dd; stn DS 10,
42°51' N, 15°55' W, 4360 m, 2 dd; stn DS 11, 43°00' N,
14°05' W, 5260 m, 4 dd; stn DS 12, 44°40' N, 17°53' W,
4990 m, 7 dd; stn DS 13, 44°41.2' N, 17°49' W, 4990 m,
6 dd. Biogas IV, stn DS 54, 46°3T W, 10°29'W, 4659 m,
V. Scarabino and F. Scarabino, 201 1
Page 129
Figures 1-16. Species of Laevidentalium, Pulsellum, and Striopulsellum. 1-5. Laevidentalium abyplaine new species. 1. Holo-
type (43.3 mm), off Portugal, 39°59.5' N, 15°00.2' W-39°59.2/ N, 15°02.1' W, 5330 m, ABYPLAINE stn CPU. lateral and dorsal
views of shell. 2. Details of apex, INCAL stn OS 03. 3-5. Radula, paratype, type locality. 3. Lateral tooth, internal view.
4. Lateral and marginal teeth, lateral view. Scale bar = 10 pm. 5. Rachidian tooth, anterior border and detail. Scale bar = 100
pm. 6. Pulsellum filiforme new species, holotype (8.9 mm), Puerto Rico Trench, 8°12.4' N, 55°50.2/ W, 2487-2500 m, R/Y Knorr
25 stn 301, lateral view or shell. 7-12. Striopulsellum sandersi new species. 7. Holotype (7.2 mm). North Blake Plateau, 40°42.6'
N, 46° 13.8' W, 4400 m, R/V Chain 106, stn 334, lateral and dorsal views of shell. 8. Striopulsellum sandersi new species, external
view of apex. 9. Section showing internal view. 10. External view of apex and details of internal structure by transparency.
11. Microsculpture of the surface. Scale bar = 10 pm. 12. Same specimen, sculpture at center of shell. Scale bar = 100 pm.
13. Striopulsellum minimum (Plate, 1908) (6.8 mm), Argentine Basin, 43°58' S, 52°09' W, 5781 m, R/V Vema 1961, stn V-15-80,
lateral and dorsal views. 14-15. Striopulsellum atlantis new species, holotype (6 mm) off Pernambuco, Brazil, 7°58' S, 34°17' W,
943-1007 m, R/V Atlantis-II-31-167. 14. Detail of sculpture at center of shell. 15. Shell sculpture on oral area. 16. Striopulsellum
knorr new species, holotype (5.5 mm), Puerto Rico Trench, H°2.2' N, 55°4.8' W, 4417U429 m, R/V Knorr 25, stn 288; lateral
and dorsal views.
1 dd. Biogas VI, stn CP 15, 46°32.2/ N, 10°28.5'
W, 4715 m, 1 dd; stn CP 16, 46°27.3' N, 10°25.8'
W, 4825 m, 2 dd; stn CP 17, 46°30.8/ N, 10° 19.5' W,
4706 m, 2 lv. Incal, stn OS 03, 46°02,5' N, 10° 19,5' W,
4798 m, 10 dd; stn OS 04, 46°03.9' N, 10° 12.8' W, 4796
in, 1 lv, 6 dd; stn WS 05, 46°03' N, 10° 15' W, 4804 m, 1
dd; stn CP 12, 46°00.5' N, 10° 18,3' W, 4796 m, 8 lv, 6 dd.
Etymology: Named (name in apposition) after the
French expedition Abyplaine (1982) to northeastern
Atlantic depths in recognition to its success on the dis-
covery of new deep-sea species.
Distribution: Collected alive between 4796 and 5330
meters in the northeastern Atlantic Ocean off the coast
of Portugal, in the Gulf of Gascony, and off northern
France. Laevidentalium abyplaine is considered exclu-
sively abyssal.
Remarks: Young specimens present a shallow apical
notch on ventral side of apex. This feature led us to con-
sider that the apical aspect of adult specimens is probably
due to a reabsorption process. Laevidentalium abyplaine
can be compared to Laevidentalium leptosceles (Watson,
1879) (Leetotype NHMUK 1887.2.9.21, examined) widely
Page 130
THE NAUTILUS, Vol. 125, No. 3
distributed in the Indo-Pacific region in 918-5300 m
depth (Scarabino, 1995). The new species is more taper-
ing, curved and smooth, whereas L. leptosceles has
clear longitudinal undulations, especially on the dorsal
side. It also can be compared in outline to Graptacme
acutissima (Watson, 1879) (Leetotype N1IMUK
1887.2.9.31, examined) from the Indo-Pacific, but this
latter has a well-defined apical notch on ventral side and
longitudinal sculpture near apex. Other bathyal and
abyssal Atlantic Graptacme, such as Graptacme perlonga
(Dali, 1881) (Leetotype MCZ 7752, examined) is much
more solid, longer, less tapering and also has apical notch
and longitudinal sculpture at apex, clearly noticeable
under lens. Larger specimens reach 49 mm length.
Laevidentalium abyplaine would be the first living
Laevidentalium recorded for the Atlantic Ocean. How-
ever, given the few conchological characters of this genus
and the fact that its type species is an Eocene fossil
( Dentalium incertum Deshayes, 1825), it is here
suggested that the generic allocation of all living and
fossil Laevidentalium should be globally reviewed.
Order Gadilida Starobogatov, 1974
Suborder Gadilimorpha Steiner, 1992
Family Pulsellidae Boss, 1982
Genus Pulselhim Stoliczka, 1868
PulseUum filiforme new species
(Figures 6, 30-31)
Description: Shell 8.9 mm long, thread-like outline,
markedly curved, arc close to middle of shell, veiy slow
tapering. Surface irregular, translucent with white
opaque patches. Apex and mouth simple, straight, section
circular.
Radula (Holotype): Rachidian teeth polygonal, sides
almost parallel, and anterior margin with pointed edge.
Lateral teeth wide at the base and with well-armed head
bearing four denticles, the two lateral teeth longer and
pointed. Marginal teeth simple, straight.
Measurements of Holotype: L 8.9, Max 0.9, Apd 0.5,
Arc 0.9, Larc 4.7.
Type Material: Holotype (lv) MCZ 293968, 5 para-
types (lv) MCZ 202969, 293970-73; 1 paratype (dd)
MNHN 24333.
Type Locality: Puerto Rico Trench, 8°12.4' N, 55°50.2'
W, 2487-2500 m, R/V Knorr 25 stn 301 (WHOI).
Other Material Examined: R/V Knorr 25, stn 293,
08°28.8' N, 54°04.3' W, 1456-1518 m, 1 lv; stn 299,
7° 55.1' N, 55° 42.0' W, 1942-2076 m, 3 lv (1 paratype),
5 dd; stn 301, 8° 12.4' N, 55°50.2W, 2487-2500 m, 3 lv
(holotype), 1 dd; H/V Knorr 35, stn 340, 38° 14.4' N,
70° 20. 3' W- 38° 17.6' N, 70°22.8/ W, 3264-3356 m, 10 lv
(5 paratypes), 8 dd.
Etymology: Named after the shells’ narrow, “thread-
like” outline.
Distribution: Collected alive between 1518-3264
meters in the Western Atlantic Ocean from the North
Blake Plateau and the Puerto Rico Trench.
Remarks: The thread-like aspect with sides almost
parallel and length of shell differentiate this new species
from other Atlantic and worldwide PulseUum species.
Maximum length 9.2 mm.
Genus Striopulsellum Scarabino, 1995
Remarks: As result of the present study, the genus
Striopulsellum assembles six species and confirms its pref-
erence for bathyal to hadal depths worldwide. These are
Striopulsellum minimum (Plate, 1908) (Leetotype ZMB/
Moll-59728a), the type species, with circum -Antarctic dis-
tribution (3423- 6179 m depth), also recorded from New
Caledonia (Scarabino, 1995) and in the Verna Basin,
Argentina, live at 3423-6179 m (Scarabino, 1979, and
present paper) (Figures 13, 37, specimen and radula re-
spectively), Striopulsellum striatinum (Henderson, 1920)
(Syntypes USNM 108106, examined) described off
Fernandina, Florida, USA, from 537 m, representing the
shallowest record for the genus; Striopulsellum galatheae
Knudsen, 1964, collected alive in the Sunda Trench at
6900-7000 m depth (Holotype ZMUC), and the three
new species described herein: Striopulsellum sandersi
new species, widely distributed in the north Atlantic
ocean at 3264-5800 m depth; Striopulsellum knorr new
species in the Puerto Rico Trench at 4429-4934 m depth;
and Striopulsellum atlantis new species, from northeast-
ern Brazil at 943-1007 m depth.
StriopulseUum sandersi new species
(Figures 7-12, 36)
Description: Shell 7.2 mm long, translucent grey,
regularly curved and slow tapering, arc located anterior
to centre of shell. Longitudinally sculptured by 24 fine
primary striae at apex and secondary ones that arise early
and are doubled in number. Surface linely granulose.
Apex oblique, dorsal side longer, circular in section,
pre-apical callus thick. Walls of apical area alternate
thinner and thicker sections, easily observed by
transparency. Anterior aperture straight, circular in
cross-section.
Radula (Specimen from R/V Knorr 35, stn
340): Rachidian teeth polygonal, anterior margin with
three cusps, one central and two minor ones, lateral
profile thicker at posterior border and thinner at anterior
border, delimited by a cusp. Lateral teeth with five den-
ticles between main cusps. Marginal teeth straight, with
contact border large.
Measurements of Holotype: L 7.2, Max 0.5, Apd 0. 1 ,
Arc 0.4, Larc 4.
V. Scarabino and F. Scarabino, 2011
Page 131
Tvpe Material: Holotype (lv) MCZ 293944 and
5 paratvpes: 3 (lv) MCZ 293945, 2 (lv) MNHN 24334.
Type Locality: North Blake Plateau, 40°42.6' N,
46° 13.8' W, 4400 m, RA7 Chain 106, stn 334.
Other Material Examined: RA7 Chain 106, stn 334,
40° 42. 6' N, 46° 13.8' W, 4400 m, 15 (holotype and 3
paratypes); RA7 Knorr 35, stn 340, 38°14.4' N, 70°20.3'
VV, 3264-3356 m 3 lv; Abyplaine, stn CP 21, 42°57.7' N,
13°59.2' W - 42°58' N, 14°44.0' W, 5260 m, 1 lv; stn DS
04, 34° 54' N, 21°26.10' W, 5160 m, 1 lv, 1 dd; stn DS 06,
32° 03' N, 22°01' W, 5250 m, 1 lv; stn DS 10, 42°51' N,
15° 55' W, 4270-4360, 3 dd; stn DS 11, 43°00' N, 14°05'
W, 5260 m, 2 lv (paratypes). Biogas VI, stn 10-CB5,
55° 43' N, 49°21' W, 3676 m, 1 lv; stn 19-CB8, 38°55,
46°47' VV, 5320 m, 5 lv, 2 dd; stn 78, 46°31' N, 10°24' VV,
4706 m, 1 lv; stn 79, 44°30' N, 10°27' W, 4715 m;
Biovema, stn 09, 1 1°36' N, 32°52' W, 5875 m 32 lv; stn
CP 22, 44° 42' N, 17°59' W, 1 lv; stn DS 04 34°54' N,
21°26' VV, 5160 m, 10 lv; stn DS 06, 32°03' N, 22°0]'
VV, 5250 m, 2 lv; 2 dd; stn DS 10, 11°33' N, 32°52' W,
5875 in, 3 lv; stn DS 1 1 , 43°00' N, 14°05' W, 5260 m,
2 lv; Noratlante, 1969, stn 21, 38°28' N, 3°03' W, 5228-
5240 m, 2 lv; stn DS 08, 52° 10' N, 45°32' VV, 4100-4120,
1 lv; stn DS 19, 38°55' N, 46°47' W, 5320, 2 lv.
Etymology: Named after the late Dr. Howard L.
Sanders (WPIOI), contemporary pioneer of deep-sea
zoological research of the Atlantic Ocean, who hosted
the senior author in his laboratory at Woods I Iole, many
years ago, and made available for study several of the
specimens described in the present paper.
Distribution: Collected alive between 3264-5800
meters from the North Atlantic basin, Verna Trench and
the Gulf of Gascony.
Remarks: Compared to the other two new species
described here, Striopulsellum sandersi new species is
more regularly curved than S. knorr new species and
5. atlantis new species, has the apex oblique and it is
specially identified by the characteristic structure of the
wall on the apical area. Shells frequently present break-
ages and repairs. Maximum length 11.3 mm.
Striopulsellum knorr new species
(Figures 17, 34-35)
Description: Shell 5.5 mm long, translucent grey,
slightly curved and slow tapering. Longitudinally sculp-
tured by 34 line but well-defined primary striae, second-
ary ones appearing on posterior quart, doubling in
number. Apex straight, circular in cross-section, apical
callus thick, lumen circular. Mouth straight, circular in
section.
Radula (Holotype): Rachidian teeth polygonal, ante-
rior margin with single cusp. Lateral teeth with four
denticles between main cusps. Marginal teeth slightly
curved.
Measurements of Holotype: L 5.5, Max 0.6, Apd 0.2,
Arc 0.3, Larc 2.2.
Type Material: Holotype (dd) MCZ 293947 and 6
paratypes (2 lv, 1 dd) MCZ 293948, (3 dd) MCZ 293949.
Type Locality: Puerto Rico Trench, 11°2.2'N,
55°4.8'W, 4417-4429 m (RA' Knorr 25, stn 288).
Material Examined: Puerto Rico Trench, RA7 Knorr
25, stn 287, 13°15.8'N, 54°52.2'W, 4934-4980 m
(3 paratypes, dd); stn 288, 11°02.2'N, 55°4.8'W, 4417-
4429 m (holotype and 3 paratypes, 2 lv, 1 dd).
Etymology: Named (name in apposition) after the
RA7 Knorr (WHOI).
Distribution: Puerto Rico Trench, collected alive in
4429-4934 nr.
Remarks: When compared to the other congeners,
Striopulsellum knorr is almost straight, its apical callus
is thicker, and the striae are less evident.
Striopulsellum atlantis new species
(Figures 7, 14-15, 32-33)
Description: Shell 6 mm, slender, slightly curved,
fragile, translucent grey. Apical area smooth, with 72 fine
striae, appearing early and covering the remainder of
shell. Spaces between striae convex and surface roughly
granulose. Apex simple, preapical callus thin.
Radula (Holotype): Rachidian teeth polygonal, ante-
rior border irregular. Head of lateral teeth with four
denticles between the three main cusps, in number of
two in the internal side and one more pointed on exter-
nal side ol teeth head. Marginal teeth slightly curved,
thicker at contact points with laterals.
Measurements of Holotype: L 6, Max 0.75, Apd 0.3,
Arc 0.2, Larc 3.1.
Type Material: Holotype (lv): MCZ 293950; para-
types (2 lv) MCZ 293951.
Type Locality: Off Pernambuco, Brazil, 7°5S' S,
34° 17' W, 943-1007 m (RA7 Atlantis-II-31-167).
Other Material Examined: Off Pernambuco, Brazil,
RA7 Atlantis 11-31-167, 7°58' S - 34°17' VV, 943-1007 m,
3 lv.
Etymology: Named (name in apposition) after the
RA7 Atlantis II (WHOI).
Distribution: Know only from the type locality.
Collected alive at 943-1007 m.
Page 132
THE NAUTILUS, Vol. 125, No. 3
Figures 17-29. Species of Cadulus , Gadila , Chistikovia , and Siphonodentalium. 17-19. Cadulus unilobatus new species, holotype
(4 mm). Gulf of Gascony, 47°36.1' N, 8°40.5' W, 2360 m, BIOGAS V stn DS 65. 17. Cadulus unilobatus new species, holotype
(4 mm). Gulf of Gascony, 47°36.1' N, 8°40.5' W, 2360 m, BIOGAS V stn DS 65, lateral, dorsal and ventral views. 18. Cadulus
unilobatus new species, paratype, radula, details of the head of lateral teeth, internal view (barlO mg). 19. Radula, external view of
lateral, raehidian, and head or marginal teeth. Scale bar = 10 pm. 20, 21. Gadila cretea new species, holotype (5.5 mm), off
Fernando de Noronha, Brazil, 00° 3' S, 27°48' W, 3730-3787 m, FPV Atlantis 11-31 stn 155, lateral and dorsal views. 20. Gadila
cretea new species, radula, Gulf of Gascony, 47°27.30' N, 9°39.9' W, 4354 m, Incal, stn WS10, internal view of lateral and raehidian
teeth. Scale bar = 10 pm. 21. Gadila cretea new species, radula, same locality as of specimen in Figure 20, internal view of marginal
teeth. Scale bar = 10 pm. 22. Gadila celtica new species, holotype (10.6 mm). Gulf of Gascony, 47°32.5' N, 9°04.1' W, 2813 m,
BIOGAS II stn DS 31, lateral and dorsal views. 23-25. Chistikovia atlantica new species, holotype (16.9 mm), North Blake Plateau,
40°42.6/ N, 46°13.8/ W, 4400 m, R/V Chain 106 stn 334. 23. Lateral, ventral and dorsal Hews of the shell. 24. Radula, external view of
lateral teeth heads and raehidian teeth. 25. Internal view of marginal teeth. 26-29. Siphonodentalium coronatum new species.
26. Paratype, radula, internal view of lateral tooth, 27. Raehidian teeth, internal view. Scale bar: 100 pm. 28. Details of shell apex.
29. Holotype (16.1 mm). North Blake Plateau 40°42.6' N, 46° 13.8' W, 4400 m IW Chain 106, stn 334, lateral and dorsal views.
Remarks: Striopulsellum atlantis differs from its con-
geners by the absence of sculpture at apical sector and
less noticeable striae.
Subfamily Gadilinae Stoliczka, 1868
Genus Cadulus Philippi, 1844
Cadulus unilobatus new species
(Figure 17-19)
Description: Shell 4 mm long, translucent white, max-
imum diameter at anterior third of shell. In lateral view,
ventral side is regularly curved to apex, whereas dorsal side
shows veiy slightly concave and convex alternating lines.
In frontal view, sides are almost straight, from maximum
diameter to apex and to mouth. Growth lines well-defined,
straight. Apex wide, slightly dorsoventrally compressed,
with small, rounded edge lobe on ventral side. Preapical
callus thick, lumen dorsoventrally oval. Anterior aperture
straight, slightly dorsoventrally compressed.
Radula (Paratype): Raehidian teeth polygonal, ante-
rior border with small medial pointed process. Lateral
teeth strong, surface of head irregular, with three main
cusps, two of which are located on internal area and third
V. Scarabino and F. Scarabino, 201 I
Page 133
m
37
Figures 30-37. Species of Pulsellum and Striopulselliim.
30-31. Pulsellum filiforme new species. 30. Lateral view
and apical and oral profiles. 31. Radula of holotype, left, lateral
teeth, internal face; right, lateral faces; center, raehidian
tooth; below, marginal teeth. Scale bar = 100 pm. 32-33.
Striopulselliim atlantis new species, holotype (6 mm), oft Per-
nambuco, Brazil, 7°58' S, 34°17' W, 943-1007 m, R/VAtlantis-
11-31-167], lateral view and details of apical area. 33. Holotype,
radula, above, raehidian tooth; below, lateral tooth, internal
view. Scale bar = 100 pm. 34-35. Striopulselliim knorr new
species, holotype (5.5 mm), Puerto Rico Trench, 11°2.2' N,
55° 4. 8' W, 4417-4429 m, R/V Knorr 25, stn 288. 34. Apex in
cross-section. 35. Left, external view of lateral tooth; center,
raehidian tooth; right, lateral tooth, internal view; below, mar-
ginal tooth. Scale bar = 100 pm. 36. Striopulselliim sandersi
new species, radula, R/V Knorr 35, stn 340, left, lateral tooth,
external view; light, lateral tooth; center, internal view;
raehidian, lateral and internal views; below, marginal tooth
(bar: 100 mp). 37. Striopulselliim minimum (Plate, 1908), rad-
ula, left, views of lateral teeth; right, internal views of raehidian
teeth.
cusp wide and small, external pointed cusp. Between
cusps, four denticles of different sizes, placed at differ-
ent angles between cusps. Marginal teeth slightly curved
with thicker contact point with laterals.
Measurements of Holotype: L 4, Max 1/0.9, Dmax
1.2, Oap 0.66/0.6, Apd 0.4/0.35, Arc 0.14, Larc 1.5.
Type Material: Holotype (lv) MNHN 24335 and
2 paratypes (lv) MNHN 24336.
Type Locality: Gulf of Gascony, 47°36.1/ N, 8°40,5'
W, 2360 m (BIOGAS V stn DS 65).
Other Material Examined: BIOGAS V, stn DS 65,
47036.F N, 8°40.5' W, 2360 m, 10 lv (including holotype
and 2 paratypes), 3 dd.
Etymology: Only one lobe, to highlight the apical
feature.
Distribution: Known only from the type locality, col-
lected alive in 2360 m depth .
Remarks: Relative location of the maximum diameter
and the ventral apical lobe distinguishes Caclulus
unilobatus from other congeners reported to the area
such as C. artatus Locard, 1897 (holotype not located),
C. gracilis Jeffreys, 1877 (holotype USNM 175853, exam-
ined), C.jeffreysi (Monterosato, 1875) (yype material not
located), C. propinquus G. O. Sars, 1878 (syntypes ZMO
26071-72), and C. subfusiformis M. Sars, 1865 (syntypes
SMNH 4626). Other species presenting similar apical
structure to Caclulus unilobatus are C. teliger Finlay,
1926 (Tertiary of New Zealand) from New Zealand (holo-
type AIM; paratypes ANSF 232249; DMNH 22370,
examined), C. vincentianus Cotton and Godfrey, 1940,
from the eastern Australia (Holotype, SAM D 13730), and
an undescribed species from the Philippines.
Genus Gadila Gray, 1847
Gadila cretea new species
(Figure 20-21)
Description: Shell 5.5 mm long, opaque chalky-white,
fragile. Maximum diameter on anterior third. Dorsal side
almost straight, ventral evenly convex on anterior three-
fourths of shell, straight to apex. In dorsal view, sides
present outline similar to ventral. Apex large, simple,
circular in section, callus thick. Oral aperture oblique,
slightly compressed laterally. Growth lines oblique.
Radula (Incal: stn DS16, stn WS10): Raehidian
teeth, with large sides and pointed medial cusp. Lateral
teeth with two pointed processes on internal lace and
another on outer side, space in between with 8 denticles,
external face of the head irregular. Marginal teeth
slightly curved, keeled.
Measurements of Holotype: L 5.5, Dmax 1.6, Oap
0.7, Apd, 0,5. Arc 0.1, Larc 2,3.
Type Material: Holotype (lv) MCZ 293933 and 4
paratypes: 2 (lv), MCZ 293935, 193936; 2 (lv) MNHN
24337.
Type Locality: Off Fernando de Noronha, Brazil,
00° 3' S, 27°48' W, in 3730-3787 m (R/V Atlantis 11-31
stn 155).
Page 134
THE NAUTILUS, Vol. 125, No. 3
Material Examined: 11/ V Atlantis 11-31, stn 155, 0°3'
S, 27°4S/ W, 3730-3787 m, 6 lv (holotype and 5 para-
types); BiAgoRES: stn 126, 39°19.5' N, 33°47.0' W, 3360
nr, 4 dd; R/V Knorr 35, stn 340, 2 lv; 39° 19.5' N, 33°47'
VV, 3360 m, 1 lv; R/V Chain 106, stn 334, 40° 42. 6' N,
46° 13.8' W, 4400 m, 1 lv (paratype); stn 234, 38° 14.4' N,
70°20.3' W-38° 17.6' N, 70°22.8' W, 3264-3356 m 1 lv
(paratype); Incal, stn DS16, 47°29.8' N, 9° 33.4' W, 4268
m, 2 lv, 1 dd; stn WS09, 47°28.80' N, 9°34' VV, 4277 m, 1 lv
2 dd; stn WS10, 47°27.30' N, 9°39.9' W, 4354 m, 3 lv, 1 dd;
stn DS15, 47°33.40' N, 9°39.10' W, 4211 m, 1 lv, 2dd.
Biogas IV, stn DS55, 47°34.9' N, 9°40.9' W, 4125 m, 16 lv
(2 paratypes), 18 dd; Biogas V, stn DS66, 47°28.20' N, 9°00'
VV, 3480 m, 2 d; stn 67, 47°3T N, 9° 35' W, 4510 m, I lv;
Biogas \T, stn DS75 47°28.1' N, 9°07.8' W, 3250 m, I lv
2 d; stn DS76, 47°34.8' N, 9°33.3' W, 4228 m, 17 lv, 2 dd;
stn DS77 47°31 .8' N, 9° 34.6' W 4240 m, 2 lv.
Etymology: From Latin creteus, chalk, referring to
the surface texture on shells of this species.
Distribution: Live collected between 3264-4510
meters. Its range is amphi- Atlantic. In the Western
Atlantic it is found in the Pernambuco Basin and Puerto
Rico Trench, in Eastern Atlantic basins from the Gulf of
Gascony to the Azores.
Remarks: According to its unusual shell outline, there
is no similar species in the Atlantic Ocean to be com-
pared with G. cretea. Maximum length 5.8 mm.
Gadila celtica new species
(Figure 22)
Description: Shell 10.6 mm long, gently curved, and
tapering, polished white. Maximal diameter at anterior
third. Ventral side regularly curved, dorsal side alternat-
ing concave and convex outline. Apex simple, clearly
oblique, ventral side longer, slightly laterally com-
pressed. Apical callus thin. Mouth slightly oblique, later-
ally compressed. Growth lines easily noticeable, also
oblique. Radula unknown.
Measurements of Holotype: L 10.6, Dmax 1.7/1. 9,
Oap 1/1.1, Apd 0.5, Arc 0.33, Larc 4.1.
Type Material: Holotype (dd) MNHN 24338 and
3 paratypes (1 lv, 2 dd). MNHN 24339.
Type Locality: Celtic Sea, 47°32.5' N, 9°04.1' VV,
2813 m (Biogas II, stn DS 31).
Material Examined: Biogas II, stn DS 31 47°32.5'
N, 9°04.T W, 2813 m, 1 dd (holotype). Biogas III stn
DS 38, 47°32.5' N, 8°35.8' W, 2138 m, 2 dd (paratypes);
Biocas V, stn DS 65, 47°36.1' N, 8°40,5' W, 2360 m, I lv
(paratype).
Etymology: Named after the Celtic Sea, general area
of the type locality.
Distribution: Collected alive in 2360 meters, with
dead shells found between 1913-2813 meters. A North
Atlantic Ocean species known from the Northeastern
Celtic Sea and the Gulf of Gascony.
Remarks: Gadila celtica can be compared to
G. miamiensis (Henderson, 1920), from off Florida
(USA) in 209 fms (382 m) (holotype USNM 314772,
examined) and G. bushii (Dali, 1889) from Barbados in
100 fms (182 m) (lectotype MCZ 7745, examined). Indi-
viduals of both species are smaller than G. celtica and
have a straight apex. Gadila miamiensis has the most
similar outline, but is more curved and the oral profile is
more oblique than G. celtica, and G. bushii clearly tapers
faster and the apical area is narrower.
Family Wemersoniellidae Scarabino, 1986
Genus Chistikovia Scarabino, 1995
Chistikovia atlantica new species
(Figure 23-25)
Description: Shell 16.9 mm long, porcelain white,
solid, almost straight and clearly dorsoventrally de-
pressed. Maximum diameter near the oral aperture from
where the shell tapers regularly to apex and mouth.
Unsculptured, except for veiy oblique, conspicuous, and
close-set growth lines. Apex wide, margin veiy oblique,
dorsal side higher, callus thick. Mouth thin walled,
oblique.
Radula (Holotype): Rachidian teeth polygonal with
anterior margin simple. Lateral teeth strong, with a
sharp pointed primary cusp with irregular grooves on
the outer part of the head. Marginal teeth almost
straight, pointed at inner margin.
Measurements of Holotype: L 16.9, Max 2 5/2.9,
Dmax 4.4, Oap,1.8/1.5, Apd 1-1.3.
Type Material: Holotype (lv) MCZ 293927 and
5 paratypes (1 lv, 4 dd): 3 MNHN 24340 (1 lv, 2 dd);
1 ZMUC (dd); 1 (dd) MOM 291 146.
Type Locality: North Blake Plateau, 40°42.6' N,
46° 13.8' W, 4400 m (R/V Chain 106, stn 334).
Material Examined: R/V Chain 106, stn 334, 40°42.6'
N, 46° 13.8' W, 4400 m (1 lv, holotype); Biogas III: stn CV
23, 47°32.7' N, 8°34.2' W, 2034 m, 1 dd; Biogas IV, stn DS
55, 4 7° 34. 9' N, 9°40.9' W, 4125 m, 1 lv; Biogas V, stn DS
66, 47° 28.2' N, 9°00' W, 3480 m, 2 lv, 1 dd; Biogas VI, stn
DS 75, 47°28.1' N, 9°07.8' W, 3250 m, 1 dd; stn DS 76,
47°34.8' N, 9° 33. 3' W, 4228 m, I lv, (paratype) 1 dd;
Incal, stn DS 10, 50° 12.7' N, 13° 16.6' VV, 2719 m, 1 dd
V. Scarabino and F. Scarabino, 2011
Page 135
(paratype); stn DS 15, 47°33.4' N, 9°39.1' W, 4211 m, 1 dd
(paratype); stn WS 07, 55°00.7/ N, 12°3P W, 2884 m, I
dd. Noratlante, stn 10 CB5, 55°43/ N, 49°21' W, 3876 m,
1 dd; R/V Princesse-Alice II (191 1), stn 2964, 46°17.30'
N, 05° 42' W, 4387 m, 1 dd (paratype); Ingolf (1895), stn
38, 59° 12' N, 51° 05' W, 3521 m, 1 dd (paratype).
Etymology: Relative to the Atlantic Ocean.
Distribution: Collected alive between 3250—4400
meters, dead shells found between 2034-4400 meters. A
North Atlantic Ocean species found off the southwest and
south coast of Greenland, high latitudes of the central and
northeastern Atlantic, off Ireland and the Gulf of Gascony.
Remarks: The other species of tins genus are
Chistikovia kermadecae Scarabino, 1995 (the type spe-
cies) from Kermadec Trench, New Zealand in 2470-
4570 m (holotype ZMUC, 11.5 mm), and Chistikovia
carlessi (Lamprell and Healy (1998), as Gadila carlessi )
from northern Queensland, Australia, in 2710 nr, (holo-
type QM M040084, 19.2 mm). Chistikovia atlantica is
similar to C. carlessi , the main difference being the
location of the maximum diameter, clearly more anterior
in the latter than in the new species. Chistikovia
kermadecae has the ventral side slightly curved, not
straight as in C. atlantica and C. carlessi, and, in addi-
tion, the apical structure is better defined.
Family Siphonodentaliidae Simroth, 1894
Genus Siphonodentalium M. Sars, 1859
Siphonodentalium coronatum new species
(Figure 26-29)
Description: Shell 16.1 mm long, slightly curved, bril-
liant white, fragile. Maximal diameter near oral aperture,
gradually tapering to apex. Ventral side regularly convex,
dorsal side regularly concave from maximum diameter to
apex, almost straight to mouth. Apex notably large,
crown-like, with 12 lobes, five each on dorsal and ventral
sides and two lateral, higher and sharper due to deep
latero-ventral notches. Oral aperture oblique, slightly
dorsoventrally depressed.
Radula (Paratype, MNHN 24341): Rachidian teeth
with one cusp on lateral sides and three smaller ones on
anterior side, two of which ventrally placed and one
centro-dorsally placed. Lateral teeth with large anterior
third, curved, with two pointed processes on dorsal lace
and one smaller on one side and another on other side,
with smooth intervening gap. Marginal teeth straight.
Measurements of Holotype: L 16.1, Max 2.5, Oap
2. 0/1. 9, Dmax 4.8, Apd 1.6, Arc 0.6, Larc 7.2.
Type Material: Holotype (lv) MCZ 293926 and 2
paratypes (lv) MNHN 24341.
Type Locality: North Blake Plateau, 40°42.6' N,
46° 13.8' W, 4400 m (R/V Chain 106, stn 334).
Other Material Examined: R/V Chain 106, stn 334,
40°42.6' N, 46° 13.8' VV, 4400 m, (lv) holotype; Biogas II,
stn DS 23, 46°32.8' N, 10°21' W, 4734 m, 1 lv (paratype);
Biogas V, stn DS 69, 44°21.9' N, 4°52.4' W, 4510 m, 1 lv
(paratype); stn DS 82, 44°25.4' N, 4°52.2' W, 4462 m, 1
lv; stn CP 19, 44°24.9' N, 4°51,3' W, 4434 m I lv; Incal,
stn WS 08, 47°30.5' N, 9°32.9' W, 4287 m, 1 dd.
Etymology: Specific epithet refers to the crown-like
shape of the apex.
Distribution: Collected alive between 4510—4734
meters, dead shells from 4287 meters. A North Atlantic
Ocean species found southwest of Ireland, the Gulf ol
Gascony and oil Portugal.
Remarks: Three other species of Siphonodentalium
are cited for the northeastern Atlantic: Siphonoden-
talium lobatum (Sowerby, I860) (syntypes NHMUK
1951.2.14.4-5, examined), Siphonodentalium laubieri
Bouehet and Waren, 1979 (holotype and paratypes at
MNHN, examined), and Siphonodentalium spectabilis
(Verrill, 1885) (lectotype USNM 37935, examined). The
first species is more curved and tapering than the new
species, and S. laubieri has only four lobes and notches.
Siphonodentalium laubieri is known only from the Nor-
wegian Sea and the Laptev Sea in 2212-2502 m depth
(Sahlmann et ah, 2009), whereas S. lobatum has a large
geographic and bathymetric distribution in the northern
Atlantic from off British Islands to Spitzbergen, Arctic
Sea and Barents Sea in 38-3100 m depth (Ivanov and
Zarubina, 2004). Siphonodentalium spectabilis (Verrill,
1885), occurs in the northwestern Atlantic at 2780 m
depth and has amphi-Atlantic distribution; it is much
more tapering that the other species and have distinct
arrangement and size of apical lobes.
ACKNOWLEDGMENTS
The authors highly appreciate the continuous support and
advice of Philippe Bouehet, Virginie Heros, Philippe
Maestrati, and Jean-Pierre Rocroi (MNHN, Paris). We
also acknowledge the help received from Michele Bruni
and Christian Carpine (MOM), Adam Baldinger (MCZ),
Kathie Way (NPIMUK, London), Ole S. Tendal and
Thomas Schiotte (ZMUC) for access to collections and
other curatorial support. To Bernard Metivier (MNHN,
Paris) for his help during the early stages of the present
study. Yuri Kantor (Russian Academy of Science, Mos-
cow) helped with the first draft of the manuscript,
Mike Severns and Pauline Fiene revised the English,
and Barbara Buge (MNHN, Paris) assisted with SEM
illustrations. For study material, the authors are
deeply indebted to the late Howard S. Sanders
(ex-WHOI) and Michel Segonzae (ex-IFREMER).
Special thanks are due to Bernd Sahlmann (Haus der
Natur-Cismar) and John Healy (QM) for their valuable
comments and suggestions.
Page 136
THE NAUTILUS, Vol. 125, No. 3
LITERATURE CITED
Bouchet, P. and A.Waren. 1979. The abyssal molluscan fauna
of the Norwegian Sea and its relation to other faunas.
Sarsia 64: 211-243.
Caetano, C.H.S., V. Scarabino, and R.S. Absalao. 2006.
Scaphopoda (Mollusca) from the Brazilian continental
shelf and upper slope (13° to 21°S) with descriptions of
two new species of the genus Cadulus Philippi, 1844.
Zootaxa 1267: 1-47.
Cotton, B.C. and EK. Godfrey 1940. The molluscs ol South
Australia Part II: Scaphopoda, Cephalopoda, Aplacophora
and Crepipoda. Adelaide, Government Printer, pp. 315-600.
Dali, W.H. 1881 . Reports on the results of dredging, under the
supervision of Alexander Agassiz, in the Gull of Mexico
and in the Caribbean Sea (1877-78), by the United States
Coast Survey Steamer “Blake”, Lieutenant-Commander
C.D. Sigsbee, U.S.N., and Commander J.R. Bartlett,
U.S.N., commanding. XV. Preliminary report on the
Mollusca. Bulletin of the Museum ol Comparative Zool-
ogy at Harvard College 9 (2): 33-144.
Dali, W.H. 1889. Reports on the results of dredging, under the
supervision of Alexander Agassiz, in the Gulf of Mexico
(1877-78) and in the Caribbean Sea (1879-80), by the
U.S. Coast Survey Steamer “Blake”, Lieut. -Commander
C.D. Sigsbee, U.S.N., and Commander J.R. Bartlett,
U.S.N., commanding. XXIX. Report on the Mollusca.
Part 2, Gastropoda and Scaphopoda. Bulletin of the
Museum of Comparative Zoology at Harvard College 18:
1-492, pis. 10-40.
Deshayes, G.P. 1825. Anatomic et monographic du genre
Dentale. Memoires de la Societe d’Histoire Naturelle de
Paris 2: 321-378, pis 15-18.
Finlay, H.J. 1926. A further commentary on New Zealand mol-
luscan systematic^. Transactions and Proceedings of the
New Zealand Institute, Wellington 57: 320-485, pis. 18-23.
Henderson, J.B. 1920. A monograph of the East American
scaphopod mollusks. United States National Museum
Bulletin 111: 1-177, 20 pis.
Ivanov, D.L. and E.M. Zarubina 2004. Distribution of
scaphopod molluscs (Mollusca, Scaphopoda) in the North
Atlantic and Arctic oceans, based on materials of Russian
and Soviet expeditions. Rutheniea 14: 89-104.
Jeffreys, J.G. 1877. New and peculiar Mollusca of the order
Solenoeonchia procured in the " Valorous ” expedition.
Annals and Magazine of Natural Histoiy (4) 19: 153-158.
Jeffreys, J.G. 1883. On the Mollusca procured during the
"Lighting” and “ Porcupine ” expeditions, 1868-70.5. Pro-
ceedings of Scientific Meetings of the Zoological Society
of London, 1882: 656-687, pi. 49-50.
Knudsen, J. 1964. Scaphopoda and Gastropoda from depths
exceeding 6000 meters. Galathea Report 7: 125-136.
Lamprell, K.L. and J.M. Healy. 1998. A revision of the
Scaphopoda from Australian waters (Mollusca). Records
of the Australian Museum, Supplement 24: 1-189.
Locard, A. 1897-1898. Mollusques Testaees. In: Expeditions
Scientifiques du Travailleur et du Talisman pendent les
annees 1880-1883. Masson, Paris, 2: 515 pp., 18 pis.
Monterosato, T.A. di. 1875. Nuova Rivista delle conchiglie
Mediterranee. Atti dell’Accademia Palermitana di
Scienze, Lettre e Belle Arti (2) 5: 1-50.
Niekles, M. 1955. Seaphopodes et Lamellibranches recoltes
dans l'Ouest Africain. Atlantide Report. Scientific Results
of the Danish Expedition to the Coasts of Tropical West
Africa 1945-1946 3: 93-237.
Niekles, M. 1979. Seaphopodes de l’Ouest-Africain (Mollusca,
Scaphopoda). Bulletin du Museum National d’Histoire
Naturelle, Section A. Zoologie, Biologie et eeologie
Animales ( series 4) 1(1): 41-77, 1 pi.
Plate, L. H. 1908. Die Scaphopoden der Deutsehen Siidpolar-
Expedition. Deutsche Siidpolar Expedition 1901-1903,
10, Zoologie 2: 1-6.
Sahlmann, B., I. Richling, and V. Wiese. 2009. Note on the
Siphonodentalium species from Arctic waters (Mollusca,
Scaphopoda). Schriften zur Malakozoologie Cismar, 25:
47-52.
Sars, G.O. 1878. Bidrag til Kundskaben om Norges arktiske
Fauna. I. Mollusca regionis Arcticae Norvegiae. Oversigt
over de i Norges arktiske region forkommende Bloddyr.
Universitets-Program Christiana forste halvaar 1878 [1]:
xiii + [iii] + 466 pp, 34 pis (shells); IS pis.
Scarabino, V. 1979 (ms). Les seaphopodes bathyaux et abysaux
de l’Atlantique occidental (Systematique, distribution,
adaptations) nouvelle classification pour l’ensemble de la
classe. Dr. thesis, Universite d’Aix Marseille II, 154 pp.
Scarabino, V. 1986a. Nuevos taxa abisales de la elase
Scaphopoda (Mollusca). Comunicaciones Zoologicas del
Museo de Historia Natural de Montevideo 11 (155): 1-19.
Scarabino, V. 1986b. Systematies of Scaphopoda (Mollusca),
I. Three new bathyal and abyssal taxa of the order
Gadilida from South and North Atlantic Ocean.
Comunicaciones Zoologicas del Museo de Historia Natu-
ral de Montevideo 11 (161): 1-15, pis. 1-3.
Scarabino, V. 1995. Scaphopoda of the tropical Pacific and
Indian Oceans, with descriptions of 3 new genera and 42
new species, in Bouchet P. (ed.), Resultats des Campagnes
MUSORSTOM, vol. 14, Memoires du Museum national
d'Histoire naturelle 167: 189-379.
Scarabino, V. and H. Caetano 2008. On the genus Hetero-
schismoides Ludbrook, 1960 (Scaphopoda: Gadilida,
Heteroschismoidinae), with description of two new spe-
cies. The Nautilus 122: 171-177.
Scarabino, V. and F. Scarabino 2010. A new genus and thirteen
new species of Scaphopoda (Mollusca) from the tropical
Pacific Ocean. Zoosystema 32(3): 409-423.
Steiner, G. and A.R. Kabat 2004. Catalogue of species-group
names of Recent and fossil Scaphopoda (Mollusca).
Zoosystema 26 (4): 549-726.
Verrill, A.E. 1885. Results of the explorations made by the
steamer Albatross off the northern coast of the United
States in 1883. Annual Report of the Commissioner of
Fish and Fisheries for 1883: 503-699, pis. 1-14.
Watson, R.B. 1879. Mollusca of the H.M.S. Challenger Expe-
dition. II. The Solenoeonchia, comprising the genera
Dentalium, Siphodentalium, and Cadnlus. Journal of the
Linnean Society of London 14 (78): 506-529.
THE NAUTILUS 125(3): 137-149, 201 1
Page 137
A new genus of Cretaceous margaritine gastropod (Turbinidae)
from the northeastern Pacific Ocean
Richard L. Squires
Department of Geological Sciences
California State University
Northridge, CA 91330-8266, USA
and
Invertebrate Paleontology1
Natural History Museum of Los Angeles Count)'
Los Angeles, CA 90007 USA
[email protected]
ABSTRACT
Igonoia , a new genus of a margaritine vetigastropod, is recog-
nized from Lower and Upper Cretaceous rocks in the northeast-
ern Pacific, in the region extending from Vancouver Island,
British Columbia, to southern California. Eight species are
known, five are new: the early late Albian I kieli new species
and 1. shastana new species; the late Cenomanian I onoensis
new species and I stewarti (Murphy and Rodda, 1960) new
combination; the late Turonian /. vacca new species; the
Santonian I. occidentalis (Whiteaves, 1903) new combination;
and the Maastriehtian I. angulata (Gabb, 1869) new combina-
tion and I. muiri new species. Igonoia is presently known to be
endemic to the study area. Specimens are found predominantly
in northern California, in fine-grained siliciclastic sandstones
that were deposited in warm-temperate, shallow-marine waters.
Specimens are most numerous in Santonian rocks.
Additional keywords: Mollusea, Margaritinae, fossil, endemic,
temperate waters
INTRODUCTION
Small trochiform vetigastropods present in Cretaceous
shallow-marine rocks of the northeastern Pacific are
poorly documented in the literature. In the authors on-
going process of attempting to establish which genera
are present, a new genus of margaritine vetigastropod
was detected in museum collections. The new genus
Igonoia occurs in both Lower and Upper Cretaceous
shallow-marine rocks in the region extending from Van-
couver Island, British Columbia, Canada to southern
California. Specimens are locally abundant but are
otherwise uncommon faunal elements. There are eight
known species of the new genus, and five of them are
new. The three previously named ones were originally
1 Research Associate
assigned to other similar-looking genera. In addition
to erecting the new genus, the main pin-poses of this
paper are to describe its species and to record their
biostratigraphic succession. The areas where the spec-
imens were collected are shown on Figure 1, and their
designations (e.g.. Area 3) are used throughout the
paper. The details of the type localities of the species
are given in the Appendix. The temporal distributions
of the species are shown in Ligure 2. Paleogeographic
and paleoclimatic conditions of the new genus are
discussed.
Included in this paper are supplementary descrip-
tions (based on new examination ot type material)
and refined biostratigraphic records of the three previ-
ously named species: Igonoia angulata (Gabb, 1869);
Igonoia occidentalis (Whiteaves, 1903); and I. steward
(Murphy and Rodda, 1960). New information about
the type locality of I. angulata is provided, and its
type material consists of two species: 1. angulata and
I. muiri new species. The first photographic views of
the type material of I. occidentalis are provided. Addi-
tional photographic views of I. steward are given, and
its type material consists of two species: I. steward and
I. ononensis new species.
This study was based on 260 specimens borrowed
from museums having extensive collections of northeast
Pacific Cretaceous fossils. Most of the specimens
are stored in the Invertebrate Paleontology Collection at
the Natural History Museum of Los Angeles County.
The base and umbilical areas of the specimens are
commonly encased in well-cemented, fine-grained
siliciclastic sandstone. In order to remove this material,
it was necessary to use a high-speed drill and diamond-
coated grinding wheels, followed by the careful use
of hand-held, very sharp needles. Preservation of shell
material is generally good. Protoconch and early
teleoconeh whorls are very rarely present, and mostly or
completely decollated. The one moderately well pre-
served protoconch with its shell intact was sputter-coated
Page 138
THE NAUTILUS, Vol. 125, No. 3
Figure 1. Localities map and latitudinal distribution of study
area species of Igonoia.
prior to being imaged by means of an Hitachi S-3000N
SEM (scanning electron microscope).
Abbreviations used for catalog and locality numbers
are: ANSP: Academy of Natural Sciences, Philadelphia;
GSC: Geological Survey of Canada, Ottawa; LACMIP:
Natural History Museum of Los Angeles County, Inver-
tebrate Paleontology; UCLA: University of California,
Los Angeles (collections now housed at LACMIP);
USGS: United States Geological Survey, Menlo Park,
California (collections now housed at University of Cali-
fornia, Berkeley, Museum of Paleontology).
SYSTEMATIC PALEONTOLOGY
Clade Vetigastropoda Salvini-Plawen, 1980
Family Turbinidae Rafinesque, 1815
Subfamily Margaritinae Stoliczka, 1868
Remarks: This subfamily was previously generally
believed to be a trochid subfamily (e.g., Fretter and
Graham, 1977; Hickman and McLean, 1990), but, based
on molecular studies ol extant taxa by Williams et al.
(2008), it has been recently and provisionally recognized
to be a turbinid. Williams et al. (2009) demonstrated that
Margaritinae is not monophyletic.
Ma
Figure 2. Geologic ranges of the studied species of Igonoia.
Ages of stage boundaries from Gradstein et al. (2004).
Genus Igonoia new genus
Type Speeies: Igonoia onoensis new species, late
Cenomanian, northern California.
Description: Shell size veiy small to medium small
(4.5 to 13 mm height). Shell height commonly slightly
less or approximately same size as shell diameter, rarely
greater than diameter. Trochiform. Phaneromphalous.
Spire low to moderately high, 43% to 59% of shell
height. Pleural angle 80° to 95°. Protoconch smooth
(most likely less than one whorl), transition to teleoconch
unclear. First teleoconch whorl showing spiral threads
before showing any axial ribs. Teleoconch four to six
convex whorls; base usually rounded. Suture sunken
and commonly groove-like. Teleoconch ornament of spi-
ral ribs (beaded or unbeaded), commonly crossed by
raised growth lines, especially on ramp/shoulder areas;
shells can be nearly smooth. Shoulder rounded. Aper-
ture circular. Peristome discontinuous. Last whorl large,
base convex or keeled. Umbilicus open and deep,
bounded by beaded weak to moderately strong spiral
rib; umbilical wall can have cancellate ornament where
growth lines intersect spiral ribs.
Geologic Age: Early late Albian to “mid” Maastrichtian
(early late to late middle).
Etymology: Named for the adjacent towns of Igo and
Ono in the Bald Hills area, Shasta County, northern
California.
Remarks: After careful examination of each specimen,
only two were found with remnants of their protoconch
R. L. Squires, 2011
Page 139
present. Only one of these, a specimen ol I. onoensis
(Figures 21-22), has the shell intact on its protoconch,
whereas the other, a specimen of I. shastana (Figure 14),
is missing its shell on the protoconch and adjacent early
teleoconch whorls (only an internal mold is present).
Gabb (1869) originally assigned the material that
is now known to comprise I. cingulata (Gabb, 1869)
and I. muiri new species to genus Margaritella Meek
and Hayden, 1860, a nomen dubium (not Margaritella
Thiele, 1891).
The other previously named species of Igonoia were
assigned eventually by other workers (Whiteaves, 1903;
Stewart, 1927; Murphy and Rodda, 1960) to the
solarielline genus Solariella Wood, 1842. This is not
surprising, given that Hickman and McLean (1990)
reported that solariellines are known to have produced
convergences with margaritine shells. Fossil species of
Solariella have been characterized (e.g., Davies, 1971;
Kiel and Bandel, 2001) as having a continuous peri-
stome, spiral cords that can be strongly noded, a keel on
the base of the shell, and a very prominent spiral cord on
the rim of the umbilicus. Igonoia differs from Solariella
by having a discontinuous peristome, sunken suture,
shoulder with raised growth lines with or without axially
aligned beads, whorl sides with or without axially aligned
beads, and commonly an absence of a very prominent
spiral rib bordering the umbilicus.
Igonoia is similar to genus Margarites J. E. Gray, 1847
(ex Leach ms), but Igonoia differs by having a ramp or
shoulder with raised growth lines with or without axially
aligned beads, whorl sides with or without axially beads,
and commonly a less prominent spiral rib bordering the
umbilicus.
Igonoia kieli new species
(Figures 3-8)
Diagnosis: Small-sized Igonoia , ramp slightly con-
cave, moderately wide, and bearing up to three beaded
spiral ribs (posteriormost ones more prominent); whorl
sides smooth or with some prominent growth lines pre-
sent and extending posteriorward across ramp.
Description: Shell size small (up to height 8 mm,
diameter 9 mm, same specimen). Shell height
Figures 3-16. Albian species of Igonoia new genus. Specimens coated with ammonium chloride. 3-8. Igonoia kieli new species. 3-7.
Holotype LACMIP 13682, LACMIP loc. 22900, height 8.7 mm, diameter 9.4 mm. 8. Paratype LACMIP 13683, LAGMIP loc. 22900,
height 6.6 mm, diameter 8.4 mm. 9-16. Igonoia shastana new species. 9, i 1, 13, 14, 15. Holotype LACMIP 13684, LACMIP loc.
28757, height 6.3 mm, diameter 6.2 mm. 10, 12, 16. Paratype LACMIP 13685, LACMIP loc. 24369, height 7.5 mm, diameter 8.1 mm.
Page 140 THE NAUTILUS, Vol. 125, No. 3
approximately 92% of shell diameter. Trochiform.
Phaneromphalous. Spire moderately elevated, approx-
imately 54% of shell height. Pleural angle approxiately
87°. Protoconch unknown. Teleoconch approximate-
ly five convex whorls. Suture impressed. Ramp slightly
concave and moderately wide. Upper spire whorls with
two subsutural and equal-strength beaded spiral ribs;
penultimate whorl with three beaded spiral ribs, all
nearly equal strength. Ornament on last whorl with six
spiral ribs, posteriormost two beaded (elongate beads)
and equal strength, anteriormost four ribs unbeaded
and weaker strength. Ornament on whorl sides obso-
lete or with some widely spaced, prominent growth
lines present and extending posteriorward across ramp.
Base demarcated by low angulation. Ornament on base
consisting of many closely spaced unbeaded spiral ribs,
anteriorward becoming broader and beaded toward
umbilicus and producing cancellate ornament. Aper-
ture subcircular. Outer and inner lips thin. Peristome
discontinuous. Umbilicus wide, its rim angulate and
demarcated by moderately strong and beaded spiral
rib. Umbilical wall with stronger cancellate ornament
than area immediately posterior to umbilical rim.
Growth lines prosoeline, tilted 28° from vertical.
Holotype: LACMIP 13682, height 8.7 mm, diameter
9.4 mm.
Paratype: LACMIP 13683, LACMIP loc. 22900.
Type Locality: LACMIP 22900, Bald Hills, Ono area,
Shasta County, northern California (Area 3).
Geologic Age: Early late Albian (upper Oxytropidoceras
packardi ammonite zone).
Distribution: Buclden Canyon Lormation, Chickabally
Mudstone Member, Bald Hills, vicinity of Ono, Shasta
County, northern California (Area 3); reworked
Albian fossils in lower Turanian Venado Sandstone
just south of Sites, Colusa County, northern California
(Area 5).
Etymology: Named for Steffen Kiel who has made
significant contributions to the study of Cretaceous
vetigastropods.
Remarks: The examined material consisted of six
specimens: live from loc. 22900 (type locality) and one
from loc. 24369. Preservation is generally good. Igonoia
kieli co-occurs with I. shastana new species at Iocs.
22900 and 24369. Locality 22900 is from the upper part
of the Chickabally Mudstone Member, and Murphy
(1956: figs. 3-5) plotted this locality (as loc. 2900) on
his columnar section and on his geologic maps. On his
figure 6, he plotted this locality near the top of the
Oxytropidoceras packardi ammonite zone, and on the
biostratigraphic chart shown by Murphy et al. (1969:
fig. 2), it appears that this part of the zone is early late
Albian in age.
The single specimen of I. kieli from loc. 24369 is from
the Venado Sandstone. This member is of early Turanian
age and contains reworked Albian fossils (Squires and
Saul, 2004).
Igonoia kieli differs from I. shastana by slightly larger
size, subsutural rib, much less uniform ornament, and
obsolete ornament on the sides of the whorls. Igonoia
kieli is similar to 7. muiri new species, but I. kieli differs
by having larger size, subsutural rib much weaker on
spire whorls, absence of flat ramp, less angulate shoul-
der, more spiral ribs on shoulder, and much less promi-
nent growth lines incising the spiral ribs on the shoulder.
Igonoia shastana new species
(Ligures 9-16)
Diagnosis: Small-sized Igonoia , spiral ribs numerous
and uniformly noded except on anterior half of last whorl
and on posterior part of base of last whorl.
Description: Shell size small (up to height 7 mm,
diameter 8.5 mm, same specimen). Shell height
approximately 92% of shell diameter. Trochiform.
Phaneromphalous. Spire moderately elevated, approxi-
mately 50% of shell height. Pleural angle approxi-
mately 84°. Protoconch most likely less than one
whorl. Teleoconch approximately 4.5 whorls. Suture
impressed. All whorls with rounded sides. Ornament
obsolete on two earliest whorls. Ornament on
remaining whorls consisting of many closely spaced
spiral ribs, beaded except on anterior half of last whorl
and on posterior part of base of last whorl. Base demar-
cated by low angulation. Spiral ribs on base
anteriorward becoming wider and bearing beads that
become elongate near umbilical rim. Aperture circular.
Outer and inner lips thin. Peristome probably dis-
continuous. Umbilicus wide, its rim angulate and
demarcated by spiral rib wider and more strongly
beaded than adjacent spiral ribs on base. Umbilical
wall cancellate. Area abaxial to umbilical rim with
irregularly spaced incised growth lines. Growth lines
prosoeline, tilted approximately 35° from vertical.
Holotype: LACMIP 13684, height 6.3 mm, diameter
6.2 mm.
Paratype: LACMIP 13685, LACMIP loc. 24369.
Type Locality: LACMIP 28757, Thompson Canyon,
Yolo County, northern California (Area 6).
Geologic Age: Early late Albian (upper Oxytropidoceras
packardi ammonite zone).
Distribution: Budden Canyon Formation, upper
Chickabally Mudstone Member, Bald Hills, Ono area,
Shasta County, northern California (Area 3); reworked
Albian fossils in upper Cenomanian “Antelope” shale
(upper part), just south of Sites, Colusa County, northern
California (Area 5); and reworked Albian fossils in
Turanian Venado Sandstone, Thompson Canyon, north
R.L. Squires, 2011
Page 141
of Putah Creek, Monticello Dam area, Yolo County,
northern California (Area 6).
Etymology: Named for its occurrence in Shasta
County, northern California.
Remarks: The examined material consisted of eight
specimens: three from USGS loc. M-177 (see Squires
and Saul [2004: 500] for locality details); two from
LACMIP loc. 22900; two from 24369; and one from
28757 (type locality). Distinction between the pro-
toconch and earliest teleoconch whorl cannot be made
because the shell is missing in these areas.
Igonoia shastana co-occurs with I. kieli new species at
locality 22900 in the upper part of the Chickabally Mud-
stone Member, and both co-occur as reworked Albian
material at loc. 24369 in the Venado Sandstone. The
USGS loc. M-177 specimens also represent reworked
material but are from the upper part of the “Antelope”
shale in beds approximately 23 to 30 m below the base of
the overlying Venado Sandstone.
According to the LACMIP records, loc. 28757 is in the
Yolo Formation. On Matsumotos (I960: fig. 9) map, this
locality plots near the contact between this formation
and the underlying Venado Sandstone. Locality 28757 is
most likely located in the Venado Sandstone, thus the
specimens are also reworked material.
Igonoia shastana and 7. kieli are somewhat similar in
that their early whorls are smooth and a portion of their
last whorl has either diminished or obsolete ornament.
Igonoia shastana differs from 7. kieli by slightly smaller
size, absence of a subsutural rib, meh more uniform
ornament, and ornament on the sides of the whorls.
No known specimens show intermediate morphology
between the two species. Future collecting might reveal
such specimens, and, hence, the two species could be
shown to be conspecific.
Igonoia onoensis new species
(Figures 17-23)
Sollariella stewarti Murphy and Rodda, 1960: 839 (in part).
Diagnosis: Small-sized Igonoia , ramp rounded and
covered by four to five spiral ribs bearing prominent
beads arranged in rows, whorl sides with weak and
unbeaded spiral ribs, and basal ornament strong, includ-
ing wide umbilical cord.
Description: Shell size small (up to height 7 mm,
diameter 7 mm, same specimen), glossy surface. Shell
height approximately same as shell diameter. Trochiform.
Phaneromphalous. Spire moderately elevated, approxi-
mately 56% of shell height. Pleural angle 92°. Protoconch
smooth (most likely less than one whorl), transition to
teleoconch unclear; first half whorl of shell measures
0.38 mm (380 pm) diameter. Teleoconch approximately
five whorls. Earliest teleoconch whorl with two equal-
strength spiral threads (one on shoulder and one just
anterior to shoulder) and three to four much weaker
spiral threads; after another 180°, weaker spiral ribs dis-
appear but spiral threads (two) on or near shoulder con-
tinue and become incipiently beaded. All teleoconch
whorls with rounded sides. Suture impressed. Ramp
rounded, narrow, and covered by four to five equant
spiral ribs bearing prominent elongate beads arranged in
rows. Ornament on whorl sides consisting of weak (rarely
obsolete) unbeaded spiral ribs. Aperture subcircular.
Outer and inner lips thin. Peristome probably discontin-
uous. Base ornamented with several strong, moderately
narrow spiral ribs. Umbilicus wide, its rim angulate and
demarcated by nodulose wide spiral rib. Area abaxial to
umbilical rim widi irregularly spaced incised growth lines.
Growth lines prosocline, tilted 35° from vertical.
Holotype: LACMIP 13686, height 7.2 mm, diameter
7.2 mm.
Paratype: LACMIP 13687, LACMIP loc. 23476.
Type Locality: LACMIP 23476, Bald Hills, Shasta
County, northern California (Area 3).
Geologie Age: Late Cenomanian (slightly older than
Igonoia stewarti).
Distribution: Budden Canyon Formation, Bald Hills
Member, Bald Hills, Ono area, Shasta County, northern
California (Area 3).
Etymology: Named for the town of Ono, Shasta
County, California.
Remarks: Examined material consisted of four spec-
imens (one early? adult and three juveniles), all from
LACMIP loc. 23476 in the middle part of the Bald Hills
Formation. One of the juveniles has its protoconch intact
(Figures 21-22). Murphy and Rodda (1960) did not rec-
ognize that the specimens they identified as S. stewarti
from LACMIP loc. 23476 represent a different species
than S. stewarti. Although both species occur in the Bald
Hills Member, S. onoensis is found slightly downseetion
from S. stewarti.
Murphy and Rodda (I960: fig. 2) reported that the
aporrhaid gastropod Arrhoges ( Latiala ) califomicus
(Gabb, 1864) occurs at LACMIP loc. 23476. Popenoe
(1983) assigned this aporrhaid a Cenomanian? to early
Turanian age.
The new species is similar to Igonoia stewarti but
7. onoensis is characterized by having prominently
beaded spiral ornament, whereas 7. stewarti is character-
ized by having weaker ornament consisting of raised
growth lines. In addition. 7. onoensis differs by having
smaller size, more sloped ramp, beaded spiral ribs on the
ramp, nearly obsolete spiral ribs on sides of the whorls,
and slightly stronger ornament on the base.
The new species most resembles Igonoia main new
species but differs by having a larger size, no subsutural
cord, rounded shoulder (rather than angulate), and shoul-
der demarcated by several equal-strength spiral ribs,
rather than by only two spirals, with the posteriormost
Page 142
THE NAUTILUS, Vol. 125, No. 3
Figures 1 7-29. Cenomanian species of Igonoia new genus. Specimens coated with ammonium chloride. 17-23. Igonoia onoensis
new species. 17, 18, 19, 20, 23. Holotype LACMIP 13686, LACMIP loc. 23476, height 7.2 mm, diameter 7.2 mm. 21-22. Paratype
LACMIP 13687, LACMIP loc. 23476, height 3 mm, diameter 4.5 mm. 21. Abapertural view of spire tip. 22. SEM image of left-
lateral view of protoconch and early teleoconeh whorls, width of view 2.5 mm. 24-29. Igonoia stewarti (Murphy and Rodda, 1960).
24, 25, 27, 28, 29. Holotype LACMIP 9821, LACMIP loc. 23763, height 8 mm, diameter 8.9 mm. 26. Hypotype LACMIP 13688,
LACMIP loc. 23465, height 6.2 mm, diameter 6.9 mm.
the strongest. In addition, on I. onoensis , the ornament on
the base is not as weak abaxially.
Igonoia stewarti (Murphy and Rodda, I960) new
combination
(Figures 24-29)
Solariella stewarti Murphy and Rodda, 1960: 839 (in part),
pi. 103, figs. 4-5.
Diagnosis: Small-sized Igonoia with spire low, shoul-
der rounded with numerous very line to fine spiral ribs
crossed by prominently raised growth lines, basal orna-
ment weak, and umbilical cord moderately strong.
Description: Shell size small (up to height 8 mm, di-
ameter 9.2 mm, same specimen), glossy surface. Shell
height approximately 89% of shell diameter. Trochiform.
Phaneromphalous. Spire low, approximately 45% of
shell height. Pleural angle 92°. Protoconch unknown.
Teleoconeh approximately six whorls, all with rounded
sides. Suture nearly eanaliculated. Shoulder rounded with
three to five spiral ribs (noded), commonly very weak
to weak. Spiral ornament elsewhere (on sides of whorls)
consisting of numerous and closely spaced, weak to rarely
moderately strong spiral riblets with tendency to being
faint to obsolete. Shoulder with numerous and closely
spaced, weak to moderately strong ribs coincident with
R.L. Squires, 2011
Page 143
prominently raised growth lines. Aperture subcircular.
Outer and inner lips thin. Peristome probably discontin-
uous. Base ornamented by numerous, very weak spiral
riblets. Umbilicus rim angulate and demarcated by some-
what nodulose, moderately strong to strong spiral rib. Area
just posterior to umbilical rim with irregularly spaced ribs.
Area just abaxial to umbilical rim cancellate on some speci-
mens. Umbilical wall cancellate. Growth lines prosocline,
tilted 35° from vertical.
Holotype: LACMIP 9821 [= UCLA 28622], height
8 mm, diameter 8.9 mm.
Para type: LACMIP 9822 (unfigured here) [= UCLA
28683], LACMIP loc. 23763.
Type Locality: LACMIP 23763, Bald Hills, Shasta
County, northern California (Area 3).
Geologic Age: Late Cenomanian (slightly younger
than I. onoensis ).
Distribution: Budden Canyon Formation, Bald Hills
Member, Bald Hills, Ono area, Shasta County, northern
California (Area 3).
Remarks: The examined material consisted of nine
specimens: four from LACMIP loc. 23464, three from
LACMIP loc. 23465, and five from LACMIP loc. 23763.
Preservation is good. Two of the specimens from
LACMIP locality 23465 have stronger spiral ribs than
normal for this species, and one of these specimens is
illustrated in Figure 26. These variants were not men-
tioned by Murphy and Rodda (1960).
Murphy and Rodda (1960: 839) believed that
S. stewarti is represented by some of the type material
of Igonoia angulata. During this present investigation,
this latter material was studied and found to consist
of two species: I. angulata (Gabb) and I muiri new
species. The latter species does resemble I. stewarti
(see I. muiri for a comparison).
Murphy and Rodda (I960) did not recognize that the
specimens they identified as Sola della stewarti from
LACMIP loc. 23476 represent a different species. In
this present report, these specimens are identified as
Igonoia onoensis new species, which is found in the
middle part of the Bald Hills Member of the Budden
Canyon Formation.
Igonoia stewarti is present in the upper half of the
Bald Hills Member of the Budden Canyon Formation
(Murphy and Rodda, 1960: 839, text-fig. 2). The associ-
ated macrofauna, especially the species of the gastro-
pods Gyrodes greeni Murphy and Rodda, I960 and
Gijrodes allisoni Murphy and Rodda, 1960, are indica-
tive of a late Cenomanian age (Popenoe et al., 1987:
fig. 1). Murphy and Rodda (1960: fig. 2) also reported
that the ammonite Desmoceras ( Pseudouhligella ) cf.
barri/ae was found with S. stewarti at LACMIP loc.
23464, and Matsumoto (1959: 7) reported that tins
ammonite “seems to occur in the Cenomanian.” Mur-
phy and Rodda (1960) reported the ammonite Turnlites
dillen from loe. 23464. Rodda (1959) assigned this
ammonite a Cenomanian age. Murphy and Rodda
(1960) also reported that S. stewarti is also present
in the “formation” that overlies the Bald Hills “forma-
tion.'' Using the revised stratigraphy of Murphy et al.
(1969), this overlying “formation” is the Gas Point Mem-
ber (Cenomanian to Turanian) of the Budden Canyon
Formation. The present author, however, was unable to
confirm a Gas Point Member occurrence of I. stewart.
Igonoia vacca new species
(Figures 30-34)
Diagnosis: Small-sized Igonoia with spire low and
teleoconch bearing widely spaced, narrow spiral ribs
crossed by widely spaced and raised growth lines, espe-
cially on rounded shoulder.
Description: Shell size small (up to height 7 mm,
diameter 8 mm, same specimen). Shell height slightly
less or approximately same size as shell diameter.
Troehiform. Phaneromphalous. Spire low, approxi-
mately 46% of shell height. Pleural angle 85°.
Protoconch unknown. Teleoconch approximately six
convex whorls. Suture impressed; sutural area flattish
on penultimate whorl. Teleoconch approximately four
convex whorls. Shoulder area rounded. Ornament
consisting of widely spaced, narrow spiral ribs; spire
whorls with five riblets; spiral ribs on last whorl some-
what clustered together: two near suture, one on
shoulder, four to five on sides of whorls, and numerous
ones on base. Spiral ribs on base gradually become
slightly stronger near umbilical rim where raised
growth lines cross spiral ornament. Aperture circular.
Outer and inner lips thin. Peristome discontinuous.
Umbilicus moderately wide, its rim angulate and
demarcated by beaded spiral cord with beads grading
into nodes toward anterior end of columella. Umbilical
wall cancellate. Growth lines prosocline, tilted 30°
from vertical.
Holotype: LACMIP 13689, height 5.6 mm, diameter
6.6 mm.
Type Locality: LACMIP 25421, east of Redding,
Shasta County, northern California (Area 2).
Geologic Age: Late Turanian.
Distribution: Redding Formation, Melton Sandstone
Member, east of Redding, Shasta County, northern Cal-
ifornia (Area 2); Ladd Formation, Baker Canyon Mem-
ber, Santa Ana Mountains, Orange County, southern
California (Area 8).
Etymology: Named for its occurrence in the Cow
Creek area east of Redding, Shasta County, northern
California; vacca , Latin, meaning cow, used as a noun in
apposition.
Remarks: Tl le examined material consisted of 17
specimens, and nearly all of them are from the Redding
Page 144
THE NAUTILUS, Vol. 125, No. 3
Figures 30—41. Late Turanian and late Santonian species of Igonoia new genus. Specimens coated with ammonium chloride.
30-34. Late Turanian Igonoia vacca new species, holotype LACMIP 13689, LACMIP loc. 25421, height 5.6 mm, diameter 5.6 mm.
35-42. Late Santonian Igonoia occidentalis (Whiteaves, 1903). All specimens coated with ammonium chloride. 35, 36, 40. Hypotype
LACMIP 13690, LACMIP loc. 24217, height 8.7 mm, diameter 7 mm. 37-38. Paratype GSC 5918a, Nanaimo area, Vancouver
Island, British Columbia, height 5.5 mm, diameter 7.1 mm. 38. Left-lateral view. 39. Hypotype LACMIP 13691, LACMIP loc.
10794, height 7 mm, diameter 6.6 mm. 41. Hypotype LACMIP 13692, LACMIP loc. 24217, diameter 10 mm. 42. Paratype GSC
5919, Nanaimo area, Vancouver Island, British Columbia, diameter 6.9 mm, x5.4.
Formation. Most of the specimens have good preserva-
tion. The new species somewhat resembles Igonoia
shastana new species, but the former differs by having
non-beaded spiral ribs and narrower and much more
widely spaced ribs.
Igonoia occidentalis (Whiteaves, 190.3) new
combination
(Figures 35-42)
Solariella ( radiatula ? var.) occidentalis Whiteaves, 1903:
368-369, pi. 45, figs. 5, 5a.
Solariella roddai Saul, 1959.
Diagnosis: Moderately small-sized Igonoia with shell
height greater than shell diameter, commonly with
prominent subsutural cord, and raised growth lines
stronger than nearly obsolete spiral ribs, except on base,
on subsutural spiral cord, and on umbilical rim.
Description: Shell size moderately small (up to height
13 mm (estimated), diameter 12 mm, same specimen).
Shell height approximately 15% greater than shell diam-
eter. Troehiform. Phaneromphalous. Spire moderately
high, approximately 59% of shell height. Pleural angle
approximately 81°. Protoconch unknown. Teleoconch
approximately five to six whorls, all with rounded sides.
Suture impressed, rimed by prominent, unnoded
subsutural cord. Shoulder narrow. Ornament generally
weak and crossed by raised growth lines. Upper spire
whorls with c-ancellate ornament. Lower spire whorls
with many wide-spaced, flat ribs separated by finely
incised lines. Last whorl similar to lower spire whorls,
except for base with many weak and closely spaced spiral
ribs that become slightly stronger anteriorward. Aper-
ture circular. Outer lip thin, inner lip thicker and
projecting slightly out over umbilicus. Peristome discon-
tinuous. Umbilicus moderately wide, its rim angulate
and demarcated by spiral rib, weakly beaded with beads
R.L. Squires, 2011
Page 145
decreasing in strength anteriorward. Base oi last whorl
near umbilical rim and umbilical wall cancellate. Growth
lines prosochne, tilted 30° from vertical.
Holotype: GSC 5918, height 4.7 mm, diameter
6.9 mm.
Paratypes: GSC 5918a, 5918b, 5919, 5919a, all from
the type locality.
Type Locality: Vicinity of Nanaimo, Vancouver
Island, British Columbia (Area 1).
Geologic Age: Santonian.
Distribution: LOWER SANTONIAN: Haslam For-
mation, Benson Creek and Nanaimo River, both in the
vicinity of Nanaimo, Vancouver Island, British Columbia
(Area 1); Redding Formation, upper Member V, Clover
Creek, east of Redding, Shasta County, northern Califor-
nia (Area 2). UPPER SANTONIAN: Redding Forma-
tion, Member VI, Clover Creek, east of Redding, Shasta
County, northern California (Area 2); tentative occur-
rence in Chico Formation, top of Musty Buck Member,
Chico Creek, Butte County, northern California (Area 4).
Remarks: Examined material consisted of 212 spec-
imens, which represents justs over 80% of the known
studied specimens of Igonoia . Preservation is moderately
good. Whiteaves (1903) reported that some of his type
material was collected (by others) from Brennan Creek
in the vicinity of Nanaimo, Vancouver Island. According
to R. Graham (person, commun.), it should read Benson
Creek. Igonoia occidentalis is most abundant in lower
Santonian rocks at LACMIP loc. 24246 (Area 2), where
168 specimens have been collected. A few weathered
specimens tentatively identified as this new species are
from the top of the Musty Buck Member in the Chico
Formation, Butte County, northern California.
Igonoia occidentalis is similar to Igonoia angulata but
differs from the latter by much larger shell size, suture
not canaliculate, presence of subsutural rib, and raised
growth lines extending from suture to suture on spire
whorls and from suture to umbilical rim on last whorl.
Igonoia occidentalis resembles the Upper Cretaceous
margaritine Atira omatissima (Gabb, 1864) from Califor-
nia but differs from the latter by having shell height
greater than shell diameter, subsutural cord, non-sloping
ramp, more prominent growth lines, inner lip not
projected over edge of umbilicus, and umbilical rim
demarcated by au angulation rather than a prominent
spiral rib.
Stoliczka (1867-1868) reported Solariella radiatula
Forbes, 1846, from southern India at the locale of
Odiyanr [= Odium of old usage], which, according to
Sundaram et al. (2001), is stratigraphically situated in
the upper Albian to Cenomanian Kami Formation.
Although Whiteaves (1903) questionably identified
I. occidentalis as Solariella (radiatula ? var.) occidentalis,
this species is here identified as I. occidentalis because it
is not Forbes’s species radiatula.
Igonoia angulata (Gabb, 1869) new combination
(Figures 43-47)
Margaritella angulata Gabb, 1869: 172 [in part], pi. 28, figs. 55.
Solariella angulata (Gabb). Stewart, 1927: 317, pi. 24, fig. 17.
Diagnosis: Very small-sized Igonoia with suture
canaliculate, ornament prominent only on shoulder,
prominently raised growth lines on periphery and on
base of last whorl.
Description: Shell size very small (up to height
4.5 mm (estimated), diameter 4.8 mm, same specimen).
Shell height approximately same as shell diameter.
Trochiform. Phaneromphalous. Spire moderately high,
approximately 54% of shell height. Pleural angle 80°.
Protoconch unknown. Teleoconch approximately four
whorls. Suture canaliculate. All whorls with flattish
sides. Shoulder augulate, crossed by many prominently
raised growth lines that become obsolete near middle
portion of whorls. Spiral ornament obsolete on spire
whorls; spiral ornament on last whorl consisting of
many very fine threads starting at middle portion of
whorls and continuing onto base. Base demarcated by
rounded angulation; base covered by many veiy fine
spiral threads that become microscopically beaded
anteriorward. Aperture elliptical. Outer and inner lips
thin. Peristome probably discontinuous. Umbilicus rim
angulate and demarcated by beaded spiral ribs.
Growth lines prosocline, tilted approximately 33° from
vertical .
Lectotype: ANSP 4238 (designated by Stewart (1927)
but missing since 1992 (P. Colloman, person, commun.),
height 4.4 mm, diameter 5 mm.
Paralectotypes: ANSP 79512 [ex-ANSP 4238],
Type Locality: LACMIP 23312, Franklin County,
near Martinez, Contra Costa County, northern Califor-
nia (Area 7).
Geologic Age: “Mid” Maastrichtian (late early to mid-
dle late).
Distribution: Panoehe Formation, Franklin Canyon,
southwest side of Martinez, Contra Costa County, north-
ern California (Area 7).
Remarks: The examined material consisted of two
specimens, both previously part of a supposed group of
six ANSP paralectotypes of Solariella angulata. Five of
these specimens are stored together as ANSP 79512 [ex
4238] and the sixth one is ANSP 79153. Of the five
ANSP 79512 specimens, only two are like the drawing
provided by Gabb (1869) and the photograph provided
by Stewart (1927) of the lectotype of S. angulata. Of the
remaining three specimens, two belong to Igonoia muiri
new species, and one is an indeterminate species
because it has lost most of its shell. The ANSP 79153
specimen is a badly crushed naticid? gastropod, and the
Page 146
THE NAUTILUS, Vol. 125, No. 3
Figures 43-51. Maastrichtian species of Igonoia new genus. 43—47. Igonoia angulata (Gabb, 1869), paralectoype ANSP 79512
[e.v 4238], LACMIP loe. 23312, height 4.4 mm, diameter 5 mm. 48-51. Igonoia muiri new species, holotype ANSP 81350, LACMIP
loc. 23312, height 5.2 mm, diameter 7 mm.
rock matrix filling its aperture is light in color, soft, and
totally unlike the blackish -gray, well-cemented siltstone
in the apertures of the two specimens of 1. angulata and
the two specimens of I. muiri.
Gabb (1869) reported that the type locality ol his
S. angulata to be “at Martinez.” He (lid not collect the
type specimens; they were sent to him by a collector. The
area immediately surrounding this city has stratigraphic
units ranging in age from Late Cretaceous to Miocene,
and there are several faults (Weaver, 1953). The location
of the type locality of I. angulata , therefore, has been
poorly known; subsequently, the geologic age of this spe-
cies has been uncertain. Inspection (by the present
author) of the rock type associated with the two spec-
imens of 1. angulata revealed a match with the rock type
associated with the gastropod Atira inornata (Gabb,
1864), which is also found at LACMIP loc. 23312.
Squires (2010) reported that A. inornata is of “mid”
Maastrichtian age. According to the LACMIP records,
this locality is the same as Gabb's original “at Martinez”
Cretaceous locality. On Dibblees (1980) geologic map of
tiie area, this locality plots in the Panoche Formation.
Cossmann (1918: 257) based the earliest record ol
genus Periaulax Cossmann, 1888, on “ Margantella ”
angulata Gabb, 1869 from the so-called “Chico Group”
at Martinez, California. He assigned these strata to the
“Aturian,” which according to Haiiand et al. (1982: 1 10),
generally refers to the Campanian.
Igonoia muiri new species
(Figures 48-51)
Margantella angulata Gabb, 1869: 172 [in part].
Solaiiella angulata (Gabb). Stewart, 1927: 317 [in part].
Diagnosis: Veiy small-sized Igonoia with spire low,
beaded subsutural rib, ramp flat, shoulder angulate and
bearing two spiral ribs (beaded), subsutural area and
ramp incised by prominently raised growth lines, and
sides of whorls smooth .
Description: Shell size veiy small (up to height 5 mm
(estimated), diameter 7 mm, same specimen). Shell
height approximately 90% of shell diameter. Trochiform.
Phaneromphalous. Spire low, approximately 43% of shell
height. Pleural angle approximately 95°. Protoconch
unknown. Teleoconch approximately four whorls. Suture
impressed, bordered by prominent subsubtural beaded
rib. Ramp flat. Spire whorls with sides somewhat
rounded; last whorl with sides flattish. Ornament on
whorls consisting of beaded subsutural rib, stronger
R.L. Squires, 2011
Page 147
beaded spiral rib on angulate shoulder, and one other
spiral rib (weaker) jnst anterior to shoulder; all three ribs
incised by moderately widely spaced prominently raised
growth lines that become obsolete on middle portion of
sides of whorls. Base demarcated by rounded angulation;
several weak spiral threads posterior to angulation.
Ornament on base consisting of many spiral ribs becom-
ing stronger and beaded anteriorward; beads crossed
by prominent growth lines, thereby producing cancellate
ornament. Aperture elliptical. Outer and inner lips
thin. Peristome discontinuous. Umbilicus wide, its rim
angulate and demarcated by prominently beaded spiral
rib. Umbilical wall cancellate. Growth lines prosoeline,
tilted 42° from vertical.
Holotype: ANSP 81350, height 5.2 mm, diameter
7 mm.
Paratype: ANSP 81351 (unfigured), from the type
locality.
Type Locality: LACMIP 23312, Franklin County,
near Martinez, Contra Costa County, northern Califor-
nia (Area 7).
Geologic Age: “Mid” Maastrichtian (late early to
middle late).
Distribution: Panoche Formation, Franklin Canyon,
southwest side of Martinez, Contra Costa County, north-
ern California (Area 7).
Etymology: Named for John Muir, early Californian
naturalist and visionary conservationalist, whose home is
in the immediate vicinity of the type locality ol the new
species.
Remarks: The examined material consisted of two
specimens, previously part of a supposed group of six
paralectotypes of Solariella angulata (see “Remarks” for
I. angulata).
The new species occurs with I. angulata at LACMIP
loc. 23312, which occurs in strata of “mid” Maastrichtian
age (see “Remarks” for I. angulata). The new species
differs from I. angulata by larger size, wider shell, non-
canaliculate suture, subsutural rib, two spiral (beaded)
ribs on shoulder, and much stronger spiral ribs on base.
Igonoia muiri is most similar to I. onoensis new spe-
cies but differs from the latter by having smaller size,
subsutural cord, angulate shoulder (rather than
rounded), shoulder demarcated by only two spirals, with
the posteriormost the strongest (rather than with approx-
imately seven spirals, all nearly equal in strength), orna-
ment on base less well developed, and ornament on base
somewhat obsolete near middle portion of sides of
whorls.
PALEOGEOGRAPIIIC AND PALEOCLIMATIC
COMMENTS
Igonoia kieli and I. shastana , the earliest known repre-
sentatives ol this new genus, existed in the Albian, which,
according to Hallam (1992: fig. 4.8) and Frakes (1999),
was a time of warming ocean waters and a pronounced
sea-level rise. During the Albian and Cenomanian,
Igonoia reached its peak diversity (two species during
each stage) in northern California. There was excep-
tional warming during the Turonian, as well as one of
the highest sea-level stands ol the entire Cretaceous
(Haq et ah, 1987; Frakes, 1999). These conditions would
have been ideal for I. vacca to become widespread in
the study area, but the number of specimens is low. In
addition to being found in northern California (i.e.,
approximately 42° N) (Area 2), I. vacca also ranged
as far south as the Santa Ana Mountains in southern
California (Area 8). Based on an analysis of paleomag-
netic studies (Dickerson and Butler, 1998: fig. 1), the
Santa Ana Mountains are part of a microplate tectonic
terrane that would have been even slightly farther south
(approximately 32° N, compared to its present-day loca-
tion at 33° N). Based on volutodermine and opine
bivalve studies (Saul and Squires, 2008; Squires and
Saul, 2009), warm -temperate surface waters were the
norm for the study area and the approximate position
of the Late Cretaceous subtropical/warm-temperate
boundary shifted from 43° N in the Turonian to 36° N
in the Campanian and Maastrichtian.
During the latest Turonian to Coniacian there was
marked cooling (Frakes, 1999) and a drastic drop in sea
level (Hallam, 1992). No Coniacian specimens of Igonoia
are known. Relative to the Coniacian, there was some
warming during the Santonian and early part of the
Campanian (Frakes, 1999), and sea level remained gen-
erally high (Hallam, 1992). The time of greatest abun-
dance of Igonoia specimens was the Santonian, with
most of the specimens found in northern California.
The occurrence of/, occidentalis in the Nanaimo Group
on Vancouver Island, British Columbia (Area 1) is an
artifact ol tectonic transport. Work on Cretaceous mol-
lusks by Squires and Saul (2006: 86) and Saul and
Squires (2008: 214) supported the contention that the
Nanaimo Group was deposited not any farther south
than northern California.
No Campanian age specimens of Igonoia are known,
and the only study area specimens of Igonoia
Maastrichtian age are two specimens each of 7. angulata
and I. muiri.
In summary, the localities of Igonoia are mainly clus-
tered around the 40° N latitude in northern California
(Figure 1), thus they plot within the warm-temperate
water regime (see Saul and Squires, 2008: fig. 3). Prior
to tectonic transport complications, study area Igonoia
were most widespread, but few in number, during
the relatively warm time of the Turonian when temper-
ate waters expanded latitudinally. The highest abun-
dance of specimens, however, was during the Santonian,
Page 148
THE NAUTILUS, Vol. 125, No. 3
which was a cooler time relative to the Turanian.
The lack of Campanian-age Igonoia and the paucity of
Maastrichtian-age specimens are very puzzling, and
the reasons await further study.
ACKNOWLEDGMENTS
The author thanks Raymond Graham and Joe Haegert
(Victoria Palaeontology Society, Victoria, British Colum-
bia) for sending excellent specimens with good locality
data from the Nanaimo Group, Vancouver Island; Paul
Callomon (ANSP) for loans of Gabb’s specimens; Jean
DeMouthe (California Academy of Sciences) for access
to collections; J. Dougherty (GSC at Ottawa) for the loan
of Whiteave’s specimens from the Nanaimo Group;
Harry Filkorn (ex LACMIP) for access to collections and
loan of specimens; Lindsey T. Groves (Natural History
Museum of Los Angeles County, Malacology) for loan of
specimens and for library assistance; Jann Thompson of
the Smithsonian Institution for the loan of Whites
specimen from the Gualala area; Mark Goodwin
(University of California, Berkeley, Museum of Paleon-
tology) for access to the collection and for loan of
specimens. The author thanks LouElla R. Saul (LAC-
MIP) for sharing her knowledge about Cretaceous
mollusks and James H. McLean (Natural Histoiy
Museum of Los Angeles County, Malacology) for sharing
his knowledge of vetigastropod genera. Angel Valdes
(California State University, Pomona, Biology Depart-
ment) kindly took the SEM image, and LACM provided
the SEM facilities. Steffen Kiel (University of Gottingen,
Germany) critically reviewed the manuscript and
provided important comments.
LITERATURE CITED
Cossmann, M. 1888. Catalogue illustre des coquilles lossiles de
l'Eocene des environs de Paris. Annales de la Societe
Royale Malaeologique de Belgique 23: 3-324.
Cossmann, M. 1918. Essais de Paleoeonchologie Comparee,
Tome 11. Privately published, Paris, 388 pp.
Davies, A.M. 1971. Tertiary Faunas, Volume 1. The Composi-
tion of Tertiaiy Faunas, revised by F. E. Eames. George
Allen and Unwin, London, 571 pp.
Dibblee, T.W., JR. 1980. Preliminary geologic map of the
Briones Valley Quadrangle, Alameda and Contra Costa
counties, California. U. S. Geological Survey Open File
Report 80-539.
Dickerson, W. R. and R.F. Butler. 1998. Coastal and Baja Cali-
fornia paleomagnetism reconsidered. Geological Society
of America Bulletin 110: 1268-1280.
Forbes, E. 1846-1847. Report on the fossil Invertebrata from
southern India collected by MM. Kaye anti Cunliffe. Trans-
actions of the Geological Society of London (2) 7: 99-174.
Flakes, L.A. 1999. Estimating the global thermal state from
Cretaceous sea surface and continental temperature data.
In: E. Barrera and C. C. Johnson (eds.). Evolution of the
Cretaceous Ocean-Climate System. Geological Society of
America Special Paper 332: 49-57.
Fretter, V. and A. Graham. 1977. The prosobraneh mollusks of
Britain and Denmark. Part 2-Troehacea. The Journal of
Molluscan Studies, Supplement 3: 39-99.
Gabb, W. M. 1864. Description of the Cretaceous fossils.
Geological Survey of California, Palaeontology 1: 57-243.
Gabb, W. M. 1866-1869. Cretaceous and Tertiary fossils. Cali-
fornia Geological Survey, Palaeontology 2: 1-299.
Gradstein, F.M., J. Ogg, and A. Smith. 2004. A Geologic
Time Scale 2004. Cambridge University Press, Cambridge,
589 pp.
Gray, J.E. 1847. The classification of the British Mollusca. By
Dr. W. E. Leach, M. D. Annals and Magazine of Natural
Histoiy, Series 1, 20: 267-273.
Hallam, A. 1992. Phanerozoie Sea-level Changes. Columbia
University Press, New York, 266 pp.
Haq, B.J., J. Hardenbol, and PR. Vail. 1987. Chronology of
fluctuating sea levels since the Triassic. Science 235:
1156-1167.
Harland, W.B., A.V. Cox, PG. Llewellyn, C.A.G. Piekton,
A.G. Smith, and R. Walters. 1982. A Geologic Time Scale.
Cambridge University Press, Cambridge, 131 pp.
Hickman, C.S. and J.H. McLean. 1990. Systematic revision
and suprageneric classification of trochacean gastropods.
Natural Histoiy Museum of Los Angeles County, Science
Series 35, 169 pp.
Kiel, S. and K. Bandel. 2001. Troehidae (Arehaeogastropoda)
from the Campanian of Torallola in northern Spain. Acta
Geologica Polonica 51: 137-154.
Matsumoto, T. 1959. Upper Cretaceous ammonites of
California, Part II. Kyushu Lhriversity, Memoirs of the
Faculty of Science, Series D, Geology, Special Volume 1,
172 pp.
Matsumoto, T. 1960. U pper Cretaceous ammonites of Califor-
nia, Pt. III. Kyushu University, Memoirs of the Faculty of
Science, Series D, Geology, Special Volume II, 204 pp.
Meek, F. B. and F.V. Hayden. 1860. Systematic catalogue, with
synonyma, etc., ol Jurassic, Cretaceous and Tertiaiy fossils
collected in Nebraska. Proceedings of the Academy of
Natural Sciences of Philadelphia 12: 417-432.
Murphy, M.A. 1956. Lower Cretaceous stratigraphic units of
northern California. Bulletin of the American Association
of Petroleum Geologists 40: 2098-2119.
Murphy, M.A. and PU. Rodda. 1960. Mollusca of the Creta-
ceous Bald Hills Formation of California. Journal of Pale-
ontology 34: 835-858.
Murphy, M.A., PU. Rodda, and D.M. Morton. 1969. Geology
of the Ono Quadrangle, Shasta and Tehama counties, Cal-
ifornia. California Division of Mines and Geology, Bulletin
192, 28 pp.
Popenoe, W. P. 1983. Cretaceous Aporrhaidae from California:
Aporrhainae and Arrhoginae. Journal of Paleontology 57:
742-765.
Popenoe, W. P, L. R. Saul, and T. Susuki. 1987. Gyrodiform
gastropods from the Pacific coast Cretaceous and Paleo-
cene. Journal of Paleontology 61: 70-100.
Rafinesque, C.S. 1815. Analyse de la Nature, on Tableau de
l’Univers et des Corps Organises. Barravecchia, Palermo,
224 p.
Rodda, P. U. 1959. Geology and paleontology of a portion of
Shasta County, California. Unpublished Ph.D. disserta-
tion. University of California Los Angeles, 204 pp.
Salvini-Plawen, L. 1980. A reconsideration of systematics in
the Mollusca (phylogeny and higher classification).
Malacologia 19: 249-278.
R.L. Squires, 2011
Page 149
Saul, L. R. 1959. Senonian mollusks from Chico Creek. M. A.
thesis. University of California Los Angeles, 170 pp.
Saul, L. R. and R.L. Squires. 2008. Volutoderminae (Gastropoda:
Volutidae) of Coniaeian through Maastrichtian age from
the North American Pacific slope. Journal of Paleontology
82: 213-237.
Squires, R.L. 2010. Northeast Pacific record of the Cretaceous
marine gastropod Atira and a review of its paleobio-
geography. Journal of Paleontology 84:1022-1030.
Squires, R. L. and L. R. Saul. 2004. The pseudomelaniid gastro-
pod Paosia from the marine Cretaceous of the Pacific
slope of North America and a review of the age and
paleobiogeography of the genus. Journal of Paleontology
78: 484-500.
Squires, R.L. and L. R. Saul. 2006. Cretaceous Acila
( Trtincacila ) (Bivalvia: Nuculidae) from the Pacific slope
of North America. The Veliger 48: 83-104.
Squires, R.L. and L. R. Saul. 2009. Cretaceous opine bivalves
from the Pacific slope of North America and palaeo-
biogeography of subfamily Opinae Chavan, 1969.
Palaeontology 52: 1311-1347.
Stewart, R.B. 1927. Gabb’s California fossil type gastropods.
Proceedings of the Academy of Natural Sciences of Phila-
delphia 78: 287^447.
Stoliczka, F. 1867-1868. Cretaceous fauna of southern India, 2.
The Gastropoda. Geological Survey of India, Memoirs,
Palaeontologica Indica, Series 5, 497 pp.
Sundaram, R., R. Henderson, R.A. Ayyasami, and J.D. Stilwell.
200 1 . A lithostratigraphic revision and palaeoenviron-
mental assessment of the Cretaceous System exposed in
the onshore Cauvery Basin, southern India. Cretaceous
Research 22: 743-762.
Thiele, J. 1866-1893. Das Gebiss der Schnecken zur
Begriindung einer Natiirlichen Classification. Band 2,
pp. 247^409, R. Strieker, Berlin. [A continuation of work
begun by F. H. Troschel in 1856.]
Weaver, C.W. 1953. Eocene and Paleocene deposits at Marti-
nez, California. University of Washington Publications in
Geology 7: 1-102.
Whiteaves, J.F. 1903. On some additional fossils from the Van-
couver Cretaceous, with a revised list of the species there-
from. Geological Survey of Canada, Mesozoic Fossils, Part
5: 309-415.
Williams, S.T., S. Karube, and T. Ozawa. 2008. Molecular sys-
tematic^ of Vetigastropoda: Troehidae, Turbinidae and
Trochoidea redefined. Zoologica Scripta 37: 483-506.
Williams, S.T., K.M. Donald, H.G. Spencer, and T. Nakano.
2009. Molecular systematic^ of the marine gastropod fam-
ilies Troehidae and Calliostomatidae (Mollusea: superfam-
ily Trochoidea). Molecular Phylogenetics and Evolution
54: 783-809.
Wood, S.V. 1842. A catalogue of shells from the Crag. [Gastro-
pods]. Annals of the Magazine of Natural History 9: 455-
462; 527-544.
APPENDIX I. TYPE LOCALITIES OF THE NEW
SPECIES
Localities are LACMIP. All quadrangle maps listed
below are U. S. Geological Survey maps.
Detailed information about the other cited localities in
the text is available via the following: LACMIP website:
<http://ip.nhm.org/ipdatabase/locality_show>; UCMP
website: <http://ucmpclb.Berkeley.edu/loc.html>.
22893. Dark brown sandstone, 5260 ft. S 28.5° W of
intersection of Ono-Igo Road and Cottonwood- Igo
Road, on East Fork of Hulen Creek, Ono Quadrangle
(15 minute), Bald Hills, Ono area, Shasta County, Cali-
fornia. Budden Canyon Formation, Iluling Sandstone
Member. Age: Late Aptian. Collector: M. A. Murphy,
January 1, 1951.
22900. 1500 ft. N18°W of confluence of North Fork of
Cottonwood Creek and Hilling Creek; on Hiding Creek,
in conglomeratic sandstone forming the narrows; is first
sandstone below junction with east fork of Hiding
Creek, NE/4 of sec. 17, T. 30N, R. 6W, Ono Quadrangle
(15-minute, 1952), Bald Hills area, Shasta County, Cali-
fornia. Budden Canyon Formation, Chickabally Mud-
stone Member. Age: Early late Albian (upper part of
Oxytropidoceras packardi ammonite zone). Collector:
M. A. Murphy, January, 1953.
23312. Crest of 500 ft. ridge on N side of Franklin
Canyon due W of the old John Muir place at S end
of city of Martinez, northeastern corner of Briones Val-
ley Quadrangle (7.5 minute, 1959), Contra Costa
County, California (= Gabb’s original Martinez Creta-
ceous locality). Great Valley Sequence. Age: "Mid“
Maastrichtian (late early to middle late). Collector: W.
P. Popenoe, August, 1944.
23476. Hard concretionary sandstone, 3000 ft. S of
NW corner of sec. 30, T. 30 N, R. 6 W, Ono Quadrangle
(15 minute), Coyote Creek, Bald Hills, Ono area, Shasta
County, California. Budden Canyon Formation, Bald
Hills Member. Age: Cenomanian. Collector: P. U.
Rodda, August, 1955.
23896. Hard concretionary sandstone in gully bottom
and on slope to the west, 570 ft. W and 2300 ft. S of NE
corner of sec. 25, T. 31 N, R. 6 W, Redding Quadrangle
(7.5 minute, 1957, photorevised 1969), Clear Creek area,
Shasta County, northern California. Budden Canyon
Formation, Chickabally Mudstone Member. Age: Late
early Albian ( Brewericeras hulenense ammonite zone).
Collectors: P. U. Rodda, M. A. Murphy, and W. P.
Popenoe, August, 1955.
24246. Sandstone bed 30-40 ft. stratigraphically above
conglomerate at center of W line of sec. 33, on N side of
divide between Clover and Basin Hollow creeks, Shasta
County, northern California. Redding Formation, upper
Member V. Age: Early Santonian. Collector: W. P.
Popenoe, August 25, 1959.
25421 . Sandstone nodules in shale, left bank of Little Cow
Creek, about 5 ft. above the channel bottom, 75 m NE
(upstream) from intersection of the creek bed with the line
fence, S line of sec. 9, T. 32 N, R. 3 W., Millville Quadrangle
(15-minute, 1953), Shasta County, California. Formation:
Redding Formation, Melton Sandstone Member. Age: Late
Turanian. Collector: VV. P. Popenoe, summer 1937.
28757. 2700 ft. N of Putah Creek, section 20, T. 8 N, R. 2
W, Thompson Canyon, just NE of Monticello Dam
(forming Lake Berryessa), near the letter “y” in the word
“Canyon,” Monticello Dam Quadrangle (7.5 minute, 1959),
Yolo County, Venado Sandstone (containing reworked
Albian fossils). Age: Turanian (see Matsumoto, I960: 38).
THE NAUTILUS 125(3): 150-158, 2011
Page 150
Reproductive biology of Octopus tehuelchus d’Orbigny, 1834
(Cephalopoda: Octopodidae) in southern Brazil
Jonatas Alves
Graduate Program in Biological Oceanography
Institute of Oceanography
Federal University of Rio Grande
CEP 96201-900 Rio Grande, BRAZIL
[email protected]
Manuel Haimovici
Institute of Oceanography
Federal University of Rio Grande
CEP 96201-900 Rio Grande, BRAZIL
[email protected]
ABSTRACT
Octopus tehuelchus is a small octopus endemic to subtropical
and temperate waters of the southwestern Atlantic continental
shelf. Its reproductive biology was studied by examining 319
individuals, measuring 20 to 79 mm mantle length (ML), col-
lected between 1979 and 2009 along the coast of southern
Brazil. Females are more numerous in shallower waters and
attain larger size than males. Fully mature males and females
were observed in all seasons and mean mantle length at matu-
rity was 46 mm for females and 27 mm for males. The number
of intraovarie oocytes of maturing females ranged from 20 to
448 and was positively correlated with female size. In mature
females, a wide range of intraovarie oocytes diameters was
observed, in some cases with a bimodal distribution. The num-
ber of eggs in the four layings ranged from 86 to 237, the
diameters ranged from 8.2 to 14.5 mm and no bimodality was
observed. Digestive gland grew proportionally to body weight
along maturation in females but not in males, suggesting accu-
mulation of reserves for spawning and parental care in females
and priority for sexual maturation over growth in males. The
comparison of the reproductive cycle of O. tehuelchus in south-
ern Brazil with populations from northern Patagonia shows
that the species has the potential for year round spawning, but
ecological constrains only allows it to express this potential in
the lower latitudes of its distribution.
Additional keywords: Mollusea, Reproductive cycle, sexual
maturation, fecundity, southwestern Atlantic
INTRODUCTION
Cephalopods have developed a wide array of reproduc-
tive strategies, which enable them to occupy all marine
habitats (Rocha et al., 2001). Particularly, the family
Octopodidae has experienced an intense speeiation, occu-
pying coastal benthic environments from the tropics to
temperate regions (Norman, 2003). In this family, a range
of reproductive strategies occurs, from species with wide
distribution, large body size, small eggs, high fecundity
and pelagic hatchlings, such as Octopus vulgaris (Guerra,
1975; Mangold, 1987; Rocha et al., 2001; Otero et al.,
2007; Villanueva and Norman, 2008) to more narrowly
distributed species, with small body size, larger eggs, low
fecundity and benthic development, such as Octopus
tehuelchus (Pujals, 1982; Iribame, 1991; Re, 1998). This
last species occurs from subtropical southeastern Brazil
(20° S) (Haimovici and Perez, 1991) to the temperate
habitats of San Jorge Gulf, in northern Patagonia, Argen-
tina (43°S) (Re and Simes, 1992; Re, 1998).
In southern Brazil, Octopus tehuelchus occurs over
the continental shelf, as deep as 100 m depth and usu-
ally associated with gastropod shells (Haimovici and
Andriguetto, 1986). Due its low abundance in commer-
cial landings, its life cycle and biology are poorly known
in Brazil. However, the species is frequently found in
stomach contents of demersal teleosts and marine mam-
mals from this region (Santos and Haimovici, 2002). In
the Patagonian gulfs, the species is commercially ex-
ploited as small artisanal fishery (Storero, 2010).
Most information on the growth and reproductive
biology of the species comes from studies conducted
in Patagonia, in an environment predominantly that
includes rock}' bottoms, discharge of freshwater creeks
and channels, high tidal range (up to 9 m), and large
seasonal variation of temperature and luminosity
(Pollero and Iribarne, 1988; Iribarne, 1991; Navarte
et al., 2006; Klaich et al., 2008; Storero et al., 2010). This
environment contrasts with that of southern Brazil,
which presents sandy and muddy bottoms, small tidal
range and, due to its more northerly distribution, tem-
perature rarely below 12°C, even in the cold months
(Haimovici et al., 1996) and lower variation in luminosity
between winter and summer (Bakun and Parrish, 1990).
Tl le aim ol this work is to study the reproductive
biology of Octopus tehuelchus in the subtropical envi-
ronment of the continental shelf in southern Brazil,
which will allow for a better understanding of the repro-
ductive strategy along the species distribution.
MATERIALS AND METHODS
Data Collection: Specimens of Octopus tehuelchus
were collected from bottom trawl surveys by the R/V
J. Alves and M. Haimovici, 201 1
Page 151
Atlantico Sul and from commercial trawling along
southern Brazil in the 28° S to 34° S range at depth from
15 to 100 m, between 1979 and 2009. Specimens were
fixed in 10% formalin and preserved in 70% ethanol.
All preserved individuals, 125 males and 194 females,
had their total length (TL), dorsal mantle length (ML),
total body weight (BW), and digestive gland weight
(DGW) recorded. Females had their ovary weight (OW),
oviducts weight (including the ovidueal glands) (OvW),
and maximum diameter of ovidueal glands recorded.
Maximum diameters of oocytes (MDO) were measured
with a caliper to the nearest 0.1 mm. All developing
intraovaric oocytes over 4 mm were counted. Four
egg clutches were collected on gastropod shells, spawned
eggs were measured and recently hatched individ-
uals, without the yolk sac, were measured and weighed.
In males, testis weight (TW) and spermatophoric sac
(including the glandular system) weight (SSW) were
weighed within 0.01 g precision. Spermatophores in the
Needham’s sac were counted and measured at the
nearest 0.1 mm on a micrometric scale.
The reproductive cycle was analyzed by a combination
of the monthly frequencies of males and females in each
maturity stage and the monthly variations of the maturity
and gonadosomatic indices.
A maturity index (MI) was calculated as MI = SSW/
(TW + SSW) for males and MI = OvW/ (OW + OvW) for
females (Hayashi, 1970). The gonadosomatic index (GSI)
was calculated as GSI = (SSW/ (BW - SSW)) x 100 for
males and GSI = (OW/ (BW - OW)) x 100 for females
(Otero et ah, 2007). Digestive gland index (DGI) was cal-
culated as DGI = (DGW/ (BW - DGW)) x 100, similar to
the one used for Octopus vulgaris (Otero et ah, 2007).
The maturity scale was modified from Guerra (1975),
Pujals (1982), and Perez and Haimovici (1991). For
females, five stages were defined based on the size, color
and transparency of the oviducts and ovidueal glands in
preserved specimens as well as the mean diameter of the
developing oocytes: Immature (I): translucent oviducts,
ovidueal glands little differentiated, with diameter usu-
ally smaller than 2 nun; Initial maturity (II): whitish
ovidueal glands between 2 and 3 mm in diameter and
developing oocytes 2 to 4 mm long; Intermediate matu-
rity(III): ovidueal glands brown/black, 3 to 4.5 mm in
diameter, most oocytes between 4 and 7.5 mm long;
Advanced maturity (IV): enlarged oviducts, sometimes
with oocytes being released, mean diameter of the larger
oocytes over 7.5 mm; Post-spawning (V): ovary clearly
flaccid with reduced size and few eggs in it, oviducts
dilated and small ovidueal glands.
The maturity scale for males included four stages:
Immature (I): small and whitish testis, glandular system
slightly differentiated and absence of spermatophores in
the Needhams sac; Initial maturity (II): testis under
development, usually heavier than the glandular system
and Needham's sac with few (<20) spermatophores;
Advanced maturity (III): testicle weight lighter than
glandular system and Needham’s sac full; Post-liberation
of spermatophores (IV): glandular system still bulky.
Needham's sac partially or totally empty, with spermato-
phores being released and testicle relatively small,
striped and usually less heavy than the glandular system.
Potential fecundity was defined as the number of
developing oocytes with diameters over 4 mm in ovaries
of stages III and IV females. The few smaller ones, which
were probably atresic, were discarded.
Data Analyses: Reproductive indices were compared
with the non-parametric Kruskal-Wallis test for multiple
comparisons, because assumptions tor normality and
homogeneity of variance were not satisfied.
The sex ratio was calculated for the categories
“month”, “mantle length”, and “depth". To allow for
comparable numbers of specimens, ML was grouped
in four 15 mm classes and depth in three classes: under
30 m, from 30 to 59 m, and 60 m and over. Significant
deviations from the 1:1 proportion were tested using the
X“ test, adjusted to Yates correction (Zar, 1984).
Length-weight relationships were estimated for the
total sample and according to sex. Data were adjusted to
power model (y = ax1’), where y = BW; x - ML; a = the
y-intercept; and b = the slope. The goodness of fit
was expressed by r“ and the analysis of covariance
(ANCOVA) (Zar, 1984) was used to test for differences
in the slope of log-transformed relationships.
The mean mantle length at maturity (ML50%) was
estimated starting from the proportion (Pi) ol stages
III and IV individuals, grouped in 6 mm ML classes,
adjusted to the logistic model: Pi = 1— { 1/ 1 + exp [- (a +
pMLi)]}
The Bhattaeharya method ( Bhattacharya, 1967; King,
2007) was used to discriminate normal components in
the diameter frequency distribution of intraovaric
oocytes.
RESULTS
Sex Ratio: Females were significantly more abundant
that males (174:125), however the sex ratio did not dilfer
significantly when grouped monthly (Table 1). The pro-
portion of females was significantly higher among the
specimens larger than 45 mm NIL (yj = 13.89 and 5.18;
p <0.05) (Table 2), suggesting that females grow larger
than males. The number of females was higher in all
depth ranges, however, the differences between sexes
was only significant at depths shallower than 30 m (y“ =
4.17; (p <0.05) (Table 3).
Length-Weight Relationships: Females O. tehuelchus
ranged from 21 to 79 mm ML (mean 47.2) and from 8.3
to 228.5 g BW (mean 69.5) and males ranged from 20 to
76 mm ML (mean 42.6) and 4.7 to 125.1 g BW (mean
46.0). The dorsal mantle length/total body weight rela-
tionships (ML/BW) were calculated only for individuals
caught in 2009 (n = 64), which were less affected by the
dehydration observed in specimens preserved in alcohol
for long periods. Relationships were best described by
the power equations (Table 4): females: BW = 0.0211 x
Page 152
THE NAUTILUS, Vol. 125, No. 3
Table 2. Sex ratio variation of Octopus tehuelchus according
to ML 15 mm classes in southern Brazil (*significant
X~ departures from the 1:1 sex ratio p <0.05).
Table 3. Sex ratio variation of Octopus tehuelchus according to
30 m depth classes in southern Brazil (*significant x~ departures
from the 1:1 sex ratio p <0.05).
ML12098, males: BW = 0.0113 x ML2'3337 and both
sexes combined: BW = 0.0072 x ML24"2. Slope com-
parisons did not show heterogeneity between sexes
(ANCOVA, p — 0.634). However, these results should be
considered with care due to the low number ol individ-
uals, particularly of males (Table 4).
Maturation and Size-at-Maturity: Fully mature
males and females were observed in all seasons. There-
fore, the mean size and weight at maturity were calcu-
lated including specimens collected year round.
Females in stages I and II (n = 76) were observed
in all size ranges including seven females over 60 mm
ML (Figure 1). Females in stages III and IV (n = 95)
measured over 24 mm ML and weighed over 30 g.
Despite the small variation, the mean ML increased sig-
nificantly with maturation ( p <0.05) (Table 5). The
maturity curve of females showed a good fit to the logis-
tic model (r~ = 0.980) and ML50% calculated was 45.9
mm (Figure 2).
Males in stages I and II (n = 58) were observed in all
sizes including five individuals over 60 mm (Figure 1).
All males in stages III and IV (n = 65) were over 30 mm
ML and 15 g BW. The ML5o% was 27.4 mm, however,
the maturity curve of males did not show a good fit to
the logistic model (r2 = 0.129) (Figure 2).
Seasonality: Females in stages I or II were observed
in all months sampled. Stage III individuals were caught
more frequently in April, June, and November and stage
IV individuals were caught in all months sampled, mainly
in January, August, and September (Figure 3). A single
stage V female with an egg clutch was observed in July.
Three other egg clutches without the spawned female
were found in the same month and a fourth was
observed in November. Reproductive indices were not
homogeneous throughout all months (p <0.05) (Fig 4).
Higher (GSI) and lower (MI) associated to sexual matu-
rity were observed in January (summer) and June,
August, and September (late autumn to late winter).
Immature and initial maturity males (stages I and II)
occurred year round, but more frequently in April, June
and December. Stages III and IV also occurred in all
sampled months, more frequently in January (summer),
September, October, and November (late winter and
early spring) (Figure 3). There were no significant differ-
ences in the monthly means of IM and GSI (p >0.05),
indicating mature males in all seasons (Figure 4).
In both sexes, maturity stages and reproductive indi-
ces support a year-round sexual maturation cycle.
Pre-spawning Oocytes and Spermatophores: The
mean number of oocytes in the ovaries of 67 maturing
females (stages III and IV) was 246.8 (range from 20 to
448). The diameter of the oocytes ranged from 1.8 to
13.9 mm (Table 5). A wade range of oocyte diameters
was observed within the ovaries of eveiy individual,
in some cases with a bimodal distribution. The number
of oocytes (ON) increased significantly with female
ML (ON = 1.4889 x (ML) 1.3094; r=0.524 n=67)
(Figure 5). Immature and initial maturity females (stages
I and II, n = 68) had 185 oocytes in average (50 to 514),
most with diameters under 4 mm (Table 5).
In stages III and IV males (n = 67), the number ot
stored spermatophores in Needham’s sac ranged from 1
Table 4. Range of mantle length (ML) and total body weight (BW) and power regression parameters of length/weight
relationships for females and males of Octopus tehuelchus caught in southern Brazil in 2009.
n min-max (mean) ML min-max (mean) BW A B / “
Females 47 30-65 (49.9) mm 21.9-228.5 (123.4) g 0.0211 2.2098 0.7240
Males 17 28-52 (40.1) mm 32.5-1 19.4 (65.1) g 0.0113 2.3337 0.8290
Both sexes 64 0.0072 2.4772 0.8347
J. Alves and M. Haimovici, 2011
Page 153
FEMALES
MALES
Stage I
6 -
4
2 -
0
n = 14
mean ML= 31.9 mm
on
,n,n.n,
Stage
Mantle length (mm) Mantle length (mm)
Figure 1. Frequency of mantle length (ML) classes in each maturity stage of females and males of Octopus tehuelclms in southern
Brazil.
Table 5. Variation in the number and maximum diameter (MDO) of intraovaric oocytes in females of Octopus tehuelchus in
different maturation stage (Stages I, II III and IV) in southern Brazil.
to 62 (21.2 ± 12.3), with maximum length ranging from
1.7 to 57.4 mm (21.2 ± 8.9). Non-significant correlation
was found between the number of spermatophores and
the ML (r = 0.086) (Figure 5) nor between the length of
the spermatophores and the ML (r = 0.03).
Spawning and Hatchlings: All the egg clutches were
observed in gastropod shells of Tonna galea and
Adelomenon brasiliana. The number of eggs attached to
the shells ranged from 86 to 237 (165.2 ± 60.5; n = 4).
The maximum diameter of these eggs ranged from 8.1 to
14.4 mm and their diameter distribution were unimodal.
Recently hatched octopuses (n = 16) resembled small
adults, and measured from 5.0 to 6.40 mm ML and
from 10.5 to 15.0 mm TL and weighed from 0.07 to
0.12 g (Table 6). During one of the cruises, a spawned
female with her eggs stuck to a gastropod shell was placed
inside a recipient with sea water and some eggs hatched.
Recently hatched octopus did not show any swimming
behavior, remaining near the bottom of the recipient.
Page 154
THE NAUTILUS, Vol. 125, No. 3
100%
50%
25%
0%
Males
• •
^=0.129
~ i 1 1 1 r
Mantle length (mm) Mantle length (mm)
Figure 2. Relative frequency curve of mature individuals by mantle length (ML) classes (mm), of females and males of Octopus
telmelchus in southern Brazil adjusted to a logistic model.
□ I 011 Sill ■ IV
Females
Males
Figure 3. Monthly frequency (%) of the maturity stages of Octopus tehuelchus females and males in southern Brazil (values in the
bars indicate the number in each stage).
Digestive Gland Index and Reproductive Invest-
ment: The digestive gland weight (DGW) ol females
increased significantly with sexual maturation (p <0.05).
The digestive gland index (DGI) was significantly lower
in stage I (p <0.05), and remained constant in the others
stages (Figure 6). Monthly DGI of females did not follow
a seasonal pattern: the lowest values were observed in
April and May and the highest ones, in January, March,
August, and December (Figure 7).
Digestive gland weight and index of males did not
show significant changes along maturation ( p >0.05), al-
though small decrease in DGI means along maturation
was observed (Figure 6). Seasonally, higher DGI values
were observed in spring (Figure 7).
DISCUSSION
Octopus telmelchus is a small species with large eggs and
low fecundity, endemic to the subtropical and temperate
waters of the southwestern Atlantic continental shell
(Haimovici and Perez, 1991; Re, 1998). This study shows
that its reproductive biology can adapt to both environ-
ments, with seasonal spawning in temperate waters and
year round spawning in subtropical environments. Tem-
perature, light intensity and daily photoperiod can influ-
ence growth and reproduction in cephalopods (Mangold,
1987). However, these factors may influence particular
species or populations in different ways (Boyle and
Rodhouse, 2005). Temperature an photoperiod differ
between northern Patagonia (40° to 42° S), where day-
light ranges from 9 to 15 h and air temperatures along
the San Antonio Bay coast range between 6° C and 24° C
(Iribarne, 1991) and southern Brazil (32° S), where day-
light ranges from 10 to 14 h (Bakum and Parrish, 1990)
and bottom temperatures on the continental shell range
between 12° C and 24° C (Haimovici et al., 1996).
Although not discriminating the effects of each factor,
Iribarne (1991) observed that high intensity of light
J. Alves and M. Haimovici, 2011
Page 155
10
8 -
6
4
2
0
tt
Females
1 0
Males
11 i
* M.
• r f * i
0,4
0,3
I 0,2
0,1
0,0
$
J FMAMJ J ASOND
0,7
0,6
0,5
0,4
0,3 -
0,2 -
0,1
0,0
O
— I 1
F M A
MJ JASOND
Figure 4. Monthly trends of mean (±SE) values of the gonadosomatic index (GSI) and the maturity index (MI) of Octopus
tehuelchus females and males in southern Brazil.
Females
70
60
(fi 50
b
&40
gj.30
bs
| 20
^ 10
0
Males
20
0
q9°
<03 O ,
r = 0.086
O
0
O 0
0
O O
0
O cc8
— o— 0-
o
°R
0 0
0
40 60
Mantle length (mm)
80
Figure 5. Relationship between mantle length (ML) and potential fecundity (number of developing oocytes and spermatophores)
of mature females and males of Octopus tehuelchus in southern Brazil.
Table 6. Variation in the number and maximum diameter of eggs (MDE) and in the mantle length (ML), total length (TL) and
total body weight (BW) of hatchling on four egg clutches of Octopus tehuelchus in southern Brazil compared to northern Patagonia.
(Iribarne, 1991; Re, 1998).
Page 156
THE NAUTILUS, Vol. 125, No. 3
■ dgi qdgw Females
7
6
5
4
3
2
1 -
0
O
T
II
III
?
Males
4 * f
II
IV
Maturity stage Maturity stage
Figure 6. Mean (±SE) of digestive gland weight (DGW) and digestive gland index (DGI) in each maturity stages of Octopus
tehuelchus females and males in southern Brazil.
2
0 T 1 1 1 1 1 1 1 1 1 1 1 1
JFMAMJ JASOND
Figure 7. Monthly trends of mean (±SE) values of the digestive
southern Brazil.
and temperature were associated to the intensification
of growth and sexual maturation ot Octopus tehuelchus
in northern Patagonia, where sexual maturation occurs
between December and May and spawning occurs
from June to November (Pujals, 1982; Re 1989). More
recently, Storero et al. (2010) observed two distinct
sub-annual cohorts in the mantle length distributions
within San Antonio Bay, suggesting that O. tehuelchus
can have a more extended spawning season even in
the higher latitudes of its distribution. In contrast, in
southern Brazil, mature males and females were
observed year-round and egg broods were sampled both
in cold and warm months.
Octopus tehuelchus uses a wide variety of bottoms
types to deposit eggs. On the rocky bottoms of San
Matias Gulf (41° to 42° S), the eggs are attached directly
to the substrata (Re, 1998). On the sandy bottoms of the
San Antonio Bay (40° 40' S), the eggs are attached to
shelters, mainly bivalve shells of Ostrea puelchana,
Males
8
2
0 i — i — i — i — i — i — i — i — i — i — i — i 1
J FMAMJ J ASOND
gland index (DGI) of Octopus tehuelchus females and males in
Ammiuntis purpurata, Mytilus edulis plotensis, Chlamys
tehuelchus, and Pitar rostratus or gastropod shells of
Buccinanops gradatum, Odontocymbiola subnodosa,
and Zidona dufresnei (Iribarne, 1990). Although most of
these mollusks also occur in southern Brazil (Rios, 2009),
egg laying of Octopus tehuelchus in this region was found
only inside shells of large sized gastropods Tonna galea
and Adelomenon brasiliana. Iribarne (1990) notes that
the abundance of small shells in San Antonio Bay could
favor the selection ol smaller octopuses. However, the
availability of larger shells in southern Brazil does not
seem to have favored larger individuals in this region .
In southern Brazil, a wide range of sizes of developing
intraovaric oocytes and of egg sizes in the egg clutches
(Figure 8) were observed. In northern Patagonia,
some females also showed oocytes at different stages of
development (Pujals, 1982). These wide ranges in
oocytes size may decrease competition among siblings.
Plowever, there are differences in the evolution of the
J. Alves and M. Haimovici, 2011
Page 157
n=237
Figure 8. Frequency of spawning eggs size in four egg
clutches of Octopus tehuelchus in southern Brazil.
DGI between regions, that suggest that the individual
spawning period may be longer in southern Brazil: in
northern Patagonia, the DGI decreases along sexual
maturation and can be associated to intense reserve
mobilization along a short spawning season (Pujals,
1982; Iribarne, 1991); in southern Brazil, the DGI
remains high along maturation, suggesting accumulation
of reserves for a longer period of spawning and parental
care of the eggs. However, it is not consensual that
the digestive gland has an important role in energy stor-
age in cephalopods, as many authors also consider the
reserves in the muscle and gonads (Moltchaniwskyj and
Semmens, 2000; Bosa et ah, 2004; Semmens et ah,
2004).
In males, the DGI decreases in both regions, charac-
terizing a larger mobilization of energy reserves for the
reproduction and anticipation of sexual maturation
rather than growth (Iribarne, 1991). Moreover, males
mature at smaller sizes than females in both areas (Re,
1989). In the San Matias Gulf, females mature up to
three months after males. After copulation, the sperm is
stored in the oviducal glands of females (Re, 1998).
The lack of seasonality in the spawning in southern
Brazil may be associated to year-round availability of
food for hatchlings. Productivity on the inner shell of
southern Brazil is relatively high (Ciotti et ah, 1995),
mostly as a consequence of the nutrient-rich runoff from
the La Plata River and Patos Lagoon (Piola et ah, 2005).
In this region, other neritic cephalopods such as
Doryteuthis(Loligo) sanpaulensis spawn year- round
(Andriguetto and Haimovici, 1991; Haimovici, 1998a)
and many bony fishes are multiple spawners (Haimovici,
1998b). In the Patagonian gulfs, productivity is
dependent on tidal fronts and shows a strong seasonal
variation, where higher productivity rates are concen-
trated in spring and summer (Aeha et ah, 2004). In tem-
perate environments, such as the northern Patagonian
gulfs, seasonality in productivity limits food availability
and consequent survival and growth for young octopus in
the cold season more difficult. Furthermore, according
to Klaich et ah (2006), food intake, growth, and food
conversion of O. tehuelchus in experimental conditions
were lower at 10°C when compared to 15°C.
Based on our data, we have concluded that
O. tehuelchus has the potential for year round spawning,
but ecological constrains such as temperature, which
influences metabolism, and photoperiod, which influ-
ences productivity, enables the species to express this
potential only in the lowest latitudes of its distribution
range.
ACKNOWLEDGMENTS
The authors thank Roger Villanueva and Roberta Aguiar
dos Santos for their comments on the manuscript and
the skippers Bjarne Bager and Jail son for providing
specimens. J.A. was supported by a scholarship from
CAPES (Coordination for Improvement of High Educa-
tion), provided by the Graduate School of Biological
Oceanography at the Federal University of Rio Grande
(FURG). MIL was partly supported by a research grand
from the Brazilian Research Council (CNPq).
LITERATURE CITED
Acha, E.M., W. Hermes, R.A. Mianzan, M.F. Guerrero, and
J. Bava. 2004. Marine fronts at the continental shelves of
austral South America Physical and ecological processes.
Journal of Marine Systems 44: 83-105.
Andriguetto, J.M. and M. Haimovici. 1991. Abundance and
distribution of Loligo sanpaulensis Brackoniecki, 1984
(Cephalopoda, Myoposida) in southern Brazil. Scientia
Marina 55: 611-618.
Bhattaeharya, C.G. 1967. A simple method of resolution of a
distribution into Gaussian components. Biometrics 23:
115-135.
Bakun, A. and R.H. Parrish. 1990. Comparative studies of
coastal pelagic fish reproductive habitats: the Brazilian
sardine ( Sardinella aurita). Journal of Marine Science 46:
269-283.
Boyle, P. R. and P. G. Rodhouse, 2005. Cephalopods. Ecology
and Fisheries. Blackwell Publishing Company, Oxford,
452 pp.
Ciotti, A.M., C. Odebrecht, G. Fillmann, and O.O. Moller Jr.
1995. Freshwater outflow and subtropical convergence
influence on phytoplankton biomass on the southern Bra-
zilian continental shelf. Continental Shelf Research 15:
1737-1756.
Guerra, A. 1975. Determinaeion de las diferentes fases del
desarrollo sexual de Octopus vulgaris Lamark, mediante
un indice de madurez. Investigaciones Pesqueras 39:
397-416.
Haimovici, M. 1998a. Ambientes costeiros e marinhos e sua
biota: Cefalopodes. In: Seeliger, U., C. Oderbretch, and
Page 158
THE NAUTILUS, Vol. 125, No. 3
J.P. Castello (eds.) Os Eeossistemas Costeiro e Marinho do
Extremo Sul do Brasil. Editora Ecoscientia, pp. 162-166.
Haimovici, M. 1998h. Ambientes costeiros e marinhos e sua
biota: Teleosteos demersais e bentonieos. In: Seeliger, U.,
C. Oderb retch, and J.P. Castello (eds.). Os Eeossistemas
Costeiro e Marinho do Extremo Sul do Brasil. Editora
Ecoscientia, pp. 143-152.
Haimovici, M. and J.M. Andriguretto. 1986. Cefalopodes
costeiros eapturados na pesca de arrasto do litoral sul do
Brasil. Arquivos de Biologia Tecnologica 29: 473^195.
Haimovici, M. and J.A.A Perez. 1991. The coastal cephalopod
fauna of Southern Brazil. Bulletin of Marine Science 49:
221-230.
Haimovici, M., A.S. Martins, and PC. Vieira. 1996.
Distribuigao e abundancia de peixes teleosteos demersais
sobre a plataforma continental do sul do Brasil. Revista
Brasileira de Biologia 56: 27-50.
Hayashi, Y. 1970. Studies on the maturity conditions of the
common squid. A method of expressing maturity condi-
tions by numeric values. Bulletin of Japanese Society of
Scientific Fisheries, 36: 995-999.
Iribame, O.O. 1990. Use of shelter by the small Patagonian octo-
pus Octopus tehuelchus : availability, selection and effects on
fecundity. Marine Ecology Progress Series 66: 251—258.
Iribarne, O.O. 1991. Life history and distribution of the small
south-western Atlantic Octopus, Octopus tehuelchus
Orbigny. Journal of Zoology 223: 549-565.
Klaich, M. J., M. E. Re, and S.N. Pedraza. 2006. Effect of tem-
perature, sexual maturity and sex on growth, food intake
and gross growth efficiency in the “pulpito” Octopus
tehuelchus (d’Orbigny, 1834). Journal of Shellfish
Research 25: 979-986.
Klaich, M.J., M.E. Re and S.N. Pedraza. 2008. Gross growth
efficiency as a function of food intake level in the “Pulpito”
Octopus tehuelchus: A multimodel inference application.
Aquaculture 284: 272-276.
Mangold, K. 1987. Reproduction. In: Boyle, PR. (ed.) Cepha-
lopod Life Cycles, vol. 2. Comparative Reviews. Academic
Pi ■ess, London, pp. 157-200.
Moltchaniwskyj, N. A. and J. M. Semmens. 2000. Limited use of
stored reserves for reproduction by the tropical loliginid
squid Photololigo sp. Journal of Zoology 251: 307-313.
Narvarte, M.,R. Gonzalez, and M. Fernandez. 2006. Compari-
son of telnielehe octopus ( Octopus tehuelchus) abundance
between an open-access fishing ground and a marine
protected area: Evidence from a direct development spe-
cies. Fisheries Research 79: 112-119.
Norman, M. 2003. Cephalopods: A World Guide. ConehBooks,
Haekenheim, 320 pp.
Otero, J., A.F. Gonzalez, PM. Sieiro, and A. Guerra. 2007.
Reproductive cycle and energy allocation of Octopus
vulgaris in Galician waters, NE Atlantic. Fisheries
Research 85: 122-129.
Perez, J.A.A and M. Haimovici. 1991. Sexual maturation
and reproductive cycle of Eledone massyae Voss 1964
(Cephalopoda: Octopodidae) in Southern Brazil. Bulletin
of Marine Science 49: 270-279.
Piola, A. R., R.P. Matano, E D. Palma, O.O. Moller Jr., and
E.J.D. Campos. 2005. The influence of the Plata River
discharge on the western South Atlantic shelf. Geophysi-
cal Research Letters, 32: L01603. 4pp.
Pollero, R.J. and O.O. Iribarne. 1988. Biochemical-Changes
during the Reproductive Cycle of the small Patagonian
Octopus, Octopus tehuelchus, D’Orb. Comparative Bio-
chemistry and Physiology Vol. 90B: 217-320.
Pujals, M. A. 1982. Contribution al eonoeimiento de la biologia
de Octopus tehuelchus (Orbigny, Mollusca, Cephalopoda).
Anales de la Sociedad Cientifica Argentina Serie I,
Ciencias 46: 30-71.
Re, M.E. 1989. Estudios ecologieos sobre el crecimiento y la
alimentation de Octopus tehuelchus d’Orbigny en Puerto
Lobos, Golfo San Matias. Tesis Doctoral, Universidad
National de La Plata, Argentina.
Re, M.E. 1998. Pulpos octopodidos (Cephalopoda,
Octopodidae). In: Boschi, E.E. (ed.), El Mar Argentino y
sus reeursos pesqueros. Los moluscos de interes pesquero.
Cultivos y estrategias reproductivas de bivalvos y
equinoideos. Tomo 2. Instituto Nacional de Investigation
y Desarrollo Pesquero, Seeretaria de Agricultura,
Ganaderfa, Pesca y Alimentation, Mar del Plata, pp.
69-80.
Re, M.E. and E.G. Simes. 1992. Habitos alimentares del pulpo
( Octopus tehuelchus). Analisis euali-cuantitativo de la
dieta em el intermareal de Puerto Lobos, golfo de San
Matias (Argentina). Frente Marftimo 11(A): 119-128.
Rios, E.C. 2009. Compendium of Brazilian Sea Shells.
Evangraf, Rio Grande, 668 pp.
Rocha, F., A. Guerra, and A. Gonzalez. 2001. A review of
reproductive strategies in cephalopods. Biological
Reviews 76: 291-304.
Rosa, R., PR. Costa, and M.L. Nunes. 2004. Effect of sexual
maturation on the tissue biochemical composition of Octo-
pus vulgaris and O. defilippi (Mollusca: Cephalopoda).
Marine Biology 145: 563-574.
Santos, R.A. and M. Haimovici. 2002. Cephalopods in the
trophic relations off southern Brazil. Bulletin of Marine
Science 71: 753-770.
Semmens, J.M., G.T. Peel, R. Villanueva, D. Joufre, I. Sobrino,
J.B. Wood, and B.R. Rigby. 2004. Understanding octopus
growth: patterns, variability and physiology. Marine and
Freshwater Research 55: 367-377.
Storero, L.P., M. Ocampo-Reinaldo, R.A. Gonzalez, and M.A.
Narvarte. 2010. Growth and life span of the small octopus
Octopus tehuelchus in San Matias Gulf (Patagonia): three
decades of study. Marine Biology 157: 555-564.
Villanueva, R. and M.D. Norman. 2008. Biology of the plank-
tonic stages of benthic octopuses. Annual Review Ocean-
ography and Marine Biology 46: 105-202.
Zar, J.H. 1984. Biostatistical Analysis, Prentice-Hall Inc.
Englewood Cliffs, 718 pp.
THE NAUTILUS 125(3): 159-163, 201 1
Page 159
Two new species of Admetinae (Gastropoda: Cancel lari idae)
from the northeastern Pacific Ocean
M.G. Harasewych
Department of Invertebrate Zoology
National Museum of Natural History
Smithsonian Institution
P.O. Box 7012
Washington, DC 20013-7012 USA
[email protected]
Richard E. Petit
806 St. Charles Road
North Myrtle Beach, SC 29582-2846 USA
[email protected]
ABSTRACT
Two new species of the caneellariid subfamily Admetinae are
described from bathyal depths of the northeastern Pacific
Ocean. Admete verenae is presently known only from the
hydrothermal vents of the Juan de Fuca Ridge, at depths of
2192 to 2415 m. It differs from other Admete in having a
large shell with a high spire, strong spiral sculpture, and ante-
riorly tapering aperture with a deflected siphonal canal and
a distinctive siphonal fasciole. Egg capsules, each containing
5-8 embryos, are broadly oval, V-shaped in end view, and
raised on a short, broad stalk. Neadmete ohoi , from off northern
California and Washington State at depths of 276 to 732 m,
may be recognized by its distinctive tabulate spire profile and
broad, strongly channeled sutural ramp, as well by its anteriorly
tapered aperture.
Additional keywords: Mollusea, Neogastropoda, Admete ,
Neadmete , Bathyal, hydrothermal vents, egg capsules
INTRODUCTION
The Cancellariidae are a large and diverse family ot
neogastropods characterized by a highly specialized
anterior alimentary system adapted lor suctorial feed-
ing. The majority of species are tropical or temperate,
but members of the subfamily Admetinae inhabit soft
sediments at subtidal to hadal depths in polar regions
and intervening deeper waters. Some southern hemi-
sphere admetines share a distinctive radular morphology
(Oliver, 1982). Other austral species as well as all boreal
Admetinae studied to date lack a radula, but retain a
distinctive jaw with its distal portion joined ventrally to
form a tube (Harasewych and Petit, 1986). Admetines
are neither common nor diverse in the North Atlantic
(Bouchet and Waren, 1985:257; H0isseter, 2011), but are
more widespread and represented by greater numbers of
named species and genera in the fauna of the northern
Pacific Ocean (Abbott, 1974; Higo et ah, 1999; Kantor
and Sysoev, 2005).
Over the past several years, we have received samples
of two distinctive species of Admetinae. One was col-
lected during a series of research cruises to the hydro-
thermal vents along the Juan de Fuca Ridge off British
Columbia, and provided by Dr. Verena Tunnicliffe of the
University of Victoria, Canada. The other was obtained
from commercial fishing vessels working off the coast of
Washington State, USA, by Mr. Jon Aho. These two new
species are described herein. Abbreviations: CAIN:
Canadian Museum of Nature, Ottawa; USNM: National
Museum of Natural History, Smithsonian Institution,
Washington, DC.
SYSTEMATICS
Family Cancellariidae Forbes and Hanley, 1851
Subfamily Admetinae Troschel, 1865 (as Admetacea)
Genus Admete Kroyer in Muller, 1842
Admete Kroyer in Mol I or 1842.
Type Species: Admete crispa Moller, 1842 (= Tritonium
viridulum Fabricius, 1780), by monotypy.
Admete verenae new species
(Figures 1-7)
Description: Shell (Figures 1-7) moderately large
(to 25.6 mm), thin, with tall, stepped spire (spire angle
44-51°), broadly ovate aperture, and short, tapering
siphonal canal. Protoconch unknown, early whorls
eroded in all specimens. Teleoconch of 6+ weakly shoul-
dered whorls, becoming more rounded with increasing
shell size. Suture minutely impressed. Spiral sculpture
of: 2-3 weak cords between suture and shoulder; strong
cord along shoulder; 16-18 low, broad, rounded cords
between shoulder and siphonal canal; 3-4 finer cords on
siphonal canal. Cords slightly broader than intervening
spaces, both cords and intervening spaces becoming
progressively narrower toward siphonal canal. Five
cords between suture and shoulder of penultimate
whorl. Axial sculpture of veiy fine prosoeline growth
Page 160
THE NAUTILUS, Vol. 125, No. 3
Figures 1-15. Species of Ad mete and Neaclmete. 1-7. Admete verenae , new species. I , Apertural, 2, lateral, and 3, dorsal views of
the holotype, USNM 1150387. Apertural views of 4, paratype 1, 5, paratype 2, 6, paratype 3, USNM 1150388, and 7, paratype 4,
USNM 1150389. All from Chowder Hill, HHF, Middle Valley, Juan de Fuea Ridge, 48°27.50' N, 128°42.50' W, in 2415 m. Collected
by ROV Ropos. 8-15. Neadmete ahoi , new species. 8, Apertural, 9, lateral, and 10. dorsal views of the holotype, USNM 1150394,
from off southwestern Washington State, in 457-732 m. 1 1 , Apertural, 12, lateral, and 13, dorsal Mews of paratype 1, 14, Apertural
and 15, dorsal views of paratype 2, USNM 1150395, trawled on mud bottom west of Crescent City, California (41°45.9T N,
124°28.97' W), in 276 m, R/V Miller Freeman (NOAA), on large dead chunks of the hexactinellid sponge Aphrocallistes vastus.
lines. Weak axial ribs producing tubercles along spiral
cord on shoulder (18-20 per whorl) present in uneroded
portions of first 3-4 whorls. Aperture broadly ovate,
broadest just below shoulder, tapering anteriorly,
deflected from coiling axis by 18-22°. Outer lip broadly
rounded, weakly corrugated, reflecting spiral sculpture.
Parietal region nearly straight to weakly rounded,
forming angle of 132-136° with columella at siphonal
fascicole. Columella very weakly sigmoidal, nearly
straight with 1-2 barely perceptible columellar folds.
Inductural area with thin glaze to weak callus that con-
tinues along columella, flaring over pseudoumbilicus
before forming weak siphonal fold at juncture with
siphonal canal. Siphonal canal short, broad, slightly
deflected to the right, forming distinctive siphonal
fasciole. Shell color white to cream inside and out.
Periostracum thin, lamellose, yellowish to amber in
color. Shell strongly eroded, reinforced from within in
areas where periostracum worn or absent. Operculum
absent.
Anatomy: Anatomical observations are based on the
holotype (d) and paratype 3 ($). General anatomical fea-
tures as in Admete viridula (see Harasewych and Petit,
1986). Preserved animal comprises 2 Vz to 3 whorls; man-
tle cavity spans Vz whorl, kidney 1/6 whorl, digestive gland
2 whorls. Foot broad anteriorly, tapering posteriorly, uni-
formly golden tan ii i color without discernible color pat-
tern. Tentacles are short, tubular, right longer and
narrower than left, eyes absent. Mantle edge is thickened,
smooth, siphon short, distinct. Osphradium long, narrow
(L/W ~ 6), with 28 leaflets below, 35 leaflets above
broad ganglion. Leaflets low, narrow twice as broad as
ganglion above, equal to ganglion below. Ctenidium as
wide and about twice as long as osphradium, extending
beyond its anterior and posterior margins. Leaflets
narrow, deeply pendant. Hypobranchial gland volumi-
nous, as broad as osphradium and ctenidium, thick,
transversely pleated. Pallial gonoducts and rectum run
along right side of mantle cavity, partially covered by
hypobranchial gland. Kidney only slightly larger than
M.G. Harasewych and R.E. Petit, 2011
Page 161
pericardium. Proboscis short, broad, pleurombolic, with
long retractor muscles extending to columellar muscle.
Buccal mass small, anterior dorsal surface covered by
thin, cuticularized jaw that forms long, thin tube
extending toward mouth. Radula absent, paired salivary
and accessoiy salivary glands present, veiy narrow, tubu-
lar. Valve of Leiblein at rear of buccal mass. Esophagus
extends posteriorly, passing through nerve ring, running
posteriorly to join thin, U-shaped stomach that lines
anterior wall of digestive gland. Intestine runs along
right wall of mantle cavity, expanding to form rectum.
Penis large, long, broad, thick, with a terminal papilla
eminating from an obliquely truncated distal surface.
Female pallial gonoduct of albumen gland, large capsule
gland, small bursa copulatrix.
Egg Capsules: Several egg capsules, recently hatched,
were collected at the type locality. Capsules were
5 Vi mm wide, 4 Vz mm tall, 2 mm wide, oval in profile,
V-shaped in end view, and raised above substrate by
short (1.5 mm), broad (4 mm), ribbon-like stalk. The
long axis of the capsule was tilted with respect to sub-
strate. The dorsal surface (between and just below the
free ends of V) has a large, round hatching aperture
nearer to the side ol capsule tilted toward substrate.
Capsules collected at the Grotto Vent site were smaller,
but with similar proportions, and contained 5-8 embryos
per capsule.
Type Locality: Chowder Hill, Middle Valley, Juan de
Fuca Ridge, 48°27.50' N, 128°42.50/ W, in 2,415 m.
Collected by ROV ROPOS.
Type Material: Holotype (length = 25.6 mm),
USNM 1150387; paratypes 1-3, USNM 1150388, all
from the type locality (Clam bed scoop 1), collected 22
June 1992, University of Victoria coll. R 192-360;
paratype 4, USNM 1150389; paratypes 5-6, CMNML
094280, all from the type locality (Clam bed scoop 2),
collected 22 June 1992, University of Victoria coll.
R 192-361 . USNM 1150392, Egg capsules, from the ri pe
locality (Clam bed scoop 2), collected 22 June 1992,
University of Victoria coll. R 192-2230.
Other Material Examined: USNM 1150390, (9
specimens), Finn Vent, Mothra Field, Endeavour Seg-
ment, Juan de Fuca Ridge, 47° 55.44' N, 129°06.53' W,
in 2281 m, collected 19 July 1999, University of Victoria
coll. R507-8204; USNM 1150391, (5 specimens). Grotto
Vent (chimney side) Main Field, Endeavour Segment,
Juan de Fuca Ridge, 47°57.10' N, 129°06.00' W, in 2192
m, collected 16 July 1991, PIniversity of Victoria coll.
A2409-363; USNM 1150393, egg capsules. Grotto Vent
(chimney side) Main Field, Endeavour Segment, Juan
de Fuca Ridge, 47°57.10' N, I29°06.00' W, in 2192 in,
collected 16 July 1991, University of Victoria coll.
A2409-2232, collected by ROV Roros.
Etymology: This new species honors Dr. Verena
Tunnicliffe, of the School ot Earth and Ocean Sciences,
University of Victoria, for her contributions to the study
of the ecology and evolution ol the deep sea and hot vent
biota.
Comparative Remarks: Admete verenae is readily
distinguished from its congeners by its large size, high
spire, anteriorly tapering aperture with a short siphonal
canal slightly deflected to the right, and conspicuous
siphonal faseiole. Admete viridula (Fabricius, 1780) and
several nominal species to which it is closely related have
axial sculpture on the early whorls that sometimes con-
tinues onto the posterior portion ol later whorls. Admete
regina Dali, 1911, (Macginitie, 1959: pi. 5, fig. 1), which
may be as large or larger, has a weak siphonal lasciole,
but differs in having a much broader, generally heavier
shell with a proportionally shorter spire, much weaker
and finer spiral sculpture, and a much larger, rounder
aperture with a concavely curved columella. Admete
bruuni Knudsen, 1964, from 6660-6770 m in the
Kermadec Trench, is similar in size, but has a veiy thin
shell with numerous (~50) veiy fine and faint spiral
threads, a larger, more evenly ovate aperture, and a lon-
ger siphonal canal that crosses the coiling axis of the shell
and lacks a siphonal faseiole.
The egg capsules of Admete verenae are similar to
those of Admete viridula (illustrated by Bouchet and
Waren, 1985: fig. 687), but differ in being flatter, and
elevated on a short, broad stalk, with a hatching aper-
ture that is not medial but displaced laterally. The num-
ber of embryos per capsule (5-8) is comparable to that
of other admetine species (Pawlik et al., 1988: 52).
Identical egg capsules collected by DSV Alvin on the
Endeavour Segment of the Juan de Fuca Ridge were
described and illustrated by Gustafson, Littlewood and
Lutz (1991: 39, figs. 22-25), who attributed them to the
genus Admete , but noted that no species of Admete had
been collected from the Juan de Fuca Ridge. These
capsules, which contained 1-6 large larvae that complete
development within the egg capsule, can now be attrib-
uted to Admete verenae , suggesting that this species has
a paucispiral protoconch.
Genus Neadmete Habe, 1961.
Type Species: Neadmete okutanii Petit, 1974, by PC.
Z.N, 1986.
Neadmete ahoi new species
(Figures 8-15)
Description: Shell (Figures 8-15) large for genus
(to 26.9 mm), moderately thick, with talk tabulate spire
(spire angle 46-58°), sharply angled shoulder, ovate aper-
ture, and short, siphonal canal. Protoconch unknown,
early whorls eroded and pitted in all specimens.
Teleoconch of 6+ strongly shouldered whorls. Suture
weakly adpressed and incised. Spiral sculpture: absent
in broad channel between suture and shoulder, strong
cord at shoulder, 7-8 strong cords between shoulder
and siphonal canal, 4-5 weaker cords on siphonal canal,
with 0-3 finer threads between strong cords. Cords
Page 162
THE NAUTILUS, Vol. 125, No. 3
much narrower than intervening spaces, becoming
weaker toward siphonal canal. Three cords between
suture and shoulder of penultimate whorl. Axial sculp-
ture of fine prosocline growth striae. Axial ribs (18-20
per whorl) appear by whorl 5, extend from shoulder to
mid-whorl, forming raised tubercles on intersection
with spiral cords. Tubercles appear on shoulder, are
strongest on first spiral cord, reduced on second spiral
cord, indistinct or absent on other cords. Aperture ovate,
tapering anteriorly, deflected from coiling axis by 25-29°.
Outer lip slightly prosocline, smooth, with porcellaneous
glaze weakly furrowed beneath shoulder and major
cords. Parietal region short, weakly rounded, forming
angle of 137-141° with columella. Columella nearly
straight, axial, with 2 weak oblique columellar folds pos-
teriorly, 2 stronger cords anteriorly, and a pronounced
siphonal fold. Siphonal canal short, broad, slightly
deflected to the left, crossing the coiling axis of the shell.
Shell straw caramel colored externally, with white aper-
ture. Periostracum thin, lamellose, yellowish. Operculum
absent.
Anatomy: The anterior portion of a single, partially
preserved female specimen, paratype 2 (figs. 14-15),
was available for study. General anatomical features were
similar to those of Admete viridula (see Harasewych and
Petit, 1986). Foot broad anteriorly, tapering posteriorly,
body color pale, creamy white, tentacles long, tapering,
with large, black eyes at their bases. Osphradium,
ctenidium large, hypobranchial gland voluminous. Intes-
tine, long, narrow extending beyond anterior edge of
capsule gland and small bursa copulatrix. Proboscis
short, containing minute buccal mass. Cuticularized jaw
covering dorsal and anterior surface of buccal mass
formed anteriorly directed tube. Radula absent.
Tvpe Locality: Off southwestern Washington State,
USA, in 457-732 nr [“250-100 fathoms”].
Type Material: Holotype (length = 26.9 mm), USNM
1150394, from the type locality. Para types 1, 2, USNM
1 150395, West of Crescent City" California (41°45.912' N,
124° 28. 968' W), trawled, R/V Miller Freeman (NOAA),
276 m, ou large dead chunks of the ridged hexactinellid
sponge Aphrocallistes vastus , on mud bottom, coll.
Roger N. Clark, 1 November, 1999.
Etymology: We take pleasure in naming this species
for Mr. Jon Aho of Warrenton, Oregon, who generously
made the holotype available.
Comparative Remarks: Neadmete ahoi differs from
all known species of Neadmete, as well as from other
admetines, in having a strongly channeled sutural ramp.
Kanakoff and McLean (1966) reviewed the Recent
northeastern Pacific species, recognizing Neadmete
modesta (Carpenter, 1864), N. circumcinta (Dali, 1873),
and provisionally N. unalaskaensis (Dali, 1873) as a pos-
sible variant of N. modesta , noting that these species
were all highly variable in shell proportions, thickness
and strength of sculpture. These authors also described
N. sutherlandi, a Late Pliocene species.
Neadmete ahoi somewhat resembles the holotype of
Neadmete modesta, but differs in having a strongly tabu-
late spire profile with a broadly channeled sutural ramp,
as well as in having a narrower aperture that tapers
anteriorly.
Kanakoff and McLean noted that a characteristic of
Neadmete is the “continuous spiral sculpture in the colu-
mella area, that increases the number of columellar
plaits.” Neadmete species have the two columellar folds
and siphonal fold that are typical of cancellariids. In
addition, there may be 0-2 thinner, sharper folds poste-
rior to the typical columellar folds that overlay the
posteriormost spiral cords of the siphonal canal. These
thinner folds are not parallel to the columellar folds or
siphonal fold.
Cancellaria turrita Sowerby, 1874, a forgotten taxon
that is probably a synonym of N. unalashkensis , was
described by Sowerby as having a “columella straight
with 3 folds.” In the next paragraph he continued his
description, stating that “the folds on the columella
appear to be 6 or 7, through the intersection of the
transverse ribs passing into the interior.”
ACKNOWLEDGMENTS
We are grateful to Dr. Verena Tunnicliffe, of the School
of Earth and Ocean Sciences, University of Victoria,
British Columbia, Canada, for making available the
specimens of Admete verenae. Appreciation is expressed
to William J. Ritter, Astoria, Oregon, USA, for sending
us material, and for calling to our attention the existence
of Neadmete ahoi. We are deeply indebted to Jon Aho
and Roger N. Clark for making available the specimens
used in this study.
LITERATURE CITED
Abbott, R. T. 1974. American Seashells; the marine Mollusea
of the Atlantic and Pacific coasts of North America.
2nd edition. Van Nostrand-Reinhold, New York, 663
pp., 24 pis.
Bouchet, P. and A. Waren. 1985. Revision of the Northeast
Atlantic Bathyal and Abyssal Neogastropoda excluding
Turridae (Mollusea, Gastropoda). Bollettino Malacologico,
Supplement 1: 121-296.
Gustafson, R.G., D.T. Littlewood, and R.A. Lutz. 1991. Gastro-
pod egg capsules and their contents from deep-sea hydro-
thermal vent environments. Biological Bulletin 180: 34—55.
Harasewych, M.G. and R.E. Petit, 1986. Notes on the mor-
phology of Admete viridula (Gastropoda: Cancellariidae).
The Nautilus 100: 85-91.
I Ipisaeter, T., 201 1 . Revision of the Cancellariidae (Gastropoda:
Caenogastropoda) in the deep water of the Norwegian
Sea, with the description of a new species of Admete.
Journal of the marine Biological Association of the United
Kingdom 91: 493-504.
Higo, S., P. Callomon, and Y. Goto, 1999. Catalogue and bibli-
ography of the marine shell-bearing Mollusea of Japan :
M.G. Harasewyeh and R.E. Petit, 2011
Page 163
Gastropoda, Bivalvia, Polyplacophora, Scaphopoda. Elle
Scientific Publications, Osaka, 749 pp.
International Commission on Zoological Nomenclature
(I.C.Z.N.). 1986. Opinion 1370. Neadmete okutanii Petit,
1974 designated as type species of Neadmete Habe,
1961 (Mollusea, Gastropoda). The Bulletin of Zoological
Nomenclature 43: 17-18.
Kanakoff. G. P. and J. H. McLean. 1966. Recognition of the
cancellariid genus Neadmete Habe, 1961, in the west Amer-
ican fauna, with description of a new species from the
Lomita Mail of Los Angeles County, California. Los Angeles
County Museum, Contributions in Science 116: 1-6.
Kantor, Y.I. and A.V. Sysoev. 2005. Catalogue of molluscs of
Russian and adjacent countries. KMK Scientific Press,
Ltd., Moscow, 627 pp.
Knudsen, J. 1964. Scaphopoda and Gastropoda from depths
exceeding 6000 meters. Galathea Report 7: 125-136.
Macginitie, N. 1959. Marine Mollusea of Point Barrow, Alaska.
Proceedings of the United States National Museum 109:
59-208, pis. 1-27.
Oliver, PC. 1982. A new species of cancellariid gastropod from
Antarctica with a description of the radula. British Antarc-
tic Survey Bulletin 57: 15-20.
Pawlik, J.R., J.B. O’Sullivan, and M.G. Harasewyeh, 1988.
The egg capsules, embryos, and larvae of Cancettaria
cooperi (Gastropoda: Caneellariidae). The Nautilus 102:
47-53.
Sowerby, G. B., II. 1874. Descriptions of twelve new species of
shells. Proceedings of the Zoological Society of London
for 1873: 713-722, pi. 59.
THE NAUTILUS 125(3): 164-166, 2011
Page 164
A new species of Bathytoma (Gastropoda: Borsoniidae)
from the Philippines
John K. Tucker
Illinois Natural Histoiy Survey
National Great Rivers Research and Education Center
1 Confluence Way
East Alton, IL 62024 USA
[email protected]
Baldomero M. Olivera
Department of Biology
University of Utah
Salt Lake City, UT 84112-0S40 USA
[email protected]
ABSTRACT
A new species of Borsoniidae, Bathi/toma gordonlarki new
species, is described from the Philippines. Specimens were
collected in tangle nets in 300-500 m off Balut Island, which
is located on the eastern side of the Celebes Sea. The new
species is similar to B. boholica , a species collected in the
central Philippines. However, B. gordonlarki has a broader
body and a larger spire angle than B. boholica. The discovery
of this species is important because it demonstrates that even
in areas where the fauna has been studied there remains
undiscovered diversity.
Additional keywords: Mollusca, Conoidea, tangle nets, Balut
Island
INTRODUCTION
The genus Bathytoma sensu lato contains at least 100
valid named species (Tucker, 2004). Two-thirds of these
are fossil species with a stratigraphic range from Eocene
to the Pleistocene. The other one-third are extant spe-
cies. Remarkably, about half of the Recent species have
been described since 1986, with 14 species new to sci-
ence introduced between 2004 and 2010. All of these
species were described from South African or Indo-
Pacific localities.
Bathytoma is an important genus of the Borsoniidae
(Tucker and Tenorio, 2009). These mollusks have some
of the largest shells among the turrids (sensu lato) and
commonly reach 50 mm in shell length. Puillandre et al.
(2010) described eleven new species of Bathytoma from
the western Pacific. They suggested that the large num-
ber of previously unrecognized species was due to sym-
patrie and fine-scale allopatric speciation. Bathytoma
may prove to be a source of unrecognized biodiversity
in the deep waters of the Indo-Pacifie region. Herein, we
describe another new species of Bathytoma from the
Philippines. The shell morphology of the new species is
unique and easily distinguishes it from morphologically
similar congeners.
MATERIALS AND METHODS
Specimens of the new species were acquired from local
fishermen. These were collected using tangle nets in
water depth ranging from 300 to 500 m. They had already
been cleaned and were empty shells when received. Mea-
surements made for each specimen included the shell
length, shell width, and spire length using methods
adapted from Roekel et al. (1995). The spire angle was
measured from photographic enlargements.
We also examined three specimens of Bathytoma
boholica also collected off Balut Island in deep water
(Santa Barbara Museum of Natural History, SBMNH
424101-424103). Spire angles were measured from
images of the holotype of B. boholica (Zoologische
Staatssammlung Miinehen, ZSM 1877), of the holotype
of B. badifasciata (Museum national d’Histoire naturelle,
MNHN IM2007718120), which was collected in 473-
505 m, from the Solomon Islands, 9°44' S, 160o49' E, and
of the holotype of B. consors (MNHN IM200718116),
which was collected in 520-581 m, from the Solomon
Islands, 10°25' S, 161°20' E.
SYSTEMATICS
Superfamily Conoidea Fleming, 1822
Family Borsoniidae Bellardi, 1875
Genus Bathytoma Harris and Burrows, 1891
Nomen novum pro Dolichotoma Bellardi, 1875, non
Hope, 1839
Type Species: Murex cataphractus Brocchi, 1814, by
monotypy (of Dolichotoma).
Bathytoma gordonlarki new species
(Figures 1-5)
Diagnosis: Species of Bathytoma with small or obso-
lete peripheral gemmules, with broad ovate swollen
teleoconch whorls, and spire angle of more than 55
degrees.
J.K. Tucker and B.M. Olivera, 201 1
Page 165
Figures 1—11. Bathijtoma species. 1—5. Bathijtoma gordonlarki new species. 1-2, 4. Holotype, MSI, shell length = 55.9 mm.
1. Ventral view. 2. Lateral view showing sinus. 4. Spire and protoconch. Scale bar = 1 mm. 3. Paratype, SBMNH 424100, shell
length = 51.4 nun. 5. Paratype SBMNH 424100, ventral view showing columellar plait, shell length = 58.5 nun. 6-9. Bathijtoma
boliolica Parth, 1994. 6. Holotype, ZSM 1877, shell length = 62.5 mm. 7—9. SBMNH 424102, shell length = 52.2 mm. 7. Ventral
view. 8. Lateral view showing the sinus. 9. Spire and protoconch, scale bar = 1 mm. 10. Bathijtoma hadifasciata Puillandre et al.,
2010, holotype, MNHN IM200718120, shell length = 61.0 mm. 11. Bathijtoma consors Puillandre et ah, 2010, holotype, MNHN
IM200718116, shell length = 45.9 mm.
Description: Shell length 43.8-58.2 mm, shell width
21.3-26.2 mm. Shell shape sub-biconic with rounded
swollen body whorl (Figure 1). Spire about 27% of
shell length. Protoconch diameter 1.2 mm in diam-
eter, of about 2 whorls (Figure 4), smooth, white.
Teleoeonch of 8.5 (holotype) to 9.75 (largest paratype)
whorls. Suture narrowly channeled. Subsutural ramp
complex, consisting of an anterior rounded, almost
swollen area, mostly covered by a brown band. Poste-
rior half of subsutural ramp set at steep angle and flat,
white. This combination produces a subsutural ramp
concave in profile (Figures 1, 3). Spiral sculpture of
11-13 spiral cords minutely to distinctly pustulose. Pus-
tules formed at junction of spiral cords and elevated
arcuate axial lines that cross whorl top. About six spiral
cords present on posterior half of subsutural ramp and
about five on anterior convex portion of subsutural
ramp. Spiral cords continue onto body whorl where
they become less pronounced and somewhat smoother.
Peripheral gemmules are absent but there is a narrow
row of closely set arcuate folds at junction of the spire
and body whorl (Figure 2). Anal sinus deep, U-shaped,
set on anterior half of subsutural ramp (Figure 2). Fine
growth lines trace former position of anal sinus and
continue onto body whorl. Color light- to dark-brown
on spire and shoulder. Anterior shell third may also
have brown color (Figure 2). This color pattern may
be slightly to almost totally absent (Figures 3, 5) or
may consist of a distinct brown band (Figure 2). Inte-
rior of aperture white. Columellar plait distinct. Plait
narrow, oblique to coiling axis, well-developed, about
1.3 mm tall (Figure 5).
Page 166
THE NAUTILUS, Vol. 125, No. 3
Type Material: Holotype (55.9 mm length x 25.2 mm
width) deposited at the Philippine Biodiversity Resource
Center, Marine Science Institute (MSI), University of
the Philippines. Two paratypes deposited at the Santa
Barbara Museum of Natural History (SBMNH 424100).
Three paratypes are respectively deposited at the
Museum of Comparative Zoology, Cambridge (MCZH
372642), Academy of Natural Sciences, Philadelphia
(ANSP 425053), and Museum national d’Histoire
naturelle, Paris (MNHN 23281). All type material col-
lected by fishermen using tangle nets.
Type Locality: Off Balut Island, Celebes Sea, Philip-
pines, 5° 24' N, 125° 23' E, 300-500 m depth.
Distribution: The new species is known from Balut
Island on the eastern side of the Celebes Sea south of
Mindanao, then north to Bohol Island in the central
Philippines (Parth, 1994).
Etymology: We honor Gordon Lark on the occasion
of his 80th birthday. He was the founding chairman of
the Department oi Biology, University of Utah. The sec-
ond author (BMO) is deeply indebted to him for his
guidance and friendship over the years.
Remarks: Bathijtoma gordonlarki new species is simi-
lar in coloration to B. boholica Parth, 1994 (Figures 6-8)
from the Philippines, B. baclifasciata Pnillandre et ah,
2010 (Figure 10) and B. consors Puillandre et al., 2010
(Figure 11), both from the Solomon Islands. All these
species have brown bands developed to one extent or
another. The new species, B. gordonlarki differs from
those three species and all other Bathijtoma species in
shell and spire shape. The body whorl of B. gordonlarki
is convex with rounded sides, with swollen aspect
(Figure 1). All the other species of Batlii/toma are more
slender. Moreover, the spire angle of B. gordonlarki is
much greater than in the other three similarly col-
ored species. The spire angle of the type series of
B. gordonlarki averaged almost 57°. It averaged 39° for
three specimens of B. boholica, 44° for the holotype
of B. badifaciata (Figure 10) and 46° for the holotype
of B. consors (Figure 11).
Parth (1994: fig. 2, left) included a specimen of
B. gordonlarki as a paratype of B. boholica. This speci-
men was collected from Panglao, Bohol Island, with the
holotype and other paratypes of B. boholica. We were
not able to examine the specimen but the illustration is
certainly of a typical specimen of B. gordonlarki. Parths
holotype (Figure 6) is identical to what we identify as
B. boholica (Figures 7-9). Sysoev and Bouchet (2001:
fig. 96) and Sysoev (2008: pi. 661, fig. 7) also mis-
identified specimens of B. gordonlarki as B. boholica.
Puillandre et al. (2010: fig. 1.11) illustrated the same
specimen that Sysoev and Bouchet did and identified it
as B. boholica. Confusion with B. boholica may be the
reason why this large and apparently common species
has remained undescribed.
DISCUSSION
Despite describing 11 new species of Bathijtoma from
the Indo-Paeific, Puillandre et al. (2010) considered that
the actual species diversity of the genus was still
underestimated in the western Pacific. Our contribution
adds yet another species to this group. Considering that
most of the species oi Bathijtoma have non-plaktotrophic
development, which constrains the ranges of individual
species (Puillandre et al., 2010), it is likely that continued
collecting in other regions of the Philippines and western
Pacific will reveal other new species recognizable by
conehological and molecular methods.
It is noteworthy that both B. boholica and
B. gordonlarki are sympatrie at Balut and Bohol Islands
in the Philippines. In contrast, of the 14 species-group
taxa found by Puillandre et al. (2010), 11 were mutually
allopatric. Like the odier species pairs reported by
Puillandre et al. (2010), the boliolica-gordonlarki species
pair could also suggest possible sympatrie speciation in
these deep-water conoideans. However, bathymetric
allopatry cannot be eliminated here, as depth estimates
from fishermen are often inaccurate.
ACKNOWLEDGMENTS
We thank Michael Schrodl and Enrico Sehwabe
(Zoologische Staatssammlung Mrinchen) for the image
of the holotype of Bathijtoma boholica. Images of the
holotypes of B. badifasciata and B. consors were
provided by Alexander Sysoev (Zoological Museum of
Moscow State University).
LITERATURE CITED
Parth, M. 1994. Eine neue auffallige Turriden-Art von den
Philippinen (Mollusca, Gastropoda, Turridae). Spixiana
17: 55-56.
Puillandre, N., A.V. Sysoev, B.M. Olivera, A. Couloux, and
P. Bouchet. 2010. Loss of planktotrophy and speciation:
geographical fragmentation in the deep-water gastropod
genus Bathijtoma (Gastropoda, Conoidea) in the western
Pacific. Systematics and Biodiversity 8: 371-394.
Rockel, D., W. Korn, and A. f. Kohn. 1995. Manual of the
Living Conidae Volume 1: Indo-Pacific Region. Hemmen,
Wiesbaden, 517 pp.
Sysoev, A.V. (2008) Turridae. In: Poppe, G.T. (ed.) Philippine
Marine Mollusks. Volume II. ConchBooks, Hackenheim,
Germany, pp. 732-815.
Sysoev, A.V. and P. Bouchet. 2001. New and uncommon
turriform gastropods (Gastropoda: Conoidea) from the
South-West Pacific. In: Bouchet, P. and B.A. Marshall
(eds.) Tropical Deep-Sea Benthos. Memories du Museum
National D’Histoire Naturelle 22, pp. 271-320.
Tucker, }.K. 2004. Catalog of Recent and fossil turrids
(Mollusca: Gastropoda). Zootaxa 682:1-1295.
Tucker, J.K. and M.J. Tenorio. 2009. Systematic Classifica-
tion of Recent and Fossil Conoidean Gastropods.
ConchBooks, Hackenheim, Germany, 295 pp.
THE NAUTILUS 125(3): 167-170, 2011
Page 167
A new species of Eccliseogyra (Gastropoda: Nystiellidae)
from southeastern Brazil
Emilio F. Garcia
115 Oak Crest Drive
Lafayette, LA 70503 USA
[email protected]
O
ABSTRACT
A new species of Eccliseogyra from Brazil is described and
compared to its most similar congeners: E. exquisite Bouchet
and Waren, 1986, E. folini (Dautzenberg and de Boury, 1897),
and E. pyrrhias (Watson, 1886).
Additional keywords: Mollusea, wentletrap, southwestern
Atlantic, bathyal
INTRODUCTION
The genus Eccliseogyra has traditionally been placed
in the family Epitoniidae. Clench and Turner (1952:
336-337) proposed the taxon Nystiellinae as a subfamily
of Epitoniidae for epitoniid-like species with axially
ribbed nuclear whorls that also show an abrupt change
in sculpture with first protoconch whorl and “very dif-
ferent” radulae. Nutzel (1998: 89-92) considered the
differences strong enough to raise the taxon to family
status. Although some of the differences between the
two families listed by Clench and Turner and Nutzel
are not as clear-cut as they stated (Bouchet and Waren,
1986: 471, 481), I tentatively follow Nutzel’s allocation.
The genus Eccliseogyra is composed of deep-water
species, usually with minute shells. Size and habitat
make the acquisition of specimens difficult, and species
are rare in collections. The genus is represented in
the western Atlantic by four species: E. formosissima
(Jeffreys, 1884), E. nitida (Verrill and Smith, 1885),
E. performosa (de Boury, 1917), and E. pyrhias (Watson,
1886). Other species have been described from the east-
ern Atlantic (Bouchet and Waren, 1986). However, as
was the case with Eccliseogyra formosissima , which
was discovered off the coast of Louisiana in the Gulf of
Mexico (Garcia, 2003), there is a strong possibility that
other eastern Atlantic species of Eccliseogyra will be
found in the western Atlantic.
The Eccliseogyra species described herein was col-
lected off the southeastern coast of Brazil in May, 1987,
during cruise MD55 of the R/V Marion-Dufresne, oper-
ated by Terres Australes et Antarctiques Franyaises. It
was a joint project of Museum National d’Histoire
Naturelle, in Paris (MNHN; chief scientist Alain Guille)
and Universidade Santa Ursula, in Rio de Janeiro (USU;
chief scientist Janete M. Ramos). Malacologists on board
were Philippe Bouchet, Jose H. Leal, and Bernard
Metivier. The cruise generated many new discoveries of
deep-sea biota, including crustaceans (e.g. Manning
et al. 1989; Watling and Gerken, 1999), mollusks (e.g.
Leal and Bouchet, 1989; Houart 1991; Verhecken 1991;
Absalao and Pimenta 2003), and echinoderms (e.g.
Albuquerque et al., 2001).
The new Eccliseogyra species is most similar to
three Atlantic Ocean congeners; E. exquisita Bouchet
and Waren, 1986 and E. folini (Dautzenberg and de
Boury, 1897), recorded from the eastern Atlantic, and
E. pyrrhias (Watson, 1886), from the western Atlantic.
The material representing the new species is depos-
ited at the Museum National d’Histoire Naturelle, Paris
(MNHN), and Museu de Zoologia da Universidade de
Sao Paulo (MZSP). Another abbreviation used in the text
is: dd = empty shells.
SYSTEMATICS
Family Nystiellidae Clench and Turner, 1952
Genus Eccliseogyra Dali, 1892
Type Species: Delphinula nitida Verrill and Smith,
1885 by original designation.
Eccliseogyra brasiliensis new species
(Figures 1-3)
Description: Holotype (Figures 1-3) 8.7 mm in
length, thin, rather widely turriculate (width/ length
ratio 0.40). Protoconch conical, dark amber in colora-
tion, with nucleus damaged; remaining 3.5 whorls axially
ribbed (Figure 4); ribs sigmoid, as wide as interspaces;
interspaces spirally striated. Teleoconch of 6 whorls;
early whorls strongly convex; subsequent whorls shoul-
dered, roundly angular at periphery. Suture incise.
Axial sculpture of widely spaced, low, thin, frilled lamel-
lae; lamellae crossing over suture, some only slightly
Page 168
THE NAUTILUS, Vol. 125, No. 3
Figures 1-9. Eccliseogyra species. 1-4. Eccliseogyra brasiliensis new species, holotype MNHN 24428, southeastern Brazil, 21°35/ S,
40°31' W, 900 m, MD55, sta. CB98, length 8.7 mm, width 3.5 mm. 5-6. Eccliseogyra exquisite Bouchet and Waren, 1986; holotype,
Canary Ids., CANCAP st. 4.063; 28°49' N, 13°42' W, 875 m, after Bouchet and Waren, 1986, figs. 1147-1148, 6.9 mm. 7-9. Eccliseogyra
folini (Dautzenberg and de Boury, 1897), lectotype, Monaco st 703; 39°21/ N, 31°06/ W, 1360 m. After Bouchet and Waren, 1986,
figs. 1143-1144, 9.1 mm.
peaked at shoulder on last whorl, 20 on penultimate
whorl. Spiral sculpture of low, rounded cords; cords of
uneven strength, unevenly spaced, weaker below
periphery of whorl, not crossing over axial lamellae.
about 8 main cords on penultimate whorl. Basal disk
posteriorly delineated by weak ridge, ornamented with
continuation of axial lamellae and obsolete spiral cords.
Umbilicus deep, very narrow. Aperture holostomatous,
E.F. Garcia, 2011
Page 169
subcircular; lip thin; inner lip slightly expanding over
umbilical area. Shell white, somewhat glossy. Opercu-
lum pale yellow, translucent.
Type Material: Holotype MNHN 24428, length 8.7
mm, width 3.5 mm, MD55, sta. CB98; Paratypes:
Paratype 1, MNHN 24429, 21°36' S, 39°58' W, 1199-
1295 m, 11.4 mm, MD55, sta. CB99; paratype 2, MNHN
24430, 19° 38' S, 38°43' W, 960 m, 10.5 mm, MD55, sta.
CB95; paratype 3, MNHN 24431, 18° 59' S, 37°48' VV,
1540-1550 m, 3 mm, MD55, sta. DC70; paratype 4,
MNHN 24432, 19°36' S, 38° 53' W, 640 m, 9.6 mm,
MD55, sta. CB93; paratype 5, MNHN 24433, 19°4T S,
37°48/ W, 790-940 m, 11.8 mm, MD55, sta. CB77;
paratype 6, MZSP 100523, 21° 35' S, 40°31' W, 900 m,
10 mm, MD55, sta. CB98.
Type Locality: Southeastern Brazil, 21°35/ S, 40°31' W,
900 m, MD55, sta. CB98.
Other Material Examined: 19°4P S, 37°48/ W, 790-
940 m, MD55, sta. CB77 (2 dd.); 23°47' S, 42°10' W, 610
m, MD55, sta. CB105 (5 dd); 21°35' S, 40°3T W, 900 m
[MD55, sta. CB98] (10 dd).
Distribution: Southwestern Brazil, from 18°59'S to
21036' S and from 37°48/ W to 40°31' W, in 640 to 1550 m.
Remarks: The angular whorls and narrow umbilicus
separate the new species from most Atlantic Ocean spe-
cies of Eccliseogyra . From the eastern Atlantic, only
Eccliseogyra exquisita Bouehet and Waren, 1986
(Figures 4-5) and E. follni (Dautzenberg and de Boury,
1897) (Figures 6-7), share these characters. Eccliseogyra
exquisita is smaller, growing to only 6.9 mm, has 6
teleoconch whorls, a protoconch of only 2.5 whorls (vs.
3.5+ for E. brasiliensis), and more obvious shoulder
spines (Figure 8). Eccliseogyra folini is proportionately
narrower (width/length ratio 0.30), has more axial lamel-
lae, more defined spiral cords that keep their strength
below the periphery of the whorls, and a more strongly
sculptured basal disk.
The western Atlantic species Eccliseogyra pyrrhias
(Watson, 1846) (Figures 8-9; also see Bouehet and
Waren, 1986, fig. 1 149) is the most similar. It differs from
Eccliseogyra brasiliensis in the following features:
1 . It has approximately 8 whorls at 8.3 mm; die holotype of
the new species has 6 whorls at 8.7 mm, and the largest
specimen of E. brasiliensis examined (paratype 5),
which measures 1 1 .8 mm, has only 7.5 whorls.
2. Its protoconch has more convex whorls (compare Fig-
ures 3 and 9). Besides the figured protoconch of the
holotype, paratype 3, which also has an almost intact
protoconch, has the same outline; several other spec-
imens with damaged protoconchs lack the distinctive
strongly convex outline of the last whorl of the
protoconch of E. pyrrhias.
3. Although teleoconch whorls of juvenile specimens
of Eccliseogyra pyrrhias and E. brasiliensis are very
similar, E. pyrrhias lacks the spiral ornamentation pos-
terior to the periphery that is present in the new spe-
cies, and the adult whorls in the latter species are more
angular, with a more defined, more concave basal disk.
Etymology: Named for the country in which it was
collected.
ACKNOWLEDGMENTS
My deepest thanks to Philippe Bouehet for inviting me
to study some of the epitoniids housed at MNHN and
allowing me to study and publish the specimen treated
herein, for providing the background material for
the expedition in which the specimens were collected,
and for giving me permission to use the figures of
Eccliseogyra exquisita and E. folini that appear in
Bouehet and Waren, 1986. I also thank him, Philippe
Maestrati, and Virginie Heros for their kind help and
hospitality while I was visiting the museum. Carlo M.
Cunha , Museu de Zoologia da Universidade de Sao
Paulo, and Jose and Marcus Coltro, owners of Fetnorale ,
were instrumental in my retrieving additional specimens
of E brasiliensis that MNHN had provisionally sent to
Brazil. Leonard Brown and Bruce Neville have kindly
allowed me to use the image of the holotype of
Eccliseogyra pyrrhias that appears in their publication.
The Wentletrap Book (1999).
REFERENCES
Absalao R.S. and A.D. Pimenta. 2003. A new subgenus and three
new species of Brazilian deep water Olivella Swainson, 1831
(Mollusca, Gastropoda, Olive llidae) collected by the RV
Marion Dufresne in 1987. Zoosystema 25: 177-185.
Albuquerque, M.N., L.S. Campos-Creasey, and A. Guille A.
2001. Two new species of Amphiuridae (Echinodermata,
Ophiuroidea) from the southeastern coast of Brazil.
Zoosystema 23: 591-604.
Bouehet, P. and A. Waren. 1986. Revision of the northeast Atlan-
tic bathyal and abyssal Aelididae, Eulimidae, Epitoniidae
(Mollusca, Gastropoda). Bollettino Malaeologieo, Supple-
mento 2: 297-576.
Clench, W.J. and R.D. Turner. 1952. The genera Epitonium
(part II), Depressiscala, Cylindriscala, Nystiella and
Solutiscala in the Western Atlantic. Johnsonia 2: 289-356.
Garcia, E.F. 2003. Unexpected molluscan finds from the
hydrocarbon vents off the Louisiana coast. American Con-
chologist30(4): 28-30.
Houart, R. 1991. The southeastern Brazilian Muricidae col-
lected by RV Marion-Dufresne in 1987, with the descrip-
tion of three new species. The Nautilus 105 (1): 26-37.
Leal J.H. and P. Bouehet. 1989. New deep-water Volutidae
from off southeastern Brazil (Mollusca: Gastropoda). The
Nautilus 103: 1-12.
Manning R.B., M.S. Tavares, and E.F. Albuquerque. 1989.
Chaceon ramosae, a new deep water crab from Brazil
(Crustacea: Decapoda: Geryonidae). Proceedings of the
Biological Society of Washington 102: 646-650.
Nutzel A. 1998. Uber die Stammesgesehiehte der Ptenoglossa
(Gastropoda). Berliner Geowissenschftliehe Abhandlungen,
series E (Palaeobiologie) 26: 1-229.
THE NAUTILUS 125(3): 171-172, 2011
Page 171
Research Note
Clarification of the authorship and date of
publication of three Asian species of
Unionidae (Bivalvia)
Recently, Petit and Coan (2008) reviewed the molluscan
taxa made available in Griffith and Pidgeon (1833-1834),
the English translation of Cuvier’s Le Regne Animal
(1830). They determined that plate 21, containing the
figures of Unio leai (fig. 1), Unio douglasiae (fig. 2), and
Unio grayii (fig. 3), was dated 1833 and that the three
species take their date of publication from this date and
not the date of the volume [1834], Petit and Coan
reported the correct authorship of the first two species
as being Gray in Griffith and Pidgeon, 1833. Haas (1969)
listed Unio leai as Lamprotula leai (Gray in Griffith,
1834) and used Unio douglasiae Griffith and Pidgeon,
1834. Correction of authorship and date of publication
for these two species does not have any effect on their
synonymies.
Unio graijii was the third species illustrated on plate
21, figure 3. This taxon was listed in the index of the
Griffith and Pidgeon volume, attributed to Lea, but no
geographic location was given. Given that this taxon was
attributed to Lea, Petit and Coan (2008) did not discuss
it. However, Lea did not describe a taxon Unio graijii but
did describe Unio grayanus Lea, 1834 (see Scudder,
1885). In discussions with Petit and Coan, they con-
firmed that the figure caption of plate 21 of Griffith and
Pidgeon indicates that Unio graijii was in fact described
by Gray in Griffith and Pidgeon in 1 833, and not by Lea
as erroneously listed in the index.
The history of the use of Unio graijii is examined.
Conrad (1853) erected Lanceolaria as a subgenus of
Unio and used Unio grayanus Lea, 1834 as the type
species. Simpson (1900, 1914) treated Lanceolaria as a
section of Nodularia Conrad, 1853. He listed Nodularia
( Lanceolaria ) gray ana (Lea, 1834) and included “Unio
grayii Griffith, Grif. Cuv., 1834” as a junior synonym.
Haas (1969) recognized Unio grayana Lea, 1834 and
placed it in Lanceolaria as a genus separated from
Nodularia, but failed to include any mention of Unio
graijii. Liu (1979) reported Lanceolaria grayana from
China and included Unio graijii as a junior synonym.
Dang et al. (1980) recognized Lanceolaria grayi [sic]
(Griffith and Pidgeon, 1834) as a species separated from
Lanceolaria grayana (Lea, 1834) from north Viet Nam.
The correct authorship and date of publication for
Unio graijii is Gray in Griffith and Pidgeon, 1833. The
Unio grayii figure is based on a specimen supplied by
Gray. A preliminary search by Jonathan Ablett, Mollusk
Collections, The Natural History Museum, London, did
not produce the type specimen of Unio grayii. Dang
(1980) commented that Moskvieheva (1973) separated
L. grayii with zigzag tubercles and ridges along the dor-
sal-slope from L. grayana with only tubercles and no
dorsal ridges.
If these taxa are treated as separate species there is
no difficulty. However, if Unio grayii is assumed to be
synonymous with Unio grayanus as used by Simpson
(1900, 1914) and Liu (1979), then with the revised
date of publication for Unio grayii , Lanceolaria grayii
(Gray in Griffith and Pidgeon, 1833) becomes the senior
synonym of Lanceolaria grayana (Lea, 1834) based on
date priority. This case does not meet both conditions of
Article 23.9.1 of the Code of Zoological Nomenclature
(International Commission on Zoological Nomenclature,
1999) to preserve prevailing usage of Unio grayanus
Lea, 1834 as the accepted name because Unio grayii
has been used in the years after 1899 (see Dang
et ah, 1980).
Richard Petit and Eugene Coan are thanked for their
time and efforts to help clarify the author and date for
Unio grayii. Jeffrey T. Garner and Robert Butler are
thanked for their clear and careful reviews.
LITERATURE CITED
Conrad, T.A. 1853. A synopsis of the family of Naiades of North
America, with notes, and a table of some of the genera and
sub-genera of the family, according to their geographical
distribution, and descriptions of genera and sub-genera.
Proceedings of the Academy of Natural Sciences of Phila-
delphia 6(7): 243-269.
Cuvier, Baron [G.J.L.N.C.F.D.], 1829-1830, Le regne animal
distribue d’apres son organisation, pour servir de base
a l’histoire naturelle des animaux et d’introduetion a
l’anatomie eomparee. Nouvelle edition, revue et augmentee.
Paris, Deterville. 5 volumes [v. Lxxxviii + 584 pp., 1829; v. 2:
xv + 406 pp., 1829; v. 3:xvi + 504 pp., 20 pis., 1830; v. 4:xxvii
+ 584 pp., by P. A. Latreille, 1829; v. 5:xxiv + 556 pp.,
by P. A. Latreille, 1829].
Dang, N.T., T.B. Thai, and V.M. Pham. 1980. Dinh loai dong
vat khong xu’o’ng song nude ngot Bac Viet Nam. Nha Xruit
ban Khoa hoc va Ky thuat, Ha Noi.Viet Nam, 573 pp.
Griffith, E. and E. Pidgeon, [1833] — 1834, The Mollusca and
Radiata. Vol. 12, in: E. Griffith, ecf, [1824] — 1835, The
animal kingdom arranged in conformity with its organiza-
tion, by the Baron Cuvier, member of the Institute of
France, & c. &c. &c. with supplementary additions to each
order, by Edward Griffith, F.L.S., A.S., corresponding
member of the Academy of Natural Sciences of Philadel-
phia, &e. and others. London, Whittaker and Co. viii +
601 pp., 61 pis.
Haas, F. 1969. Superfamilia Unionacea. Das Tierreich (Berlin)
88. 663 pp. [in German]
International Commission on Zoological Nomenclature (ICZN).
1999. International Code of Zoological Nomenclature.
Fourth edition. International Trust for Zoological Nomen-
clature, London, 306 pp.
Page 172
THE NAUTILUS, Vol. 125, No. 3
Lea, I. 1834. Observations on the naiades; and descriptions of
new species ol that, and other families. Transactions of the
American Philosophical Society 5 (New Series) (1):23-
119, pis. 1-19.
Lin Y.Y. 1979. Freshwater mollusks of China. Economic fauna
of China. 134 pp. Beijing, China.
Moskvicheva, I.M. 1973.Unionoidea (Bivalvia) of the Amur and
the Marine Territory Basin. Zoologieheskii Zhurnal 52
(10):1458-1471.
Petit, RE. and E.V. Coan. 2008. The molluscan tax a made
available in the Griffith & Pidgeon (1833-1834) edition of
Cuvier, with notes on the editions of Cuvier and on Wood’s
Index Testaceologieus . Malacologia 50: 219-264.
Scudder, N.P. 1885. The published writings of Isaac Lea, LL.D.
Biographies of American Naturalists II. Bulletin of the
U.S. National Museum, Number 23. Government Printing
Office, Washington, District of Columbia. 278 pp. [a
biographical sketch of Isaac Lea is included on pages
VII-LIX],
Simpson, C.T. 1900. Synopsis of the naiades, or pearly fresh-
water mussels. Proceedings of the U.S. National Museum
22(1205): 501-1044.
Simpson, C.T. 1914. A Descriptive Catalogue of the Naiades,
or Pearly Fresh-water Mussels. Parts I— III. Bryant Walker,
Detroit, 1540 pp.
Arthur E. Bogan
North Carolina State Museum of Natural Sciences
11 West Jones Street, Raleigh, NC 27601 USA
[email protected]
Do Van Tu
Viet Nam Academy of Science and Technology
Institute of Ecology and Biological Resources
18 Hoang Quoc Viet, Cau Giay
Ha Noi, VIET NAM
[email protected]
Sponsored in part by the State of Florida, Department
of State, Division of Cultural Affairs, the Florida Arts
Council and the National Endowment for the Arts.
NATIONAL
ENDOWMENT
FOR THE ARTS
INSTRUCTIONS TO AUTHORS
THE NAUTILUS publishes articles on all aspects of the
biology, paleontology, and systematic^ of mollusks.
Manuscripts describing original, unpublished research
and review articles will be considered. Brief articles, not
exceeding 1000 words, will be published as notes and do
not require an abstract. Notices of interest to the mala-
cological community will appear in a notices section.
Manuscripts: Each original manuscript and accompa-
nying illustrations should be submitted to the editor pref-
erably via e-mail or as hardcopy in triplicate.
Text must conform to the dimensions of 8V2 x 11-inch
paper, double-spaced,' and single-column throughout (in-
cluding literature cited, tables, and figure captions). Au-
thors should follow the general recommendations of Sci-
entific Style and Format — The CSE Manual for Authors,
Editors, and Publishers, available from the Council of
Science Editors at www.councilscienceeditors.org. The
first mention of a scientific name in the text should be
accompanied by the taxonomic authority, including year.
Latinized names and other words to be printed in italics
must be underlined; leave other formatting indications to
the editor. Metric, not English, units are to be used. Geo-
chronologic modifiers should be capitalized only when
units are formally recognized: for instance, use Late Cre-
taceous but early Miocene. Likewise, only modifiers of
formally recognized chronostratigraphic units are capi-
talized: use Lower Jurassic but upper Oligocene.
The sequence of sections should be title page, ab-
stract, introduction, materials and methods, results, dis-
cussion, acknowledgments, literature cited, tables, figure
captions, figures. The title page should include the title,
author’s name(s) and address(es). If corresponding au-
thor is not the senior author, please indicate. The ab-
stract should summarize in 250 words or less the scope,
main results, and conclusions of the article. Abstracts
should be followed by a list of additional key words. All
references cited in the text must appear in the Literature
Cited section and vice-versa. Please follow a recent issue
of THE NAUTILUS for bibliographic style, noting that
journal titles must be unabbreviated. Information on
plates and figures should be cited only if not included
within the pagination of cited work. Tables must be num-
bered and each placed on a separate page. If in doubt,
please follow a recent issue of the journal for sequence of
sections and other style requirements.
Illustrations: Illustrations are rendered either at full-
page width (maximum width 17 cm) or column width
(maximum width 8.2 cm). Please take these dimensions
into consideration when preparing illustrations. Page-
width illustrations ideally should span the entire width of
printed page (17 cm). “Tall-’ page-width illustrations
should be avoided, square or “landscape" formats work
better. Please design plates accordingly, such that there
wall be enough space left at the bottom of printed page
for plate caption. (Digital technology has made this task
much easier.)
All line drawings must be in black, clearly detailed,
and completely labeled. Abbreviation definitions must be
included in the caption. Line drawings must be high
resolution files at at least 600 dpi (dots per inch) resolution
at actual size. Standard digital formats for line drawings
include .tif, .bmp, .psd, .eps, and .pdf.
Photographs may be submitted in black-and-white or
color, preferably in RGB mode if in color. Standard digi-
tal formats for photographs include .tif, .psd, .jpg, or .pdf.
Photographs must be high resolution files at least 300 dpi
resolution at actual size.
If more than one figure is included in an illustration,
all figures are to be consecutively numbered (Figures 1,
2, 3, ... , NOT Figures 1A, IB, 1C, . . . , NOR Plate 1,
Figure 1, . . .). In illustrations with more than one figure,
make sure that blank areas between figures is kept to a
minimum, thereby allowing for more area for each indi-
vidual figure.
Compressed files (e.g., .jpg) may be used to facilitate
transmission of files during original submission, but may
not be acceptable at final submission (see below).
Voucher Specimens: Deposition of the holotype in a
recognized institutional, public collection is a require-
ment for publication of articles in which new species-
level taxa are described. Deposition of paratypes in in-
stitutional collections is strongly encouraged, as is the
deposition of representative voucher specimens for all
other types of research work.
The Editorial Process: Upon receipt, all manuscripts are
assigned a number and acknowledged. The editor reserves
the right to return manuscripts that are substandard or
not appropriate in scope for THE NAUTILUS. Manu-
scripts deemed appropriate for the journal will be sent
for critical review to at least two reviewers. The review-
ers’ recommendations will serve as basis for rejection or
continuation of the editorial process. Reviewed manu-
scripts will be sent back to authors for consideration of
the reviewers’ comments. The revised version of the
manuscript may at this point be considered accepted for
publication by the journal.
Final Submission: Authors of accepted manuscripts are
required to submit a final version via e-mail to the editor
at [email protected]. Please do not send low-resolu-
tion or compressed illustration files at this stage. Send any
files larger than 20 Mb on a CD or DVD to the editor.
Proofs: After typesetting, proofs will be sent to the au-
thor. Author should read proofs carefully and send cor-
rections to the editor within 48 hours. Changes other than
typesetting errors will be charged to the author at cost.
Offprints: An order fonn for offprints will accompany
the proofs. Offprints will be ordered through the editor.
Authors with institutional, grant, or other research sup-
ort will be asked to pay for page charges at die rate of
60 per page.
® This paper meets the requirements of ANSI/NISO Z39. 48-1 992 (Permanence of Paper)
libraries
fHE NAUTILUS
N
lO[
J 31 tf
Volume 125, Number 4
December 1 6, 201 1
ISSN 0028-1344
A quarterly devoted
to malacology .
EDITOR-IN-CHIEF
Dr. Jose H. Leal
The Bailey-Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
BUSINESS MANAGER
Amanda Stirn
The Bailey-Matthews Shell Museum
3075 Sanibel-Captiva Road
Sanibel, FL 33957
EDITOR EMERITUS
Dr. M. G. Harasewych
Department of Invertebrate Zoology
National Museum of
Natural History
Smithsonian Institution
Washington, DC 20560
CONSULTING EDITORS
Dr. Rudiger Bieler
Department of Invertebrates
Field Museum of
Natural Histoiy
Chicago, IL 60605
Dr. Arthur E. Bogan
North Carolina State Museum of
Natural Sciences
Raleigh, NC 27626
Dr. Philippe Bouchet
Laboratoire de Biologie des
Invertebres Marins et Malacologie
Museum National d’Histoire Naturelle
55, rue Buffon
Paris, 75005 France
Dr. Robert H. Cowie
Center for Conservation Research
and Training
University of Hawaii
3050 Maile Way, Gilmore 409
Honolulu, HI 96822
Dr. Robert T. Dillon, Jr.
Department of Biology
College of Charleston
Charleston, SC 29424
Dr. Eileen H. Jokinen
8234 E. North Shore Road
Sauk Ste. Marie, MI 49783
Dr. Douglas S. Jones
Florida Museum of Natural Histoiy
University of Florida
Gainesville, FL 32611-2035
Dr. Harry G. Lee
4132 Ortega Forest Drive
Jacksonville, FL 32210
Dr. Charles Lydeard
Biodiversity and Systematics
Department of Biological Sciences
University of Alabama
Tuscaloosa, AL 35487
Bruce A. Marshall
Museum of New Zealand
Te Papa Tongarewa
P.O. Box 467
Wellington, NEW ZEALAND
Dr. James H. McLean
Department of Malacology
Natural History Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Paula M. Mikkelsen
Paleontological Research
Institution
1259 Trumansburg Road
Ithaca, NY 14850
Dr. Diarm aid 6 Foighil
Museum of Zoology and Department
of Biology
University of Michigan
Ann Arbor, MI 48109-1079
Dr. Gustav Paulay
Florida Museum of Natural Histoiy
University of Florida
Gainesville, FL 32611-2035
Mr. Richard E. Petit
P.O. Box 30
North Myrtle Beach, SC 29582
Dr. Gary Rosenberg
Department of Mollusks
The Academy of Natural Sciences
1900 Benjamin Franklin Parkway
Philadelphia, PA 19103
Dr. Angel Valdes
Department of Malacology
Natural Histoiy Museum
of Los Angeles County
900 Exposition Boulevard
Los Angeles, CA 90007
Dr. Geerat J. Vermeij
Department of Geology
University of California at Davis
Davis, CA 95616
Dr. G. Thomas Watters
Aquatic Ecology Laboratory
1314 Kinnear Road
Columbus, OH 43212-1194
SUBSCRIPTION INFORMATION
The subscription rate for volume
126 (2012) is US $60.00 for
individuals, US $97.00 for
institutions. Postage outside the
United States is an additional US
$10.00 for regular mail and US
$28.00 for air delivery. All orders
should be accompanied by payment
and sent to: THE NAUTILUS, P.O.
Box 1580, Sanibel, FL 33957, USA,
(239) 395-2233.
Change of address: Please inform
the publisher of your new address at
least 6 weeks in advance. All
communications should include both
old and new addresses (with zip
codes) and state the effective date.
THE NAUTILUS (ISSN 0028-1344)
is published quarterly by The Bailey-
Matthews Shell Museum, 3075
Sanibel-Captiva Road, Sanibel, FL
33975.
Periodicals postage paid at Sanibel,
FL, and additional mailing offices.
POSTMASTER: Send address
changes to: THE NAUTILUS
P.O. Box 1580
Sanibel, FL 33957
THE0NAUTILUS
CONTENTS
Volume 125, Number 4
December 16, 2011
ISSN 0028-1344
M.G. Hai •asewyeh The Delray Beach, Florida, colony of Cerion ( Paracerion ) tridentatum
Masoumeh Sikaroodi costellata Pilsbry, 1946 (Gastropoda: Pulmonata: Cerionidae):
Patrick M. Gillevet Evidence for indirect Cuban origins 173
Fred G. Thompson Mexistrophia , a new genus of Cerionidae from Mexico
(Gastropoda: Pulmonata: Urocoptoidea) 182
Richard L. Squires New Cretaceous turbiniform vetigastropods (Gastropoda) from
the Pacific slope of North America 193
Kazutaka Amano Giant fossil Acharax (Bivalvia: Solemyidae) from the Miocene of Japan 207
Hisao Ando
Santiago F. Genta-Iturreria Redescription of the genus Modiomytilus Griffin, 1990
Miguel Griffin ( Bivalvia: Mytilidae) from Southern Patagonia with remarks on
Martin Rodriguez Raising the paleobiogeography of the genus 213
Linsey E. Haram Contribution to the biology and ecology of the spongivorous snail
James T. Carlton Cerithiopsis greenii (Gastropoda: Cerithiopsidae) in New England, USA 221
A.C. van Bruggen Albert R. Mead, 1915-2009, noted American malacologist: An obituary 228
J.I. Mead
Notice
234
Author Index
235
STATEMENT OF OWNERSHIP, MANAGEMENT, AND CIRCULATION
1. Publication Title, THE NAUTILUS.
2. Publication No., 0028-1344.
3. Filing Date, September 1, 2011.
4. Issue Frequency, Quarterly.
5. No. ol Issues Published Annually, Four.
6. Annual Subscription Price, US $97.00.
7. Complete Mailing Address of Known Office of Publication, 3075 Sanibel-Captiva Road, Sanibel, FL 33957 USA
8. Complete Mailing Address of Headquarters, same as 7.
9. Full Names and Complete Mailing Addresses of Publisher, The Bailey-Matthews Shell Museum, 3075 Sanibel-Captiva Road,
Sanibel, FL 33957 USA
Editor, Dr. Jose H. Leal, address as above.
Managing Editor, Amanda Stirn, address as above.
10. Owner, Shell Museum and Educational Foundation, Inc., address as above.
11. Known Bondholders, Mortgagees, and Other Security Holders Owning or Holding 1 Percent or More of Total Amount of
Bonds, Mortgages, or Other Securities, None.
12. The purpose, function, and nonprofit status of this organization and the tax exempt status for federal income tax purposes has
not changed during the preceding 12 months.
13. Publication Name, THE NAUTILUS.
14. Issue Date for Circulation Data Below, September 1, 2011
Average Single
15. Extent and Nature of Circulation 12 months Issue
THE NAUTILUS 125(4):173-181, 2011
Page 173
The Delray Beach, Florida, colony of Cerion (Paracerion)
tridentatum costellata Pilsbry, 1946 (Gastropoda: Pulmonata:
Cerionidae): Evidence for indirect Cuban origins
M. G. Harasewych
Department of Invertebrate Zoology
National Museum of Natural History
Smithsonian Institution
Washington, DC 20013-7012 USA
[email protected]
Masoumeh Sikaroodi
Patrick M. Gillevet
Molecular Environmental Biology
Department of Environmental Sciences and Policy
George Mason University, Prince William Campus
10900 University Boulevard, MSN 4D4
Manassas, VA 20110 USA
[email protected]
pgilleve@gmu . edi i
ABSTRACT
A large colony of Cerion has recently been reported from
Delray Beach, Florida, far north from the ranges of both
native and introduced species of Cerion. Specimens corre-
spond moiphologieally to the type series of Cerion
(Paracerion) tridentatum costellata Pilsbry, 1946, which no
longer survives at its type locality (Fort Jefferson, Garden
Key, Diy Tortugas, Florida.) Historical data indicate that this
taxon is a hybrid of two or more of the five Cuban species of
Cerion introduced to Fort Jefferson by Bartsch in June, 1924.
Museum records document that a propagule of this hybrid
taxon was transplanted to Boynton Beach in the late 1940s
and proliferated to give rise to the Delray Beach colony.
Partial cytochrome c oxidase I sequences reveal the Delray
colony to be monophyletic, and of exclusively Cuban ancestry.
Limited sampling confirms the presence of mitochondrial
genes from two ( C . tridentatum and C. sculptum marielinum)
of the five Cerion taxa introduced to Fort Jefferson in 1924. A
larger sample size, together with data from nuclear genes, will
be needed to rule out the presence of rare alleles from other
taxa. Transplantation of this newly formed hybrid propagule
to an area distant from either parent population has allowed it
to evolve in isolation and provides a unique opportunity to
study the origins and persistence of genetic diversity within
the genus Cerion.
Additional keywords: Native species, introduced species, cyto-
chrome e oxidase I
INTRODUCTION
The fossil history of the Genus Cerion in Florida dates
from the Oligocene/early Miocene (Petueh, 2004: 73),
yet the Recent fauna is limited to a single native species
with four subspecies or varieties, and to survivors of a
series of experimental introductions during the early 20th
Century. These introductions and the fates of the
resulting colonies were documented in detail by Bartsch
(1913-1931), summarized by Pilsbry (1946: 165-169), and
reviewed by Harasewych and Strauss (2006: table I.C.,
fig. 1).
Harasewych and Strauss (2006) also detailed the
occurrence of a well-established yet previously
unreported colony of Cerion in Delray Beach, Florida,
far north from the ranges of either the native or any of
the introduced species. These authors conjectured that,
“whether transported by a hurricane or intentionally
introduced, the most proximal sources for the Delray
Beach colony are the Cerion faunas of the Little Bahama
Bank or of the Bimini Islands. 1 lowever, comparisons of
the shells of both mottled and unpigmented phenotypes
from the Delray Beach colony with the primary types
of each of the named Cerion from the Bimini Islands
(5 taxa) and the Little Bahamas Bank (9 taxa) failed to
produce a close match, leading Harasewych and Strauss
(2006) to speculate that the Delray Beach colony may
be a hybrid population descended from two or more
propagules introduced some time near the middle
of the 20* 11 Century.
In the present study, we investigate more broadly
the potential sources of the Delray Beach colony ol
Cerion. Historical records of the various transplanta-
tion experiments and relevant museum collections
were examined. In addition, partial sequences of the
mitochondrial cytochrome e oxidase I gene derived
from examples of both white (Figure 1) and mottled
(Figure 2) phenotypes were compared against repre-
sentative Cerion taxa spanning the current range of
the genus, including the Bimini Islands and Little
Bahamas Bank. These molecular data, supplemented
by morphological comparisons and archival records,
are used to ascertain the identity and sources for this
introduced colony.
Page 174
THE NAUTILUS, Vol. 125, No. 4
Figures 1-15. Species of Cerion treated in this study. 1-6. Cerion ( Paracerion ) tridentatum costellata Pilsbry, 1946. 1. White and
2. mottled morphotypes, USNM 1123779. Between highway A1A and the Ocean, at northern limit of public beach, Delray
Beach, Florida, Florida (26°28.032’ N, 80°3.382’ W). On vegetation on seaside sand dunes, within 0.5 m of the ground. JV1.G.
Harasewych coll., July 7, 2008. 3. Leetotype (here designated), specimen figured in Pilsbry, L946:fig. 80d. ANSP 1792/4. 4.
Paralectotype, specimen figured in Pilsbry, 1946: fig. 80c. ANSP 426010. Both from Garden Key, Dry Toitugas, Floiida, Bales
and McGinty coll., 1941. 5. White and 6. mottled morphotypes, ANSP 192703, from the McGinty lawn, Boynton Beach, Florida,
Pilsbry coll.,' April 1954. 7-11. Taxa introduced to Fort Jefferson, Garden Key, Dry Tortugas, by Paul Bartsch in June, 1924. 7.
Cerion ( Paracerion ) tridentatum Pilsbry and Vanatta, 1895, USNM 392820, Bincon de Guanaba at Playa, Cuba. Bartsch coll..
May 29, 1924. 8. Cerion chrysalis Ferrusac, 1832, USNM 361745, Cabanas Fort, Havana Cuba, Bartschcoll., May 27, 1924. 9.
Cerion sculptum Poey, 1858,' USNM 361763, near Light House, Mariel, Cuba. Bartsch coll.. May 29, 1924. 10. Cerion mumia
Bruguiere, 1792. USNM 391821, the point at Miramar, Cuba. Bartsch coll, 1924. 11. Cerion “species". USNM 361766, east of
the point at Mariel Cuba, Bartsch coll., 1924. 12-15. Dried museum specimens of Cerion used for DNA extraction. 12-13.
Cerion ( Paracerion ) tridentatum Pilsbry and Vanatta, 1895, USNM 392820, Rincon de Guanaba at Playa, Cuba. Bartsch coll.,
May 29, 1924. 14. Cerion ( Paracerion ) tridentatum costellata Pilsbry, 1.946, USNM 487438a. 15. Cerion sculptum Poey, 1858,
USNM 487438b, both from, Garden Key, Dry Tortugas, Florida. G.R. Bales coll., May 3, 1947. Abbreviations: e, epiphragm, t,
dried tissue used for DNA extraction.
M. G. Ilarasewyeh et al., 201 1
Page 175
MATERIALS AND METHODS
With the exception of the Cerion samples from Cuba
and Fort Jefferson in the Diy Tortugas, which were
available only as dried museum specimens, DNA
from each of the taxa listed in Table 1 was extracted
from a portion ol the digestive gland and gonad
dissected from living specimens using a Qiagen
DNeasy extraction kit according to manufacturer’s
protocol.
In order to obtain DNA from older museum spec-
imens, individuals with intact epiphragms were
selected, and the dorsum of the shell removed using a
Wizard Model 100 Saw (Diamond Pacific Tool Corp.)
with a diamond lapidary blade. This usually revealed
second, and occasionally third, epiphragms, as well as
desiccated tissues (Figure 15). Small fragments of
dried digestive gland and gonad were extracted using
the Qiagen DNeasy kit. The initial lysis step was
extended to 48 hours at 65°C with continuous agita-
tion, until the tissues completely disintegrated. Sub-
sequent steps were according to manufacturer’s
protocol.
A portion of the mitochondrial cytochrome oxidase I
gene was amplified using Sigma Jumpstart Red Taq
Ready Mix and Folmer et al. (1994) primers. Resulting
PCR products were purified using AMPure magnetic
beads (Agencourt, manufacturer’s protocol) and
sequenced using either ARI 3130x1 or Spectrumedix
9600 fluorescent sequencers. Sequences were manually
checked and assembled using Sequencher 4.6 (Gene
Codes Corp.), and aligned against the cytochrome c oxi-
dase 1 gene of Albinaria caemlea (Deshayes, 1835)
(1529 bp) derived from its complete mitochondrial
genome (Hatzoglou et ah, 1995; GenBank NC 001761)
using ClustalX 2.1 (Larkin et ah, 2007). The ends and
primers were trimmed, yielding an alignment of 655
bases corresponding to positions 39 to 693 of the COI
gene in Albinaria caemlea. Aligned sequences were
reviewed and translated to 218 amino acid sequences
using MeClade Version 4.08 (Maddison and Maddison,
1992) and the extended Drosophila mtDNA genetic-
code. Relationships among the taxa based on nucleotide
and amino acid sequences were analyzed using PA UP
4.0bl0 (Swofford, 2002).
RESULTS
Comparative Morphology and Historical Review:
Specimens ol the Delray Beach colony of Cerion (Fig-
ures 1, 2) were compared against samples of each of
the native and non-native taxa introduced to Florida
(Harasewyeh and Strauss, 2004: Table 1) as well as
with Cerion tridentatum costellata Pilsbry, 1946, a
form that Pilsbry described from Garden Key (Dry
Tortugas). The Delray Beach Cerion matched closely
the type series Cerion tridentatum costellata , which also
includes both white (Figure 3) and mottled (Figure 4)
phenotypes.
There were no native Cerion species in the Diy
Tortugas prior to Bartsch’s introductions during the
first quarter of the twentieth century (Bartsch, 1913-
1931). The majority of these transplantation and
hybridization experiments were conducted on Logger-
head Key, where the Carnegie Institution of Washing-
ton maintained its Marine Biology Laboratory from
1903 until 1939. However, Cerion were also introduced
onto Garden Key, Man Key, Boy Key, and Bird Key in
the Diy Tortugas.
Cerion species were introduced onto Garden Key on
two occasions. On June 8, 1912, 138 specimens of a
species later to be named Cerion viaregis Bartsch, 1920
were planted in the "back of a small unpainted house on
the northeast side of the Fort, Garden Key, Tortugas.”
(Bartsch, 1913: 130). Bartsch visited this planting on
May 2, 1913, and found 60 ol the Cerion still li\dng. He
concluded that the site was unsuitable for the colony and
transplanted the living specimens to the inside of the
fort, near the center (Bartsch, 1914a: 170-171). He
revisited this colony on April 27, 1914, and discovered
that "the second planting inside the fort had been
burned over; 28 dead shells were found, but the rest
had disappeared. A visit to the original planting showed
6 living specimens, but no young.” On January 16, 1919,
“a careful search was made both within and without the
fort, but not a trace of Cerion was discovered, so it is
feared that this colony has disappeared.” (Bartsch,
1920a: 19-20)
On June 5-20, 1924, Bartsch (1924b: 187) introduced
2,125 specimens of Cuban Cerion onto the west and
north side of the parapet at Fort Jefferson on Garden
Key. These included: 500 specimens of Cerion
tridentatum Pilsbry and Vanatta, 1895, from Rincon de
Guanabon (Figure 7); 500 specimens of Cerion chrysalis
Ferrusac, 1832, from near Cabanas Fort (Figure 8); 500
specimens of Cerion scidptum Poey, 1858, from near the
lighthouse at Marie! (Figure 9); 500 specimens of Cerion
murnia Bruguiere, 1792, from the point at Miramar (Fig-
ure 10); and 125 young specimens of a species of Cerion
that Bartsch considered to be undescribed (similar to
C. johnsoni) from east of the point at Marie] (Figure 11).
Upon revisiting these colonies the following year,
Bartsch (1925a: 222) reported that “the colonies which
we introduced on the top of Fort Jefferson last year
also showed considerable mortality, also considerable
living specimens.” In August 1927, the colonies on
the parapet were reported to be “holding their own”
(Bartsch, 1927: 216). By August 1931, Cerion mumia,
C. chrysalis, and C. tridentata were “thriving”, while
C. scidptum , and C. n. sp. “seemed not to have survived”
(Bartsch, 1931: 373).
In his treatment of the genus Cerion , Pilsbry (1946)
discussed Bartsch’s transplantation experiments in the
Florida Keys. Citing a letter from Bartsch, Pilsbry
(1946: 166) reported that specimens of Cerion
striatellum (Guerin, 1829) from Balena Point, near
Guaniea Bay, Puerto Rico, were also introduced to the
parapet at Fort Jefferson in 1924. This species was not
Page 176 THE NAUTILUS, Vol. 125, No. 4
Table 1. Tax a, locality data, voucher specimen information and GenBank Accession information for the samples used in this study.
USNM = National Museum of Natural Histoiy, Smithsonian Institution.
GenBank Accession
GREAT BAHAMA BANK
BIMINI
(Continued)
that C. striatellum was not represented in the collec-
tions made in the Tortugas in 1941 by Dr. Bales and
Mr. McGinty.
Working with the 1941 collections from the Tortugas,
Pilsbry (1946: 168) reported that no specimens of
C. viaregis or C. mumia were present, and questioned the
identity of die species that Bartsch referred to as
C. mumia. Pilsbry revised die nomenclature for the sur-
viving taxa introduced to Garden Key to: C. chrysalis
fastigatum Maynard, 1896 and C. sculptum marielinum
Pilsbry, 1927, commenting that both were abundant on
Garden Key in 1941, as was Cerion tridentatum. lie also
noted that the typical smoodr form of C. tridentatum was
rare on Garden Key, and went on to name the prevalent,
ribbed form as Cerion tridentatum cost dial a. illustrating
three specimens (Pilsbry, 1946: fig. 80, b, c, d) that
included both white and mottled phenotypes. The
unpigmented specimen (Figure 3) illustrated in (Pilsbry,
1946: fig. 80, d) is selected here as the lectotype (ANSP
179274). The remaining syntypes (Figure 4) become
paralectotypes and have been recatalogued as ANSP
426010.
Additional specimens of living Cerion tridentatum
costellata and C. sculptum marielinum sampled from
Garden Key on May 3, 1947, are represented in
the collections of the National Museum of Natural His-
tory (USNM 487438). A survey of Garden Key by the
senior author in July 2006 revealed numerous dead
Cerion on the parapets of Fort Jefferson, but no living
Cerion were found anywhere on Garden Key.
The collections of the Academy of Natural Sciences
contain a lot (ANSP 192703) of several specimens
corresponding to Cerion tridentatum costellata col-
lected by Pilsbry in 1954. The label, hand written by
Pilsbry, identifies the specimens only as Cerion , but
states that they are from Boynton Beach, Florida,
“from the McGinty lawn, April, 1954. Imported from
Andros + the Keys 5 or 6 years before.” The
“McGinty lawn”, on Old Ocean Boulevard in Boynton
Beach, was roughly 3 kilometers north of the Delray
The phenotype Cerion tridentatum costellata , which
presently inhabits Delray Beach, traces its origin to Fort
Jefferson, on Garden Key, and may be a hybrid of two or
more of five Cuban taxa introduced there by Bartsch in
1924: Cerion tridentatum, Cerion mumia (identity
questioned by Pilsbry), Cerion chrysalis (revised by
Pilsbry to C. chrysalis fastigatum), Cerion sculptum
(revised by Pilsbry to C. sculptum marielinum), and an
undescribed taxon of Cerion similar to C. johnsoni.
There are conflicting reports as to whether the Puerto
Rican Cerion striatellus was among the species that were
introduced to Fort Jefferson, and may have thus contrib-
uted to the genotype.
During the 1940s, propagules of Cerion from “the
Florida Keys and Andros’ Island in the Bahamas were
introduced to the McGinty’s lawn. While it seems certain
that a sample of Cerion from Fort Jefferson was among
those introduced to Boynton Beach, it is less clear how
many, if any, of the four native and 13 introduced species
from the Florida Keys (Harasewych and Strauss, 2006:
Table I) or the 26 named species from Andros Island
(see Harasewych, 2009) were also introduced to Boynton
Beach, and thus may have contributed to subsequent
hybridizations.
Evidence From Partial Cytochrome e Oxidase I
Sequences: The strict consensus of six most parsimo-
nious trees based on maximum parsimony analyses of
a 655 bp segment of the cytochrome c oxidase I gene
(Figure 16) groups individuals from the same taxon, as
well as taxa inhabiting the same island (e.g., Long
Island, Eleuthera) or island group (e.g., Bimini Islands,
Turks and Caicos Islands) with a high level of support.
All Delray specimens, both mottled and white,
emerged in a single, highly supported clade that also
included two Cuban specimens of Cerion tridentatum
(Figures 12, 13) from the same 1924 sample as the 500
individuals of this species that were introduced to Fort
Jefferson, as well as a specimen of C. tridentatum
Page 178
THE NAUTILUS, Vol. 125, No. 4
Aruba
Albinaria caerulea
Cerion uva 1
Cerion uva 2
Cerion s culptum Ft Jefferson
Cerion Delray WHITE 1
Cerion Delray MOTTLED 1
Cerion tridentatum Ft Jefferson WHITE
Cerion tridentatum Cuba MOTTLED 1
Cerion tridentatum Cuba MOTTLED 2
Cerion Delray WHITE 2
Cerion Delray MOTTLED 2
Cerion Delray WHITE 3
Cerion Delray MOTTLED 3
Cerion Delray MOTTLED 4
Cerion Delray WHITE 4
Cerion striatellum 1
Cerion striatellum 2
Cerion watlingense 1
Cerion watlingense 2
Cerion lewisi 1
Cerion lewisi 2
Cerion regina 1
Cerion regina 2
Cerion bendalii 1
Cerion bendalii 2
Cerion biminiense 1
Cerion biminiense 2
Cerion lemeri 1
Cerion lemeri 2
Cerion malonei 1
Cerion malonei 2
Cerion josephinae 1
Cerion josephinae 2
Cerion femandina 1
Cerion femandina 2
Cerion glans 1
Cerion glans 2
Cerion uniformis 1
Cerion uniformis 2
Cerion uniformis 3
Cerion casablancae 1
Cerion casablancae 2
Cerion pepperi 1
Cerion pepperi 2
Cerion pepperi 3
Cerion incanum 1
Cerion incanum 2
Cerion incanum 3
Albinaria caerulea
Cuba
Puerto Rico
San Salvador
Turks &
Caicos
Abaco
Bimini
Long
Island
Eleuthera
Andros
Florida
Keys
N = 1
L = 72
Cl = 0.
Rl = 0.
17
847
941
r1!
Cerion uva 1
Cerion uva 2
_4 | Cerion striatellum 1
' Cerion striatellum 2
Cerion Delray WHITE 1
Cerion Delray MOTTLED 1
jj-L Cerion sculptum Ft Jefferson
■ Cerion tridentatum Ft Jefferson WHITE
Cerion tridentatum Cuba MOTTLED 1
Cerion tridentatum Cuba MOTTLED 2
Cerion Delray WHITE 2
i Cerion Delray MOTTLED 2
Cerion Delray WHITE 3
Cerion Delray MOTTLED 3
Cerion Delray MOTTLED 4
Cerion Delray WHITE 4
Cerion bendalii 1
Cerion bendalii 2
1- Cerion lewisi 1
Aruba
Puerto Rico
Cuba
H
Cerion lewisi 2
Cerion regina 1
Cerion regina 2
L- Cerion watlingense 1
Cerion watlingense 2
Cerion biminiense 1
Cerion lemeri 1
Cerion lemeri 2
Cerion glans 1
Cerion glans 2
Cerion uniformis 1
Cerion uniformis 2
Cerion uniformis 3
Cerion femandina 1
ll Cerion femandina 2
Cerion josephinae 1
Cerion josephinae 2
I Cerion malonei 1
"T-L Cerion malonei 2
_lj Cerion casablancae 1
i Cerion casablancae 2
Cerion pepperi 1
Cerion pepperi 2
Cerion pepperi 3
Cerion incanum 1
Cerion incanum 2
Cerion incanum 3
Cerion biminiense 2
Abaco
Turks &
Caicos
| San Salvador
Bimini
Eleuthera
Long
Island
Andros
Florida
Keys
Figures 16-17. Relationships of the Delray Beach population of Cerion , based on maximum parsimony analyses of a 665 bp
segment of the cytochrome c oxidase I gene (CO I) using representative taxa spanning the geographic range of the genus. 16. Strict
consensus of 6 most parsimonious trees, bootstrap proportions given in % above, and jackknife proportions given in % below nodes
supported at levels above 50%. 17. Single most parsimonious tree based on amino acid sequences translated using the Drosophila
mtDNA (extended) genetic code.
costellata (Figure 14) and of Cerion sculptum
marielinum (Figure 15) that were collected on Garden
Key in 1947. This clade is comprised of two subelades,
each also highly supported. One includes the specimen
of Cerion sculptum marielinum and two Delray spec-
imens, one white, the other mottled. The other subclade
includes the two 1924 specimens of Cerion tridentatum ,
the 1947 specimen of C. tridentatum costellata , and the
remaining six Delray specimens, three white and three
mottled. These data indicate that both C. tridentatum
and C. sculptum marielinum have contributed to the
genotype of C. tridentatum costallata at Fort Jefferson,
and that traces of both parent taxa persist in the mito-
chondrial genomes of the Delray Beach population in a
3: 1 ratio after more than 60 years. As none of the Delray
specimens (n = 8) appeared elsewhere in the tree, there
is no evidence to indicate that other Floridian or Andros
Island taxa have contributed to, or persist in, the geno-
type of the Delray Beach population. However, a sub-
stantially larger sample size, and data from nuclear genes
would be needed to rule out the presence of rare alleles
from other taxa.
The nucleotide sequences were translated to amino
acids, and the maximum parsimony analysis repeated,
resulting in a single most parsimonious tree (Figure 17).
Neither individuals of the same taxon, nor taxa
inhabiting the same island or island group, were well
resolved. However, coarser patterns were detected.
Amino acid sequence data were sufficient to segregate
taxa inhabiting each of the following island groups:
Dutch Leeward Islands, Puerto Rico, Cuba, Little
Bahama Bank, and Grand Bahama Bank, with San Sal-
vador and Turks and Caicos Islands grouping with the
Grand Bahama Bank.
As with the nucleotide sequence data, all Delray spec-
imens emerged in a single, highly supported clade that
M. G. Harasewych et al., 2011
Page 179
also included die Cuban C. tridentatum and die two
Fort Jefferson specimens. These results support an
exclusively Cuban ancestry for all specimens in the
clade. This clade was subdivided into two weakly
supported subclades identical in composition to those
based on nucleotide data, except that the two specimens
from Fort Jefferson (C. tridentatum costellata and C.
sculptum ) were grouped together within the large clade.
These two specimens shared a single tyrosine (TAT) to
serine (TCG) substitution not present in any other
Cerion studied.
It is interesting to note that Cerion incanum (Binney,
1851), from the Florida Keys, consistently grouped with
the samples from Andros Island, Bahamas in both analy-
ses, contradicting early hypotheses of a Cuban origin for
this species (e.g., Binney, 1851: 153; Pilsbry, 1902: 213;
1907: 193; 1946: 162; Dali, 1905: 30).
DISCUSSION
The transplantation experiments conducted by Bartsch
in the early 20th Century and subsequent, less well-
documented intentional introductions by others (e.g.,
Krieger and Austin, 1975), are anathema to modern con-
servation biologists. Nevertheless, the survivors of
Bartschs diligently recorded experiments provide
insights into the processes by which many of the numer-
ous phenotypes within the genus Cerion (> 600 named
species level taxa) may have arisen, and how they persist
through time.
The original objective for the transplantations of
propagules of Cerion from Andros Island to a number
of the Florida Keys was to determine if their morphol-
ogy would be altered over several generations by expo-
sure to different environments (Bartsch, 1913). Years
of careful measurement and segregation of multiple
generations of progeny revealed that their morphology
remained unaffected by habitat (Bartsch, 1920; Wood-
ruff and Gould, 1987: 1023). However, in two
instances the Andros Island Cerion hybridized with
the native Cerion incanum to produce phenotypes that
differed markedly from either parent species. This led
Bartsch to redirect subsequent experiments to the pro-
duction of hybrids. The majority of these efforts were
focused on controlled, pairwise combinations of spe-
cies (e.g., Bartsch, 1923a, 1924b), but some, such as
those conducted on the parapets of Fort Jefferson,
were simply the comingling of multiple species
(Bartsch, 1924b).
The hypothesis that hurricanes play an important role
in dispersing propagules of Cerion among neighboring
islands has been widely accepted (e.g., Pilsbry, 1907;
Mayr and Rosen, 1956; Clench, 1957). These infre-
quent, stochastic events are major factors determining
biogeographic patterns within Cerion , and must have
contributed to populating the Florida Keys and the
islands of the Bahamas that had been completely sub-
merged during Pleistocene interglacial high stands
(Hearty et al., 1999). Subsequent introductions of prop-
agules into the range of established populations of
Cerion result in the formation of narrow hybrid zones
in which the phenotypic variation exceeds that of either
parent (Gould and Woodruff, 1986: 435 — 440), and that
are characterized by the presence of unexpected alleles
(hybrizymes) that do not occur in either parent taxon
(Woodruff, 1989).
Gould and Woodruff (1990:78) showed that, whether
the product of hurricane transport or human activity,
such hybrid zones produce distinctive populations with
sharply demarcated boundaries and are the results of
“happenstances of history rather than forces of local
adaptation.” Such area effects are generally ephemeral,
with both the genotype and phenotype of the hybrid
subsumed into that of the numerically dominant parent
taxon over time. Goodfriend and Gould (1996)
documented that phenotypic traits in hybrid zones may
persist for periods on the order of thousands to tens of
thousands of years.
Very few of Bartsch s introductions survive to this
day. The propagule of 500 adult Cerion casablancae
introduced to Indian Key on June 1, 1912 (Bartsch,
1913: 130) has proliferated, and, in the continued
absence of the native Cerion incanum , remains
unchanged in its morphology, and presumably its geno-
type. On Bahia Honda Key, a surviving propagule of 55
Cerion casablancae hybridized with Cerion incanum ,
which reappeared on that Key between 1926 and
1931. The resulting hybrid phenotype and genotype
continue to be assimilated into those of C. incanum.
Based on allozyme studies. Woodruff and Gould (1987:
1040) calculated that “we may be unable to detect
C. casablancae genes on Bahia Honda Key 350 years
from now.”
While these examples of Bartschs transplantations
can be expected to endure fates similar to those of
hurricane introduced propagules, finding a parallel in
nature for the Delray Beach colony is more difficult.
Five Cuban taxa were introduced simultaneously into a
small isolated area on the parapets of Fort Jefferson in
June of 1924. The taxon Cerion tridentatum costellata
was described based on specimens collected in 1941.
This phenotype, not present in any of the five intro-
duced Cuban taxa, was produced in 17 years, roughly
3-5 generations, based on estimates of a generation
time of 4-5 years (Woodruff, 1978: 229). A propagule
from Fort Jefferson of unknown size and composition
(Pilsbry [1946] reported that C. chrysalis fasti-gat um ,
C. sculptum marielinum , Cerion tridentatum [rare]
and Cerion tridentatum costellata were all present on
Fort Jefferson in 1941) was introduced to the “McGinty
lawn” in Boynton Beach in the late 1940s, and possibly
admixed with one or more propagules of other Cerion
from Florida and/ or Andros Island. After 60 + years,
this population has expanded geographically, and is esti-
mated to exceed 105 individuals. Specimens are fairly
uniform in morphology (Figures 1, 2; Harasewych and
Strauss, 2006: figs. 1-8), with the exception that some
THE NAUTILUS, Vol. 125, No. 4
Page ISO
are white and others are mottled. Limited genetic sam-
pling (n = 8) indicates the presence of mitochondrial
genes from two (C. tridentatum and C. sculptum
marielinum) of the five species originally introduced
onto the parapets at Fort Jefferson in a 3:1 ratio that
does not correlate with the presence of mottling. The
possibility of as yet undetected rare alleles from other
taxa cannot be ruled out. The Delray Beach colony of
Cerion tridentatum costellata is more than 100 km dis-
tant from the nearest neighboring population of Cerion.
Thus, this “happenstance of history” has placed a newly
formed hybrid propagule in an area far removed from
either parent population. Rather than being subsumed,
it will continue to evolve in isolation lor the foreseeable
future and provides a unique opportunity to study the
origins and persistence of genetic diversity within the
genus Cerion.
ACKNOWLEDGMENTS
We are very grateful to Wayne Harland, Anne Joffe,
Harry G. Lee, M.D., Anton Oleinik, Yolanda Villacampa,
Peggy Williams, and the late Stephen J. Gould and
Glenn Goodfriend for contributing many of the samples
of Cerion from throughout the range of the genus. We
thank Dr. Gaiy Rosenberg and Paul Callomon for access
to the collections of Cerion at the Academy of Natural
Sciences of Philadelphia. The assistance of Ms. Jeanne
Allegretti, Palm Beach County Property Appraiser, in
determining the precise location of the “McGinty lawn”
is veiy much appreciated. This research was supported
in part by NSF Grant # EAR 1016936. This is
Smithsonian Marine Station at Fort Pierce Contribution
Number 856.
LITERATURE CITED
Bartsch, P. 1913. Planting Bahama Cerions upon the Florida
Keys. Department of Marine Biology, Carnegie Institution
of Washington, Yearbook (1912) 11: 129-13i, pis. 2, 3.
Bartsch, P. 1914. Report of results of the planting of Bahama
Cerions on the Florida Keys. Department of Marine Biol-
ogy, Carnegie Institution of Washington, Yearbook (1913)
12: 169-172.
Bartsch, P 1920. Experiments in the breeding of Cerions.
Papers of the Department of Marine Biology, Carnegie
Institution ol Washington, 14(282): 1-54, pis. 1-59.
Bartsch, P. 1923. Breeding experiments with Cerions. Depart-
ment of Marine Biology, Carnegie Institution of Washing-
ton, Yearbook (1922) 21 : 164-165.
Bartsch, P. 1924. Breeding experiments with Cerions. Car-
negie Institution of Washington, Yearbook (1923-1924)
23: 187-189.
Bartsch, P. 1925. Breeding experiments with Cerions. Car-
negie Institution of Washington, Yearbook (1924-1925)
24: 222-223.
Bartsch, P. 1927. Report on Cerion breeding experiments at
the Tortugas. Carnegie Institution of Washington, Year-
book (1926-1927) 26: 215-216.
Bartsch, P. 1931. Report on Cerion Colonies planted on Florida
Keys. Annual Report of Tortugas Laboratory, Carnegie
Institution of Washington, Year Book (1930-1931) 30:
373-378.
Binney, A. 1851. The Terrestial Air-Breathing Mollusks of the
United States, and the Adjacent Territories of North Amer-
ica: Described and Illustrated by Amos Binney. (published
posthumously, A. A. Gould, Editor). Volume 1. Charles Lit-
tle and James Brown, Boston, xxix + 266 pp., 16 pis.
Clench, W.J. 1957. A catalog of the Cerionidae (Mollusca:
Pulmonata). Bulletin of the Museum of Comparative
Zoology 116: 121-169.
Dali, W. II. 1905. Fossils of the Bahama Islands, with a list of
the non-marine mollusks. In: Shattuek, G.B. (Ed.) The
Bahama Islands. The Geographical Society of Baltimore,
Baltimore, pp. 23^17, pis. 10-13.
Folmer, O., M. Black, W. Hoeh, R. Lutz, and R. Vrijenhoek.
1994. DNA primers for amplification of mitochondrial
cytochrome c oxidase subunit I from diverse metazoan
invertebrates. Molecular Marine Biology and Biotechnol-
ogy 3: 294-299.
Goodfriend, G.A. and S.J. Gould. 1996. Paleontology and
chronology of two evolutionary transitions by hybridiza-
tion in the Bahamian land snail Cerion. Science 274:
1894-1897.
Gould, S.J. and D.S. Woodruff. 1986. Evolution and Systemat-
ics of Cerion (Mollusca: Pulmonata) on New Providence
Island: A Radical Revision. Bulletin of the American
Museum of Natural Histoiy 182: 389—490.
Gould S.J. and D.S. Woodruff. 1990. History as a cause of
area effects: an illustration from Cerion on Great Inagua,
Bahamas. Biological Journal of the Linnean Society 40:
67-98.
Harasewych, M.G. and J. Strauss. 2006. A new record of intro-
duced Cerion (Gastropoda: Pulmonata: Cerionidae) in
southeastern Florida. The Nautilus 120: 94-100.
Harasewych, M.G. (Ed.). 2009. Cerion v 1.02: Cerion: A web-
based resource for Cerion research and identification.
National Museum of Natural Histoiy, Smithsonian Insti-
tution. World Wide Web electronic publication, http://
i n verteb rates . si . edu/ cerion/
Hatzoglou, E., G.C. Rodakis, and R. Leeanidou. 1995. Com-
plete sequence and gene organization of the mitochon-
drial genome of the land snail Albinaria coendea.
Genetics 140: 1353-1366.
Hearty, P.J., P. Kindler, H. Cheng, and R.L. Edwards. 1999.
A+20 m middle Pleistocene sea-level highstand (Bermuda
and the Bahamas) due to partial collapse of Antarctic ice.
Geology 27: 375-378.
Krieger, P. J. and D.F. Austin. 1975. Liguus: The Boynton
Beach Colony after forty years. The Nautilus 89: 97-98.
Larkin, M.A., G. Blackshields, N.P. Brown, R. Chenna, P.A.
McGettigan, H. MeWilliam, F. Valentin, l.M. Wallace, A.
Wilm, R. Lopez, J.D. Thompson, T.J. Gibson, D.G.
Higgins. 2007. Clustal W and Clustal X version 2.0. Bioin-
formatics 23: 2947-2948.
Maddison, W. P. and 13. R. Maddison, 1992. MacClade, analysis
of phylogeny and character evolution. Version 3.05.
Sinauer Associates, Inc., Sunderland, Massachusetts.
Mayr, E. and C.B. Rosen. 1956. Geographic variation and
hybridiation in populations of Bahama snails (Cerion).
M. G. Harasewych et al., 201 1
Page 181
American Museum of Natural History Novitates, 1806:
1-48.
Petuch, E.J. 2004. Cenozoic Seas, the View from Eastern
North America. CRC Press, Boca Raton, 308 pp.
Pilsbry, II. A. 1901-1902. Family Cerionidae. Manual of Con-
chology. Ser. 2. Pulmonata. Academy of Natural Sciences
of Philadelphia 14: 174-286, pis. 27-47.
Pilsbry, II. A. 1907. Origin of the Tropical Forms of the Land
Molluscan Fauna of Southern Florida. Proceedings
of the Academy of Natural Sciences of Philadelphia
59: 193.
Pilsbry, H.A. 1946. Land Mollusca of North America. The
Academy of Natural Sciences of Philadelphia, Monograph
3, Volume 2, part 1: viii + 520 pp.
Swofford, D.L. 2002. PAUP*: Phylogenetic Analysis Using Par-
simony (and Other Methods) 4.0 Beta. Sinauer Associates,
Inc., Sunderland, Massachusetts.
Woodruff, D.S. 1978. Evolution and adaptive radiation of
Cerion : a remarkably diverse group of West Indian land
snails. Malacologia 17: 223-239.
Woodruff, D.S. 1989. Genetic anomalies associated with
Cerion hybrid zones: the origin and maintenance of new
eleetromorphic variants called hybrizymes. Biological
Journal of the Linnean Society 36: 281-294.
Woodruff, D.S. and S.J. Gould. 1987. Fifty years of intespecific
hybridization: genetics and morphometries of a controlled
experiment on the land snail Cerion in the Florida Keys.
Evolution 41: 1022-1045.
THE NAUTILUS 125(4): 182-192, 2011
Page 182
Mexistrophia , a new genus of Cerionidae from Mexico
(Gastropoda: Pulmonata: Urocoptoidea)
Fred G. Thompson
Florida Museum ot Natural History
University of Florida
Gainesville, FL 32611 USA
[email protected]
ABSTRACT
Mexistrophia new genus and three new species of the landsnail
family Cerionidae, Mexistrophia reticulata new species, M.
obsoleta new species, M. inexpectata new species, are described
from northeastern Mexico. The genus is characterized by the
absence ot lamella or other barriers within the shell. The genus
is diagnosed by soft anatomical features as well as shell charac-
teristics. The known distribution of Mexistrophia is confined to
higher elevations at 2000-2600 meters in the Sierra Madre Ori-
ental in the states of Nuevo Leon, Queretaro and Ilidalgo, where
it inhabits cool temperate conifer forests that are subject to
seasonal frosts and occasional freezes. Its distribution is disjunct
geographically and ecologically from that of Cerion , which is
confined to the tropical Caribbean region at veiy low elevations.
Additional keywords: Landsnails, biodiversity, endemism
INTRODUCTION
A prevailing misconception in molluscan biogeography is
that the land snail family Cerionidae is an autochthonous
West Indian element. Cerion , the only extant genus rec-
ognized in the family, has undergone extensive specia-
tion, but has never successfully colonized the mainland,
even though on at least two occasions species became
established in Florida, once in the Oligocene (Dali,
1890), and once by the more recently derived Cerion
incanum (Binney, 1857). Roth and Hartman (1998)
report a probable cerionid, Cerion archerontis, from the
Uppermost Cretaceous of Montana. However, the type
specimen is a fragmented and flattened fossil that defies
clear taxonomic characterization.
During the last forty years, while conducting field
work in Mexico, occasionally I collected peculiar cylin-
dric-conical snails that I identified tentatively as
“Cerion ". They were found in habitats uncharacteristic
ol Cerion. They were set aside among undetermined
“Urocoptidae” until now. Anatomical and conehological
examinations reveal that lliey are Cerionidae, but that
they differ from Cerion as a separate genus. Three new
species are described.
Abbreviations and Text Conventions: The following
symbols are used in the illustrations of anatomical struc-
tures: albl, albumen gland; atr, atrium; app, appendix;
div, diverticulum; epi, epiphallus; fovi, free oviduct;
ovid, oviduct; pen, penis; prm, penis retractor muscle:
pro, prostate; rom, right ocular retractor muscle; spd,
spermatheeal duct; spr, spermatheca; vag, vagina; vas,
vas deferens; vim, vaginal retractor muscle; Institutional
abbreviations: CNMO: Coleccion Nacional de Moluscos,
Mexico; UF: Florida Museum of Natural Histoiy,
Gainesville.
SYSTEMATICS
Mexistrophia new genus
Type Species: Mexistrophia reticulata new species.
Description: Shell small, 10-13 mm length. Shell
pupiform, with a low dome-shaped apex. Protoconch
whorls smooth and do not conspicuously rise above fol-
lowing whorl. Peristome thickened, but only slightly so,
not reflected, incomplete across parietal wall. Outer lip
and columellar lip connected by thin parietal callus.
Outer surface sculptured with fine axial thread-riblets.
Internal axis broad and hollow in upper whorls of dome-
like apex, then narrowing and becoming narrowly per-
forate or solid in last two or three whorls. Internal barrier
of lamellae or denticles lacking at all growth stages (in
contrast with Cerion.)
Anatomy: General anatomical states typically
Cerionidae. Short foot lacking a suprapedal groove. Plain
lung, with unbranched pulmonary vein. Kidney short,
with very short ureter near the end. Secondary ureter
absent.
Reproductive system typically cerionid. Genital atrium
moderately long and capacious. Epiphallus poorly differ-
entiated from vas deferens. Epiphallus + vas deferens
form very long loop that extends alongside oviduct-
prostate. Penis consists of two parts. Epiphallus entering
middle of penis. Penis ending in blind diverticulum distal
F. G. Thompson, 2011
Page 183
to epiphallus. Penis retractor muscle inserts on apex of
diverticulum. Right ocular retractor muscle passes mesad
to genitalia and attaches to right pedal retractor muscle.
Spermathecal duct veiy long, with very long appendix, or
lacking an appendix. Spermathecal duct unites with free
oviduct to form distinct vagina. Free oviduct stout and
slightly longer than vagina. Stout vaginal retractor muscle
originates on right ocular retractor muscle and inserts on
vagina (Figures 24—25).
Radula of Mexistrophia is typical Cerionidae with
nearly flat horizontal tooth rows that do not curve
upward near margins. Central tooth tricuspid. Lateral
and marginal teeth bicuspid with large mesoeone and
small ectocone. Mesoeone of marginal teeth long,
extending beyond base of tooth. Laterals and marginals
lacking entocones.
Habitat and Distribution: Mexistrophia are ground-
dwelling snails that are found in eastern Mexico in cool
temperate coniferous forests at high elevations.
Etymology: Mexistrophia (f.). The genus name is
taken from Mexi-, Mexico, and strophia, Gr. orpotpe, a
turning point, such as an axis. Strophia Albers, 1850 is an
earlier generic name that was widely used for Cerion
(not Strophia Meigen, 1832, Lepidoptera).
Mexistrophia reticulata new species
(Figures 1-6, 20, 22, 27, 28, Table 1)
Diagnosis: Pupiform shell, moderately robust, about
9-13 mm long. Conspicuous white peristome lacking
noticeable callus reinforcing it internally. Sculpture
consisting of thread-riblets, with upper ends that weakly
crenulate the suture. Spermathecal duct with long
appendix.
Description: Shell (Figures 1-6). Shell pupiform.
Spire cylindrical, relatively slender, with low domed-
shaped apex. Shell wall opaque. Ground color light
brown mottled with lighter irregular-shaped spots and
streaks that form reticulated pattern. White streaks tend
most conspicuous on upper ends of ribs. Peristome
and adjacent interior of aperture white. Deeper within,
inner wall and axis rust-colored. Shell 10.5-13.2 mm
long, 3. 9^4. 4 mm wade, and 0.31-0.38 times as wide as
long. Shell contains 8. 0-9. 2 whorls separated by weakly
impressed suture. Protoconch consisting of two smooth
whorls slightly elevated above following whorls. Follow-
ing whorls sculptured with numerous oblique thread-
riblets strongest on apical whorl, but nearly equally
developed on spire. Riblets strongest below suture and
weakly crenulate suture. Umbilicus imperforate or nar-
rowly rimate. Thick peristome weakly reflected and
discontinuous across parietal wall, where it is replaced
by thin glaze. Aperture ovate, slightly higher than wide,
0.28-0.33 times shell length, and 0.67-0.80 times
shell width. Aperture slightly prosocline in lateral profile
(Figure 5). Axis conspicuously enlarged in apical whorls.
Cylindric part of shell axis slightly sinuous, much
narrower, and narrowly perforate or solid by last whorl
(Figure 6). (Measurements based on the holotype and
twelve paratypes are given in Table i . )
Anatomy: Reproductive anatomy (Figures 20-22)
(Five specimens examined (UF 211 129): Genital atrium
(atr) moderately long and capacious. Right ocular retrac-
tor a narrow slip of muscle that passes mesad to lower
genitalia, attaching to vagina in conjunction with vaginal
retractor muscle. Stout penis (pen) bulbous, consisting
of two nearly equal sections. Distal section forming glo-
bose, blind diverticulum (div). Short penis retractor
muscle (prm) originating on inner wal 1 of lung and
inserting on end of diverticulum. Epiphallus (epi) enter-
ing middle of penis at base of diverticulum. Epiphallus
moderately stout at union with penis, but gradually grad-
ing into veiy long vas deferens. Epiphallus lined inter-
nally w4th simple longitudinal columns. Spermatheca
(spr) large and elliptical, resting against dorsal side of
oviduct at base of albumen gland. Spermathecal duct
(spd) stout, moderately long, enlarged at base where it
is muscular and weakly convoluted. Duct bearing veiy
long appendix (app) about as long as spermathecal duct.
End of appendix extending to upper end of albumen
gland. Spermathecal duct uniting with free oviduct (fovi)
to form short but distinct vagina (vag). Free oviduct
relatively stout and slightly longer than vagina. Heavy
slip of muscle that is a branch of right pedal retractor
inserting on vagina to form vaginal retractor muscle
(vrm) (Figures 21-22).
Radula (Figures 27-28). Two specimens examined
(UF 445301). Radular formula 14-1-14. Transverse tooth
rows nearly flat, not curving upward at ends. Transition
from lateral teeth to marginal teeth not clearly differen-
tiated morphologically. Eight lateral teeth and 6 marginal
teeth present in each half-row. Lateral teeth rising slightly,
and marginal teeth becoming nearly horizontal. Central
tooth trapezoidal with indented dorsal edge, 18 pm wide
and 20 pm high. Central tooth with large lanceolate
mesoeone, 15 pm long, extending to base of tooth.
Mesoeone flanked on each side by short acuminate
ectocone. Lateral teeth with long, slender mesoeone
overlaping tooth below, and small ectocone. Marginal
teeth with long mesoeone and small ectocone.
Type Locality: A talus slope 1.0 km east of Pinal de
Amoles, Queretaro State, Mexico, 21.15° N, 99.64° W,
2150 m alt.
Type Material: Holotype: UF 211128, collected 25
July, 1993 by Fred G. Thompson and Elizabeth L.
Mihalcik; Paratypes: UF 435013 (30), CNMO 3379 (5),
all from type locality.
Other Material Examined: UF 21 1129; type locality.
Specimens preserved in 75% ETOH.
Habitat: The dominant vegetation in the area con-
sists of pine forests with scattered small oak trees
Page 184
THE NAUTILUS, Vol. 125, No. 4
Figures 1—19. New species ot Mexistrophia. 1—6. Mexistrophia reticulata new species. 1. Holotype (UF 211128). 2-6. Paratypes
(UF 43513). 7-10. Mexistrophia obsolete new species. 7. Holotype (UF 34296). 8-10. Paratypes (UF 435015). 1 1-19. Mexistrophia
inexpectata new species. 1 1. Holotype (UF 226461). 12-19. Paratypes (UF 435014). Scale bar for Figure 1 applies to Figures 1-6;
for Figure 7 to Figures 7-10; for Figure 11 to Figures 11-19.
( Quercus sp.). Snails were found among grasses, mosses
and Sedum growing among limestone cobbles.
Distribution: Queretaro State, Mexico (known only
from the type locality.)
Remarks: For meristic comparisons with other spe-
cies see Mexistrophia inexpectata new species below.
Etymology: The species name reticulata (Latin)
alludes to the reticulated color pattern of the shell.
F. G. Thompson, 20] I
Page 185
3 mm
Page 1S6
THE NAUTILUS, Vol. 125, No. 4
Mexistrophia obsoleta new species
Diagnosis: Distinguished by obese pupiform shape,
obsolescent color pattern, and sculpture in which upper
ends of ribs do not crenulate suture and ribs become
obsolete or are absent on lower two whorls. Peristome
white, relatively narrow, lacking noticeable callus within.
Description: Shell (Figures 7-10) obese-pupiform,
squat cylindrical spire with low domed-shaped apex with
protoconch barely elevated above following whorl. Shell
wall opaque. Ground color light tan with obsolescent
mottling with lighter irregular spots and streaks that do
not form distinct pattern. White streaks most conspicu-
ous on ribs. Peristome and adjacent interior of aperture
white. Deeper within aperture, inner wall and axis very
light rust-colored. Shell 10.5-12.3 mm long, 4. 2-4. 8 mm
wide, and 0.35-0.41 times as wide as long. Shell contains
8.2-9. 1 whorls separated by weakly impressed suture.
Protoconch with two smooth whorls. Following whorls
sculptured with numerous, relatively strong, oblique
thread-rib lets nearly equally developed on apex and ear-
lier whorls of cylinder, becoming obsolete on lower two
whorls. Upper ends of riblets do not crenulate suture.
Umbilicus imperforate or narrowly rimate. Peristome
relatively thin, weakly reflected, and discontinuous
across parietal wall, where it is replaced by thin callus.
Ovate aperture slightly higher than wide, 0.26-0.32
times shell length, and 0.63-0.72 times shell width. Aper-
ture slightly prosocline in lateral profile, not noticeably
thickened within. Axis enlarged in apical whorls
(Figure 10). In cylindric part of shell axis nearly straight,
narrower, becoming narrowly perforate or solid by last
whorl. (Measurements based on the holotype and ten
paratypes are given in Table 2.)
Anatomy: Unknown.
Type Locality: A limestone ravine 15.8 km by road
southwest of Pinal de Amoles, Queretaro State, Mexico
(21.15° N, 99.65° W), 2585 m alt.
Type Material: Holotype UF 34298; collected 27
September, 1970 by Fred G. Thompson; Paratypes UF
435015 (25), CNMO 3373(5); all from type locality.
Distribution: Queretaro State, known from the type
locality and a nearby locality 2 km ENE of Pinal de
Amoles, 2140 m alt. (UF 268262).
Remarks: For meristic comparisons with other spe-
cies see Mexistrophia inexpectata new species, below.
Etymology: The species name obsoleta (Latin) refers
to the barely discernable reticulated color pattern on the
shell, and its sculpture, which becomes obsolete on the
last two whorls.
Mexistrophia inexpectata new speeies
Diagnosis: Relatively slender, pupiform shell with
nine or more whorls. Sculpture nearly uniform over shell
surface, consisting of fine oblique thread-riblets. Peri-
stome narrowly reflected and reinforced internally by
thick callus. Spermathecal duct lacking an appendix.
Description: Shell (Figures 11-19) pupiform. Cylin-
drical spire bearing low domed-shaped apex. Shell wall
opaque or weakly translucent. Ground color light brown
with sparse lighter irregular spots and streaks. White
streaks most conspicuous on upper ends of ribs. Peri-
stome and adjacent interior of aperture white. Deeper
within inner wall and axis rust-colored. Shell 9.8
12.4 mm long, 3.3-3. 5 mm wide, and 0.38-0.35 times as
wide as long, with 9.1-11.0 whorls. Suture weakly
impressed. Protoconch with two smooth whorls slightly
elevated above following whorls. Following whorls sculp-
tured with numerous oblique thread-riblets nearly
equally developed over shell surface. Riblets do not
crenulate suture. Umbilicus imperforate or narrowly
rimate. Thick peristome weakly reflected and discontin-
uous across parietal wall, where it is replaced by thin
glaze. Peristome reinforced internally by thick callus.
Aperture ovate, slightly higher than wide, 0.24-0.37
times shell length, and 0.69-0.76 times shell width,
slightly prosocline, nearly vertical in lateral profile
(Figure 18). Axis conspicuously enlarged in apical
whorls, straight in cylindric part of shell, veiy narrow,
becoming narrowly perforate or solid by last two whorls
(Figure 19). (Measurements based on the holotype and
ten paratypes are given in Table 3.)
Table 2. Mexistrophia obsoleta new speeies. Measurements in mm of the holotype (UF 34298) and 10 paratypes (UF 435015)
selected to show variation. SL = standard length, SW = standard width, ApH = aperture height, ApW = aperture width, Wh =
whorls.
F. G. Thompson, 2011
Page 187
Table 3. Mexistropliia inexpectata new species. Measurements in mm of the holotype (UF 226407) and 10 paratypes (UF 485014)
selected to show variation. SL = standard length, SW = standard width, ApH = aperture height, ApW = aperture width, Wh
whorls.
1 mm
Figures 23-25. Mexistropliia inexpectata new species, reproductive anatomy (UF 226408).
Anatomy: Reproductive anatomy (Figures 23-25)
(Five specimens examined (UF 226408): Genital atrium
(atr) moderately long and stocky. Penis (pen) moderately
long and slender, ending in slender, short, blind divertic-
ulum (div). Penis lined internally with six longitudinal
columns, lacks verge or stimulator. Penis retractor mus-
cle (prm) long and slender, originating on inner lung wall
and inserting on diverticulum end. Right ocular retractor
THE NAUTILUS, Vol. 125, No, 4
Page 188
Figure 26. Cerion uva (Linnaeus, 1758). Reproductive anat-
omy (UF 336946).
muscle (rom) passing mesad to genital system and
inserting into right pedal retractor muscle, attached to
vagina (vag) by short slips of muscle (Figure 25).
Epiphallus (epi) entering the penis (pen) shortly below
diverticulum, long, stout, and poorly differentiated from
vas deferens (vas). Elliptical spermatheca (sper) resting
against side of oviduct-prostate at base of albumen gland.
Spermatheeal duct (spd) relatively stout and lacking
appendix. Duct uniting with free oviduct (fovi) to form
short but well developed vagina (vag). Free oviduct short
but stocky, about as long as combined length of vagina +
genital atrium.
Radula (Figures 29-30) (Two specimens examined,
UF 226408): Radular ribbon 0.55 mm wide by 1.34 mm
long. Radular formula 18-1-18. Transverse tooth rows
horizontal, nearly straight, not curving upward at mar-
gins. Eighteen lateral + marginal teeth present. Lateral
teeth transition without morphological distinction into
marginal teeth. Central tooth as wide as adjacent lateral
teeth, 16 pm wide, trapezoidal, tricuspid. Mesocone acu-
minate, extending beyond tooth base, bordered on each
side by short acuminate ectocone. All seven lateral teeth
bicuspid with large acuminate mesocone and smaller
acuminate ectocone. Marginal teeth with large lanceo-
late mesocone and single acuminate ectocone.
Type Locality: A west-facing hillside on a limestone
exposure, 0.5 km north of El Refugio, Nuevo Leon,
Mexico (23.921° N, 99.719° W), 2360 m alt. The type
locality is in a grassy open “pinon” (pine) forest with
scattered agave and small oaks. Snails were collected
from among and under flags of limestone.
Type Material: Holotype UF 226407; collected 24
July, 1994 by Fred G. Thompson, Elizabeth Mihalcik,
Grady Taylor, and Val }. Roessling; Paratypes UF
435014 (85), CNMO 3371 (10); same data as the holo-
type; UF 267253 (33); collected January, 1996 by Val J.
Roessling; all from type locality.
Distribution: Nuevo Leon State, known only from the
type locality.
Etymology: The species name inexpectatus is from
the Latin and alludes to the fact that the reproductive
system differs from what I anticipated before dissecting
the species.
Remarks: Shell measurements of the three species
of Mexistrophia may be compared as in Table 4.
Mexistrophia inexpectata is separated from M. reticulata
and M. obsoleta by its slender size and by its larger
number of whorls.
ADDITIONAL MEXISTROPHIA
Specimens of Mexistrophia are available from the locali-
ties below. They differ from the new species described
above by size, obesity, and whorl count enough to sug-
gest that they represent different species. Their taxo-
nomic status remains undetermined because only shell
samples are available for study. These samples indicate
that the genus is widespread in northeastern Mexico.
Nuevo Leon: 1.7 km N El Refugio, 18 km. S of Zaragosa;
(UF 258407), collected 4 November, 1995 by Val J.
Roesling.
Hidalgo: Ixmiquilpan (20.483° N, 99.233° W) (UF
179719); leg. Gonzalo Halfter, collected 6 March, 1960.
Qeuretaro: 14 km NE of San Juaqum, turn-off from
Mexico Highway 120 (18.756° N, 96.189° W), 2400 m
alt. (UF 244942); collected by Grady H. Taylor,
8 September 1978.
GEOGRAPHIC DISTRIBUTION OF THE FAMILY
CERIONIDAE
(Figures 33-34)
Mexistrophia is found in eastern Mexico over a north-
south linear distance of about 400 km, and inland by
about 200 km west of the Gulf of Mexico (Figure 33).
It is known from the states of Nuevo Leon, Queretaro,
and Hidalgo, at elevations between 2150-2585 meters.
This is about 1600 km west of the nearest locality
from where Cerion has been reported in the West Indies
(Figure 34). Cerion is strictly a West Indian genus found
in Cuba, Bahamas Islands, Hispaniola, Puerto Rico,
St. Croix, and the Cayman Islands (Fahy, 1996). A single
F. G. Thompson, 2011
Page 189
Figures 27-32. Mexistrophia and Cerion uva , SEM micrographs or radula. 27-28. Mexistrophia reticulata new species (UF
445301). 27. Central and adjacent lateral teeth. 28. Hemi-sections of two horizontal teeth rows. 9-30. Mexistrophia inexpectata
new species (UF 226408). 29. Central and lateral teeth. 30. Hemi-section of a horizontal tooth row. 31-32. Cerion uva (UF 249.358).
31. Central and adjacent lateral teeth. 32. Hemi-section of a horizontal tooth row.
Page 190
THE NAUTILUS, Vol. 125, No. 4
Table 4. Comparisons of measurements (mm) and meristic
counts among the three new species of Mexistrophia described
in this article.
species, C. uva (Linnaeus, 1758), occurs on the Dutch
Leeward Islands. A single species, C. incanum (A.
Binney, 1857), occurs naturally on the mainland in
extreme southeastern Llorida. No species of Cerion has
been found in suitable coastal habitats in eastern Mexico
or Central America, although during the last two centu-
ries experienced collectors searched such habitats for
non-marine mollusks at numerous localities.
ECOLOGICAL DEPLOYMENT OL MEXISTROPHIA
The ecological deployment of Mexistrophia contrasts
strongly with the ecological distribution of West Indian
Cerionidae. Nearly all West Indian Cerionidae are found
at very low elevations, of only a few meters to tens of
meters. Generally they occur at just a few meters to a few
kilometers from the nearest shoreline among tropical
vegetative associations.
In striking contrast species of Mexistrophia occur at
elevations of greater than 2000 meters, and are found
inland at more than 200 kilometers from the Gulf of
Mexico. They occur in cool nresic or submesic temper-
ate coniferous forests. Winter frosts and occasional
freezes are normal at localities from where the genus
is known.
COMPARISONS OP MEXISTROPHIA WITH
CERION
The anatomy ol the Cerion remains poorly studies. Ana-
tomical information is available for the following species:
Cerion ( Strophiops ) incanum (Binney, 1857): Pilsbry,
1902: 176-178 [radula]; Pilsbry, 1946: 159-161 [repro-
ductive anatomy],
Cerion (Strophiops) glans (Kuster, 1847): Richter, 1926:
277-342 [reproductive anatomy]; Jaenicke, 1933.
Cerion ( Strophiops ) mumia chn/salis (Ferussac): Pilsbry,
1902: 176-178 [reproductive anatomy],
Cerion striatellum (Guerin-Manneville, 1829): Baker,
1961: 33-34 [lung, reproductive anatomy].
Figures 33. Distribution of Cerionidae in Mexico. 34. Dis-
tribution of Cerionidae in Middle America.
Cerion (Cerion) uva (Linnaeus, 1776): Baker, 1961:
34-35); Thompson, this report; Netherlands Antilles,
Curasao, beach at Christenffel Nation] Park (UP
336946).
CHARACTERIZATION OF THE CERIONIDAE
The available data, although limited, allow the
Cerionidae to be characterized as follows. The foot is
short and lacks a pedal groove. The ureter is confined to
the anterior end of the kidney. A secondary ureter is
absent. The plain lung has an unbranched pulmonary
artery. The reproductive anatomy has a blind diverticu-
lum on the end of the penis (Figure 26). The right ocular
retractor is a narrow slip of muscle that passes mesad to
the lower genitalia and unites with the right pedal retrac-
tor muscle. It is attached to the vagina in conjunction
with the vaginal retractor muscle. The penis retractor
muscle inserts on the apex of the diverticulum. The
epiphallus enters the penis at the base of the diverticu-
lum. The vagina is moderately long. The spermathecal
duct bears a veiy long appendix. The jaw is finely ribbed.
The radula differs from other urocoptoid families as
follow. The transverse tooth rows are nearly horizontal
and are not curved upward at the margins. The central
F. G. Thompson, 2011
Page 191
tooth is tricuspid with a large mezocone bordered on
each side by a small ectocone. The lateral teeth and the
marginal teeth are bicuspid with a large mesocone and a
smaller ectocone. The mesocone is elongate and extends
beyond the base of the tooth. Entoeones are absent.
Remarks: Mexistrophia reticulata is typical of the
Cerionidae in its anatomical states. Mexistrophia
inexpectata departs from the general morphology of
Cerion by lacking a diverticulum on the spermathecal
duct. This trait is considered a derived state, because
the presence of a diverticulum among stylomma-
tophoran families is so widespread that its presence must
be considered plesiomorphic (Nordsieck, 2007). The tax-
onomic significance of the absence of a diverticulum in
M. inexpectata remains to be determined because the
loss ol a diverticulum within families, subfamilies, and
genera occurred in several occasions.
Mexistrophia differs in shell features from Cerion by
lacking internal lamellae and denticles at all stages of
growth. Juvenile of many Cerion species have 2-5 denti-
cles within the early whorls in addition to an axial lamella
and a parietal lamella or denticle in the adult stage. A
comparison of Mexostrophia to subgeneric groups within
Cerion shows no close relationship to any subgenus.
Cerion contains various extant subgenera anti a single
fossil subgenus, Eustrophia Dali i890. The extant
subgenera are found on the Bahamas Islands, the
Greater Antilles except Jamaica, St. Croix and the Dutch
Leeward Islands. The subgenera differ by the location of
the axial lamella and the parietal lamella or denticles. All
of the subgenera except the fossil Eustrophia have a
columellar lamella and a parietal lamella or tooth that is
visible within the aperture. Eustrophia includes a single
species, Cerion ( Eustrophia ) anadonta (Dali, 1890). It is
a large, robust, poorly known fossil from the Oligoeene
Silex beds of Florida. It has been reported from several
localities in the Upper Oligocene-Lower Miocene of
Florida (Mansfield, 1937), but no information is avail-
able concerning the internal moipthology of the shell. It
was described originally as lacking an axial lamella and a
parietal tooth. However, the holotype (USNM I 11972)
has a parietal tooth (Harasewych, 2009). The absence of
an internally confined axial lamella is not confirmed
because no specimen has been dissected for examination
of this trait.
No close relationship between Mexistrophia and a
particular subgenus of Cerion is evident. A close rela-
tionship between Mexistrophia and Eustrophia is not
plausible because of their general dissimilarities. To
apply a generic name based on an imperfectly known
fossil species to a modern group is of very dubious value.
Roth and Hartman (1998) report a probable species of
Cerion from the uppermost Cretaceous Hell Creek For-
mation of Montana. Cerion acherantia Roth and
Hartman, 1998 is based on a fractured and compressed
shell that defies clear characterization. The identity of
this species as a cerionid is to some extent supported by
the discoveiy of modern Cerionidae in Mexico.
Speculation in the literature related Cerionidae to the
Clausiliidae and other families placed in the Mesuretln a
(Emberton et ah, 1990). Uit de Weerd (2008) demon-
strated that the Cerionidae belong in the Urocoptoidea,
and that they are most closely related to the Holospiridae
on the basis of 2SS rRNA sequence data. If Cerionidae
are recognized as a distinct family, the Holospiridae and
the Eucolodiidae must also be recognized as separate
families because their 28S rRNA, soft anatomies, and
basic shell structures differ from Urocoptidae as much
as or greater than do the Cerionidae.
ACKNOWLEDGMENTS
The following people assisted with field work: Gonzalo
Hallter, Ciudad de Mexico, Mexico; Elizabeth L.
Mihaleik, Bainbridge, Georgia; Val J. Roessling, San
Antonio, Texas; Grady B. Taylor, San Antonio, Texas; and
Gregg R Brewer, Fredricksburg, Texas. I thank John
Slapcinsky (FLMNH) for his assistance with many
aspects of this report. The anatomical drawings for this
paper were produced by Susan Trammel, Archer,
Florida. I am grateful to Allonso Correa-Sandoval,
Instituto Tecnologico de Ciudad Victoria, Tamaulipas,
Mexico, for his assistance with field work and many
other courtesies that have made this study possible.
Fieldwork was conducted under the auspices of collect-
ing permits issued during 1992-2004 by the Secretaria
del Medio Arnbiente y Recursos Naturales, Instituto
Nacional de Ecologia, Direction General de Vida
Silvestre to FGT collaborator Alfonso Correa-Sandoval.
This paper was improved by the helpful suggestions of
an anonymous reviewer.
LITERATURE CITED
Baker, H.B. 1961. Puerto Rican pupillids and clausilioids.
Nautilus, 75: 33—36.
Dali, W. H. 1890. Contribution to the Tertiary fauna of Florida,
with special reference to the Miocene Silex-beds of Tampa
and the Pliocene beds of the Caloosahatehie River. Part 1
Pulmonata, Opithobranchiate and Orthodont Gastropods.
Transactions of the Wagner Free Institute of Science of
Philadelphia, 3: 1-200.
Emberton, K.C., G.S. Nuncio, G. M. Davis, S.M. Phillips, K.
M. Monderewicz. and Y. H. Guo. 1990. Comparison of
recent classifications of Srylommetophoran land-snail
families, and evaluation of large ribosomal RNA
sequences for their phylogenies. Malacologia 31: 327-352.
Fahy, N.E. 1996. The disjunct distribution of Cerion. Western
Society of Malacologists Annual Report [for 1995], 28: 10-12.
Harasewych, M.G. (Ed.) 2009. Cerion v 1.02. Cerion, a web-
based resource for Cerion research and identification.
National Museum of Natural History, Smithsonian Insti-
tution. http://invertebrates.si.edu/Cerion/
Jaenicke, J.H. 1933. Untersuchungen zur Anatomie und
Verschiedenartigkeit der Cerion Arten der Bahamas als
Beitrag zum Problem der Artentstehung. Jenaisehe
Zeitsehrift fur Medizin und Naturwissenschaft 68: 277-402.
Page 192
O
THE NAUTILUS, Vol. 125, No. 4
Mansfield, W.C. 1937. Mollusks of the Tampa and Suwanee
Limestones of Florida. Florida Geological Survey, Geolog-
ical Bulletin 15, 334 pp.
Nordsieck, II. 2007. Worldwide Door Snails (Clausiliidae),
Recent and Fossil. Conehbooks, Haekenheim, 214 pp.
Pilsbry, II. A. 1902. Manual of Conehology. Bulimulidae,
Cerionidae, Ser. II, 14. Academy of Natural Sciences,
Philadelphia, Pennsylvania, 303 pp.
Pilsbry, H.A. 1946. Land Mollusca of North America. Mono-
graphs of the Academy of Natural Sciences of Phila-
delphia, 3, II (1), 520 pp.
Richter, K. 1926. Zur Anatomie von Cerion glans Kuster der
Bahamas-Inseln. Jenaisehe Zeitschrift fur Medizin und
Naturwissenschaft 62; 277-342.
Roth, B. and J.H. Hartman. 1998. A probable Cerion
(Gastropoda, Pulmonata) from the Uppermost Cretaceous
Hell Creek Formation, Garfield County, Montana.
Paleobios 18: 16-20.
Uit de Weerd, D.R. 2008. Delimitation and phylogenetics of
the diverse land-snail Family Uroeoptidae (Gastropoda,
Pulmonata) based on 28S rRNA sequence data: a reunion
with Cerion. Journal of Molluscan Studies 74: 317-329.
THE NAUTILUS 125(4): 193-206, 201 1
Page 193
New Cretaceous turbiniform vetigastropods (Gastropoda) from
tlie Pacific slope of North America
Richard L. Squires
Department of Geological Sciences
California State University
Northridge, CA 91330-8266 USA
and
Invertebrate Paleontology1
Natural History Museum of Los Angeles County
Los Angeles, CA 90007 USA
[email protected]
ABSTRACT
Seven new species of warm-temperate, shallow-marine
turbiniform vetigastropods are described from Cretaceous
strata in the region extending from Vancouver Island, British
Columbia, to northern Baja California, Mexico. The chilo-
dontine Agatliodonta haegerti new species (latest Santonian) is
the first confirmed species of this extant genus in the Western
Hemisphere. The ealliotropine Cidarina grahami new species
(middle Campanian) is the earliest record of this extant genus.
The colloniines Afrollonia elderensis new species (late Albian)
and Antillocollonia bos new species (Turanian) are the earliest
records of these extinct genera in Western Hemisphere. The
teguline Tegula daileiji new species (late Campanian) is one ol
the few known Campanian species of this extant genus. The
margaritines Pupillaria encina new species and Pupillaria
lomana new species (both of which are late Campanian to
possibly early Maastrichtian in age) are the earliest records of
this extant genus.
During the course of this study, it was discovered that the
nododelphinulid Trochacanthns wallalense (White, 1885) (late
Campanian to early late Maastrichtian) is the senior synonym
of T. pacificus Squires and Saul, 2001. White’s species is the
only known occurrence of this extinct genus in the Western
Hemisphere.
Additional keywords: Amberleyoidea, Seguenzioidea,
Turbinoidea
INTRODUCTION
This study concerns turbiniform vetigastropods from
shallow-marine Cretaceous rocks in the region extending
from Vancouver Island, British Columbia, Canada, to
northern Baja California, Mexico (Figure 1). These gas-
tropods comprise eight genera and eight species; seven
of the species are new. Nearly all of the species are very
1 Research Associate
rare. The significance of this study is that the species
represent either the earliest record of their genus or the
first record of their genus in the Western Hemisphere.
In addition to the description of the new species, their
biostratigraphy is established. During the course of this
study, it was discovered also that Trochacanthns
wallalense (White, 1885), is the senior synonym of
Trochacanthus pacificus Squires and Saul, 2001. The
first photographs of White’s holotype are provided here,
as well as the morphologic redescription and geologic
age refinement of his species.
The designated areas (e.g., Area 3) where the species
were collected are shown on Figure 1. The details of the
type localities are given in Appendix 1. As discussed by
Saul and Squires (2008) and Squires and Saul (2009),
localities west of the San Andreas Fault have been tec-
tonically transported, and localities in British Columbia
most likely have been tectonically transported from
northern California. The temporal ranges of all the stud-
ied species are plotted on Figure 2. Their combined
Cretaceous record in the study area spans the middle
Albian to late Maastrichtian, an interval of approximately
38 million years. The paleoelimate that prevailed in the
study area when the new species lived was generally
warm temperate (Saul and Squires, 2008; Squires and
Saul, 2009).
MATERIALS AND METHODS
This study is based on 65 specimens borrowed from
museum collections. Preservation of the shell material is
generally good, but nearly all the nacre has been
replaced by caleite. Knowledge about the umbilical area
is critical in distinguishing turbiniform-vetigastropod
taxa. Some of the specimens already were already
cleaned by L. R. Saul and the late W. P. Popenoe. A few
additional specimens were cleaned by the author and
L. R. Saul. The cleaning was done mainly by means of a
Page 194
O
THE NAUTILUS, Vol. 125, No. 4
Figure 1. Localities map and latitudinal distribution of the
studied trochiform vetigastropods.
high-speed drill with diamond-coated grinding wheels,
but, it was also necessary to use hand-held, very sharp
needles to clean the umbilical area on some of the
smaller specimens.
The sequence of the treatment of the studied taxa in
the “Systematic Paleontology” section mainly follows the
classification scheme of Waren and Bouehet in Bouchet
and Rocroi (2005: 243-245), modified to include the
results from Williams et al. (2008). Most of the morpho-
logic terms follow the usage of Cox (1960). The term
“periumbilical cord” (i.e., a spiral cord extending from
the parietal region downward to the eolumellar lip) fol-
lows the usage of Monari et al. (1996).
Current summaries of the geological details of the
formations and members containing the studied spec-
imens can be found in the following papers (listed in
ascending ehronostratigraphic order): Venado Sand-
stone (Squires and Saul, 2004a); Redding Formation,
Bellavista Sandstone and Frazier Siltstone members
(Squires and Saul, 2003a); Panoche Formation in Arroyo
Pinoso, Reef Ridge area (Stewart, 1946); upper Haslam
Formation (Squires and Saul, 2001); upper Cedar Dis-
trict Formation, west side of Denman Island (Squires
and Saul, 2006); jalama Formation (Squires and Saul,
2003b); Rosario Formation (Squires and Saul, 2001);
Figure 2. Geologic ranges of the studied species. Ages of
stage boundaries from Gradstein et al. (2004).
Point Loma Formation (Squires and Saul, 2001);
Cabrillo Formation (Squires and Saul, 2009); Gualala
Formation (Squires and Saul, 2004b); and Moreno For-
mation, “Garzas Sand" and “Quinto Silt” members
(Squires and Saul, 2003b).
Abbreviations used for catalog and locality numbers
are: LACM, Natural Histoiy Museum of Los Angeles
County, Invertebrate Paleontology Section (LACMIP);
RBCM, Royal British Columbia Museum, Victoria;
SDSNH, San Diego Society of Natural History; UCMP,
University of California Museum of Paleontology
(Berkeley); and USNM, National Museum of Natural
History, Smithsonian Institution.
SYSTEMATIC PALEONTOLOGY
Clade Vetigastropoda Salvini-Plawen, 1980
Superfamily Amberleyoidea Wenz, 1 938
Family Nododelphinulidae Cox, I960
Genus Trochacanthus Dacque, 1936
Type Species: Trochus turberculatocintus Minister
in Goldfuss, 1844, by subsequent designation (Wenz,
1938); Late Cretaceous, Europe (Poland and Germany).
Description: Shell size small to medium. Turbinate.
Phaneromphalous. Spire whorls with strong collabral
l ibs. Last whorl (on adults) deviantly coiled relative to
spire whorls. Last whorl with single keel coincident with
periphery. Umbilicus bearing thin radiating ribs sepa-
rated by sunken areas.
Discussion: Except for Trochacanthus wallalense
(White, 1885), discussed below, the only other occurrences
R.L. Squires, 2011
Page 195
Figures 3-6. Trochacanthus wallalcnse (White, 1885), holo-
type USNM 13412, from near Gualala, California, height 16.7
mm, diameter 21.5 mm. 3. Apertural view. 4. Abapertural view.
5. Umbilical view. 6. Apical view.
of this genus are from Santonian to Maastrichtian rocks
of western Germany and lower Campanian to upper
Maastrichtian rocks of central Poland (Dacque, 1936;
Kollmann, 1985; Abel-Gawad, 1986).
Trochacanthus waUalense (White, 1885)
(Figures 3-6)
Solarium waUalense White, 1885: 14, pi. 5, figs. 1, 2.
Trochacanthus pacificus Squires and Saul, 2001: 49, 51,
fig. 3.6-3.11.
Holotype: USNM 13412, height 16.7 mm, diameter
21 .5 mm.
Type Locality: Near the town of Gualala [= Wallala ol
White (1885)], Mendocino County, northern California.
Geologic Age: Late Campanian to early late
Maastrichtian.
Distribution: Gualala Formation, Mendocino County,
northern California (Area 5); Moreno Formation, infor-
mal Quinto member, Los Banos area, Stanislaus Coutny,
northern California (Area 6); Point Loma Formation,
Carlsbad, San Diego County, southern California (Area
9); Rosario Formation, Punta Santo Tomas [= Puerto
Santo Tomas], Baja California, Mexico (Area 11).
Discussion: The holotype of this species, which is a
weathered specimen whose sculpture on the spire is not
well preserved, is photographed here for the first time,
with more views than White (1885) provided in his
sketches. Prior to this present report, this species was
known only from its type locality in the Gualala Forma-
tion in Mendocino County and [as T. pacificus ] from the
Point Loma Sandstone in San Diego County. Additional
single specimens were detected during this present
investigation in collections from the Moreno Formation
(UCMP loc. A-3224) in Merced County, California and
from the Rosario Formation (UCMP loc. A-6274) at
Punta Santo Tomas, Baja California, Mexico.
Superfamily Seguenzioidea Verrill, 1884
Family Chilodontidae Wenz, 1938
Subfamily Chilodontinae Wenz, 1938
Genus A gathodonta Cossmann, 1918
Type Species: Agathodonta elegans (Deshayes in
Leymerie, 1842 [= Trochus dentigerus d’Orbigny, 1842:
185, pi. 177, figs. 9-12]), by subsequent designation
(Kollmann, 2005: 70-71); Early Cretaceous ( Haute rivian),
France.
Description: Shell size small to medium (height 10 to
34 mm). High fusiform. Suture deeply indented. Whorls
deviantly coiled. Spiral cords strong and beaded to gran-
ulose. Outer lip variced and strongly prosocline; interior
of lip thickened by apertural ridge with lira. Parietal
callus well developed. Columella with two widely sepa-
rated teeth, posterior tooth strongest and located poste-
riorly up into aperture. Pustules can be present anterior
to anterior tooth on columella shield (at anterior end of
columella). Operculum chitinous. Interior nacreous.
Discussion: Prior to work by Kollmann (2005: 70-71),
earlier workers cited the type species ol Agathodonta as
being Trochus dentigerus d’Orbigny, 1842, from France.
Cossmann (1918: 200-201, pi. 7, figs. 8-11) discussed
and figured this species, which lie identified as
Chilodonta (Agathodonta) dentigera. Wenz (1938: 298,
fig. 653) illustrated the holotype, which he identified as
Agnatlwdonta [sic] dentigera. Cox (I960: 249, fig. 160, 2)
also figured the holotype, and like Wenz, considered
Agathodonta to be a distinct genus within the
chilodontines. Cossmann (1918) and Wenz (1938)
reported the range ol Agathodonta to be Neocomian to
Albian, but McLean (1984) established that this
ehilodontine genus ranges into the Recent, where it is
represented by a single species (see also Hickman and
McLean, 1990: fig. 40E) from archibenthal (300 m)
depths in the Philippines.
Based on its overall shape and sculpture, the new
genus is veiy similar to the ehilodontine Danilia Brusina,
1865, whose type species is the extant Monodonta tinei
Calcara, 1839, from the Mediterranean Sea. Wenz (1938:
273, fig. 572) illustrated the holotype. Beu and Climo
(1974) reported that Danilia ranges from Albian to
Recent, with the fossil species mainly of Cenomanian
age in Europe. They reviewed the taxonomy of Danilia ,
compared its fossil and Recent species, and illustrated
two modern species of this genus from New Zealand.
Agathodonta differs from Danilia by having two colu-
mellar teeth instead of just one, teeth not showing a
notched appearance, and (on some species) no pustules
on columellar shield. Agathodonta superficially resem-
bles the calliotropine Cidarina Dali, 1909 in terms of
shape and sculpture, but the latter is smaller and does
not have any columellar teetli or a flared outer lip.
Page 196
THE NAUTILUS, Vol. 125, No. 4
Figures 7-17. New ehilodontine and new calliotropine. Specimens coated with ammonium chloride. 7-12. Agathodonta haegerti
new species, holotype RBCM.EH2008. 01 1.06500, Nanaimo area, British Columbia, height 33 mm, diameter 23 mm. 7. Apertural
view. 8. Oblique apertural view. 9. Abapertural view. 10. Right-lateral view. 11. Left-lateral view. 12. Apical view. 13-17. Cidarina
grahami new species, holotype RBCM.EH2010. 004. 00001, west shore of Denman Island, British Columbia, height 18 mm, diameter
13.5 mm. 13. Apertural view. 14. Abapertural view. 15. Right-lateral view. 16. Apical view. 17. Anterior (ventral) view.
Based on reports by earlier workers (Cossmann, 1918:
200; Wenz, 1938: 298; Keen, I960: 1249; McLean, 1984;
and Kollrnann, 2005: 70-71), the geologic range of
Agathodonta is Early Cretaceous (Hauterivian to Albian)
to Recent, with its fossil occurrences restricted to
Europe. Agathodonta haegerti new species, discussed
below, is ol latest Santonian age in British Columbia and
is the first confirmed species ol this genus in the Western
Hemisphere.
Agathodonta haegerti new species
(Figures 7-12)
Description: Shell size medium small (height 34 m,
diameter 22 mm, same specimen). Height approximately
1.5 times greater than shell diameter. Ovate conical.
Anomphalons. Spire elevated, height approximately
20% (estimated) of shell height. Pleural angle approxi-
mately 75°. Protoconch and uppermost spire unknown.
Teleoconch at least four whorls. Suture deeply
impressed, almost caniculate. Coiling deviant. Whorls
inflated, rounded. Shoulder very narrow. Sculpture of
strong widely spaced spiral ribs: four ribs on antepenul-
timate whorl, six on penultimate whorl, and 14 on last
whorl. Interspaces between spiral ribs usually uniformly
twice as wide as ribs, except near shoulder where inter-
spaces are three times as wide as ribs. Spiral ribs on
antepenultimate whorl uniformly beaded; posteriormost
two spiral ribs noded on penultimate and last whorl,
R. L. Squires, 2011
Page 197
other spiral ribs beaded. Aperture large, elliptical. Outer
lip with varix; interior ol outer lip flared and smoothish.
Inner lip with two widely separated teeth, posterior tooth
strongest and located posteriorly up into aperture. Colu-
mellar shield present in parietal area and smooth, wid-
ening posteriorward. Growth lines prosocline. Interior
nacreous.
Holotype: RBCM.EH2008.011.06500, height 33 mm,
diameter 23 mm.
Type Locality: Locality 1 (see Appendix I).
Geologic Age: Latest Santonian.
Distribution: Haslam Formation, upper part, just
west of Nanaimo, east coast of Vancouver Island, British
Columbia (Area 2).
Etymology: The species is named for foe Haegert
who collected the holotype.
Discussion: The new species is based on a single spec-
imen. It is well preserved and is most similar to the
extant Agathodonta nortoni McLean (1984: 122-123,
figs. 1-3; Hickman and McLean, 1990: fig. 40, E) from
the Philippines. The new species differs by having much
larger size, deviantly coiled whorls, stronger spiral ribs
on shoulder of last whorl, more widely spaced spiral ribs,
absence of having its nodes aligned in distinct collabral
rows, outer lip lirae weaker and corresponding to spiral
ribs rather than to their interspaces, columellar teeth
much farther apart, anterior tooth weaker, and absence
of pustules on the columellar shield.
The new species is similar to the extant Danilia
insperata Beu and Climo (1974: 316, figs. 10-13) from
New Zealand. The new species differs by two columellar
teeth rather than one, parietal callus, no denticles on the
outer lip, and no pustules on the columellar shield. The
new species has the same shape as Agathodonta? hrooksi
Allison (1955: 411, pi. 40, fig. 6) from upper Aptian strata
in Baja California, Mexico. Allison was hesitant about the
generic assignment of this species because ol the pres-
ence of a narrow umbilicus. The new species differs from
Allison’s species by having much coarser sculpture that
weakens rather than strengthens toward the anterior, two
rather than a single columellar fold, and no umbilicus.
Future collecting might show that Allison’s species
belongs in genus Danilia.
Subfamily Calliotropinae Hickman and McLean, 1990
Discussion: Kiel and Bandel (2001: 140) stated that
they did not find Hickman and McLean’s definition of
Calliotropinae to be “useful. " Instead, they placed
Cidarina Dali, 1909 in Chilodontinae Wenz, 1938
because Cidarina has a thick shell, whereas
Calliotropinae is characterized by thin shells.
Genus Cidarina Dali, 1909
Type Species: Margarita cidaris A. Adams in Carpe ri-
te r. 1864, by original designation; Pleistocene to Recent,
living in Alaska to northern Baja California, Mexico
(Squires and Saul, 2003b).
Description: Shell size small to medium, thin. Ovate
conical. Anomphalous. Spire elevated. Sculpture of
coarse nodes or beads formed at intersections of spiral
and collabral sculpture, sculpture weakest anterior to last
whorl periphery, aperture nearly circular and oblique.
Umbilicus covered by thin columellar callus. Interior
nacreous (Squires and Saul, 2003b).
Discussion: In their list of calliotropines having a fos-
sil record, Hickman and McLean (1990: 79-80) did not
include the extant genus Cidarina. Squires and Goedert
(1995) and Squires and Saul (2003) subsequently
established that Cidarina does have a fossil record.
Cidarina grahami new species is the earliest Cidarina.
Onlv four fossil species of Cidarina were previously
known: Cidarina cretacea Squires and Saul (2003b) of
upper Campanian to mid Maastrichtian age from the
southern half of California; Cidarina beta Squires and
Saul (2003b), of mid- Maastrichtian age from central Cal-
ifornia; Cidarina antiqua Squires and Goedert (1995) of
middle Eocene age (“Tejon Stage”) from southwestern
Washington; and Cidarina cidaris (A. Adams in Carpen-
ter, 1864) of early Pleistocene to Recent age on the
Pacific slope of North America from Alaska to northern
Baja California (Grant and Gale, 1931).
Cidarina grahami new species
(Figures 13-17)
Diagnosis: Cidarina with medium shell size, spiral
ribs nodose posterior to periphery, spiral ribs on base
closely spaced, base of last whorl bearing weak spiral ribs
with numerous, closely spaced minute nodes.
Description: Shell size medium (height 18 mm, diam-
eter 13 mm, same specimen). Height approximately 1.4
times shell diameter. Ovate conical. Spire elevated,
approximately 35% of shell height. Pleural angle 64°.
Protoconch and upper spire unknown. Teleoconch
incomplete, at least three whorls. Suture apparently
impressed. Spire whorls flat-sided, body whorl convex,
rounded but with peripheral angulation. Shell surface
covered by spiral ribs: four on ante-penultimate whorl,
five on pentultimate whorl, six on posterior half (includ-
ing peripheral angulation) of last whorl, and ten on base
of body whorl. Spiral ribs bearing fine beads on upper
spire whorls and on base of last whorl; spiral ribs bearing
medium-strength beads on penultimate whorl; spiral ribs
bearing strong nodes on posterior half of last whorl and
on first rib anterior to periphery, with strongest nodes on
peripheral angulation. Aperture moderately elliptical.
Outer lip thin. Inner lip and columella with grooved
callus closing off umbilicus. Callus wash extends over
parietal area. Growth lines prosocline, tilted 1 6 from
vertical.
Page 198
O
THE NAUTILUS, Vol. 125, No. 4
Holotype: RBCM.EH2010.004.00001, height 18 mm,
diameter 13.5 mm.
Type Locality: Locality 2 (see Appendix 1).
Geologic Age: Late middle to early late Campanian
( Metaplacenticeras cl. pacificum ammonite zone).
Distribution: Cedar District Formation, upper part,
west side ol Denman Island off east coast ol Vancouver
Island, British Columbia (Area 1).
Etymology: The species is named for Raymond Gra-
ham, who informed the author about the existence ol this
species.
Discussion: The new species is based on a single spec-
imen, which has good preservation. The new species is
most similar to Cidarina cretacea Squires and Saul
(2003b: 52, fig. 2. 1-2.4) from Maastrichtrian strata of
central California and (new information) trom the upper
Campanian to possibly lower Maastrichtian Point Loma
Formation at the Carlsbad Research Center, San Diego
County, southern California. The new species differs
from C. cretacea by having more closely spaced spiral
libs with slightly coarser ornament posterior to the
periphery on the last whorl, and fewer spiral ribs but
with coarser ornament on the base of the last whorl.
Superfamily Turbinoidea Rafinesque, 1815
Family Turbinidae Rafinesque, 1815
Subfamily Colloniinae Cossmanu in Cossmann and
Peyrot, 1916
Discussion: McLean and Kiel (2007) provided a
review ol the systematic treatment of turbinoids and
colloniines, including some reservations about recent
molecular data (e.g., Williams and Ozawa, 2006)
concerning these groups. Stemming from Cossmanns
early work, it has been recognized (e.g., Hickman and
McLean, 1990; McLean and Kiel, 2007) that opercular
information is important in dealing with colloniines.
Monari et al. (1996) pointed out, however, that in fossil
material, information about the operculum is unavailable
except in extremely exceptional cases, hence, it is nearly
impossible to base a useable paleontological classifica-
tion on opercula. They argued that other morphological
shell characters can be used to distinguish members of
colloniines, which constitute a rather homogeneous
group in having a thick shell that is smooth or weakly
ornamented with spiral threads.
Genus Afrollonia Adegoke, 1977
Type Species: Afrollonia nigerensis Adegoke, 1977, by
original designation; Paleocene, southwestern Nigeria.
Description: Shell size small. Turbiniform. Phane-
romphalous. Spire low to moderately high. Ramp broad.
Protoconch small, smooth, and bulbous. Teleoconeh
sculpture consisting ol few line spiral ribs. Anterior end
ol columellar lip slightly expanded and subangulate
where intersected by carination of umbilical margin;
umbilical rim usually prominent and crenulated, interior
of umbilicus with periumbilical cord ending in a wide
process on columella (Adegoke, 1977; Kase, 1984).
Discussion: Afrollonia is similar to genus Collonia
J. E. Gray in M. E. Gray, 1850, but differs from the
latter by having sculpture. Although Adegoke (1977)
assigned Afrollonia to subfamily Colloniinae, Kase
(1984) assigned this genus to subfamily Margaritinae
Stoliczka, 1868 based on the similarity of Afrollonia to
Atira Stewart, 1927, which was originally proposed as a
subgenus of Margarites }. E. Gray, 1847 (ex Leach ms.).
This similarity is superficial because Afrollonia is charac-
terized by a periumbilical cord; no such feature is
present on Atira.
Afrollonia has been reported only from Paleocene
strata in Egypt, Nigeria, and Togo, Africa (Adegoke
1977). Afrollonia elderensis new species, described
below, is the earliest confirmed record of this genus and
its only record in the Western Hemisphere.
Afrollonia elderensis new species
(Figures 18-23)
Diagnosis: Afrollonia with rounded whorls, suture
collared, spiral ribs moderately widely spaced, umbilicus
rim weakly demarcated.
Description: Shell size small (up to height 6 mm,
diameter 6.5 mm, same specimen). Height slightly less
than shell diameter. Turbiniform. Phaneromphalous.
Spire moderately low, height approximately 28% of shell
height. Pleural angle approximately 105°. Protoconch
unknown. Teleoconeh consisting of approximately four
whorls. Suture impressed and rimed by thin, high collar
on succeeding whorl. Whorls rounded. Ramp on last
whorl concave. Sculpture on spire whorls consisting of
approximately three to four, narrow but widely spaced
spiral threads with smooth, concave interspaces. Sculp-
ture on last whorl consisting of several thin, prominent,
and widely spaced spiral ribs; approximately five spiral
ribs between suture and base on last whorl. Interspace
between collar and posteriormost spiral rib widest and
most concave. Base not clearly demarcated from sides ol
last whorl. Sculpture on base consisting of seven spiral
ribs, most being weaker than those on periphery but
becoming anteriorly stronger. Aperture circular. Outer
and inner lips flared. Peristome continuous. Umbilicus
semi-lunar. Rim of umbilicus subtle and demarcated
near inner lip by short but strong and noded spiral rib
increasing in strength toward anterior end of aperture.
Periumbilical cord smooth, extending short distance into
umbilicus on its left side. Columellar lip reflected toward
umbilicus adjacent to terminus of periumbilical cord.
Anterior end of columellar lip slightly expanded and
subangulate where intersected by carination ol umbilical
margin. Growth lines prosocline.
Holotype: LACMIP 13701, height 6 mm, diameter
6.7 mm.
R.L. Squires, 2011
Page 199
Figures 18-30. New colloniines. Specimens coated with ammonium chloride. 18-23. Afrollonia elderensis new species, holotype
L ACM IP 13701, LAC M IP loc. 28777, height 6 mm, diameter 6.7 mm. 18. Apertural view. 19. Abapertural view. 20. Right-lateral
view. 21. Apical view. 22. Umbilical view. 23. Oblique umbilical view. 24-30. Antillocollonia bos new species 24, 25, 26, 27.
Holotype LACMIP 13702, LACMIP loc. 10742, height 6.5 mm, diameter 6,5 mm. 24. Apertural view. 25. Abapertural view.
26. Right-lateral view. 27. Apical view. 28. Faratype LACMIP 13703, Stewart’s (1946) Arroyo Pinoso, loc. 97, umbilical view,
diameter 7 mm. 29. Paratype LACMIP 13704, LACMIP loc. 10763, umbilical view, diameter 5 mm. 30. Paratype LACMIP 13705,
LACMIP loc. 10742, oblique umbilical view, diameter 5.8 mm.
Page 200
THE NAUTILUS, Vol. 125, No. 4
Type Locality: LACMIP 28777.
Geologic Age: Late Albian.
Distribution: Reworked Albian material in the
Turonian Venado Sandstone, Elder Creek, Tehama
County, northern California (Area 4).
Etymology: Named for its occurrence in Elder Creek
area, Tehama County, northern California.
Discussion: The new species is based on a single spec-
imen, which has good preservation. The exact location of
the type locality of the new species is not known. It is a
boulder from a conglomerate of early Turonian age, but,
according to the LACMIP locality information, die fauna
in the boulder is of late Albian age. Reworked late Albian
fossils in this same stratigraphic unit are known else-
where in the Cretaceous section of northern Sacramento
Valley, northern California (Matsumoto, 1960: 34-35;
Popenoe et ah, 1960: chart 10e; Squires and Saul, 2006).
The new species is most similar to Afrollonia
nigeriensis Adegolce (1977: 68-69, pi. II, figs. 10-15)
from Paleoeene rocks in southwest Nigeria but differs
from Adegokes’ species by having a flatter ramp, last
whorl not ornamented by three prominent spiral ribs
with much finer spirals in between, base not angulate,
and umbilical rim not well demarcated.
Kase (1984) reported Afrollonia matsushimensis Kase
(1984: 60-61, pi. 6, figs. 5, 8-10) from upper Aptian to
lower Albian strata in northeastern Japan. Ease’s species,
however, does not have a periumbilical ridge nor a thick-
ening of the columella where this ridge intersects the
columella; hence, his species does not belong in this
genus.
Genus A ntillocollonia SoM, 1998
Type Species: Antillocollonia brujoensis Sold, 1998,
by original designation; late Campanian to
Maastrichtian, Puerto Rico.
Description: Small size small (less than 10 mm high)
but sturdy. Turbinate. Phaneromphalous. Teleoconch
whorls smooth. Aperture circular. Peristome continuous.
Periumbilical cord prominent and smooth. Columellar
lip thickest where intersected by periumbilical cord.
Anterior end of columellar lip slightly expanded and
subangulate where intersected by carination of umbilical
margin. Exterior of operculum pustulose, ridge, and with
prominent central pit (Sold, 1998). Rim of umbilicus
with or without crenulations.
Discussion: Antillocollonia is similar to Collonia
M. E. Gray, 1850 but differs from the latter by having
an auricular (earlike) projection high on the columella
and lacking beads on the umbilical rim.
Antillocollina has been reported before only from
upper Campanian to Maastrichtian strata in Puerto Rico
(Sold, 1998). Antillocollina bos new species, described
below, is the earliest record of this genus and is also its
first record from the Pacific slope of North America.
Antillocollonia bos new species
(Figures 24-30)
Diagnosis: Antillocollonia with umbilicus rim usually
coincident with coarsely noded spiral cord, anteriornrost
two nodes strongest.
Description: Shell size very small (up to height 6.5 mm,
diameter 7 mm, same specimen). Height approximately
same as shell diameter. Turbinate. Phaneromphalous.
Spire moderately high, height approximately 20% of shell
height. Pleural angle 89°. Protoconch unknown. Teleconch
consisting of six whorls. Suture impressed. Whorls convex.
Shoulder very narrow. Shell surface smooth; base of last
whorl can have five to six, very faint, flat, and widely spaced
spiral bands with incised striae between them. Aperture
circular. Outer lip thin, inner lip thicker. Peristome contin-
uous. Umbilicus narrow. Rim of umbilicus angulate and
usually demarcated by coarsely noded spiral rib, nodes
commonly increasing in strength toward anterior end of
aperture; anteriormost node strongest; nodes on posterior
part of rim generally less well developed on adult spec-
imens; spiral rib terminates at columellar lip. Periumbilical
cord prominent, smooth. Columellar lip thickest where
intersected by periumbilical cord. Anterior end of col-
umellar lip slightly expanded and subangulate where
intersected by carination of umbilical margin. Growth lines
prosoeline.
Holotype: LACMIP 13702, height 6.5 mm, diameter
6.5 mm.
Paratypes: LACMIP 13703-13705.
Type Locality: LACMIP 10742.
Geologic Age: Turonian.
Distribution: LOWER TURONIAN: Redding For-
mation, Bellavista Sandstone Member, east of Redding,
Shasta County, northern California (Area 3). MIDDLE
TURONIAN: Redding Formation, Frazier Siltstone
Member, east of Redding, Shasta County, northern
California (Area 3). TURONIAN (UNDIFFERENTI-
ATED): Panoche Formation, Arroyo Pinoso, Reef Ridge
area, Fresno County, central California (Area 7).
Etymology: Named for its occurrence in Cow Creek
area east of Redding, Shasta County, northern Califor-
nia; bos, Latin, meaning cow.
Discussion: The examined material consisted of 52
specimens. Preservation is good although the fragile
periumbilical cord is usually missing or incomplete.
Some specimens do not have nodes on the rim of the
umbilicus.
The new species is remarkably similar to Antillo-
collonia brujoensis Sold (1998: 47—48, pi. 3, figs. 17—22)
R.L. Squires, 2011
Page 201
from upper Campanian to Maastrichtian strata in Puerto
Rico. The main difference is that the new species com-
monly has a coarsely noded spiral rib on the rim ot the
umbilicus.
The new species superficially resembles the trochid
Garromites nitidus Stephenson (1941: 262, pi. 47, figs.
17-19) from the Naeatoch Sand, eastern Texas. Stephen-
son (1941) assigned this sand to the Maastrichtian, but
Akers and Akers (1997: fig. 2) assigned it to the upper
Campanian. Genus Garramites Stephenson, 1941, which
is monotypic, is characterized by a nearly smooth small
shell having a wide umbilicus with an angulated, rather
coarsely crenulated rim. Within the umbilicus is a broad,
shallow, spiral sulcus that closely rims the row of pro-
minent crenulations. Anticollonia bos differs from
G. nitidus by having a periumbilical cord and commonly
having a beaded ridge that rims the umbilicus. In addi-
tion, A. bos does not possess a spiral sulcus that closely
rims this beaded ridge.
The occurrence of the new species in the Panoche
Formation in Arroyo Pinoso of the Reef Ridge area,
Fersno County, central California is based on the
author’s observation of specimens from Stewarts (1946:
88) locality 97. Stewart noted that W. P. Popenoe identi-
fied the fauna from this locality as Turanian in age, and
Popenoe et al. (1960: 1521) reiterated this interpretation.
Family Turbinidae? Rafinesque, 1815
Subfamily Tegulinae Kuroda, Ilabe, and Oyama, 1971
Discussion: This subfamily was previously generally
believed to be a trochid subfamily (e.g., Hickman and
McLean, 1990), but, based on molecular studies of
extant taxa by Williams et al. (2008), it has been provi-
sionally assigned to the Turbinidae.
Genus Tegula Lesson, 1 835 sensti Into
Type Species: Tegula pellisserpertis (Wood, 1828), by
original designation; Recent, west coast of Central Amer-
ica to Gorgona Island, Colombia, South America (Keen,
1971).
Description: Shell size medium, solid. Globose to
conic. Phaneromphalous. Shells smooth to sculptured,
with sculpture consisting of broad, coarsely beaded spi-
ral ribs. Base flattened. Peristome discontinuous. Ante-
rior end of columella with one or more teeth. Umbilicus
ranging from open to closed. Interior nacreous.
Discussion: Based on reports by earlier workers
(Wenz, 1938; Keen, 1960), the geologic range of Tegula
is Miocene to Recent. Subsequently, other workers
(Bandel and Stinnesbeck, 2000; Kiel and Bandel, 2001;
Squires and Saul, 2005) demonstrated that Tegula has a
Cretaceous record, and the earliest known species is
Tegula jeanae Squires and Saul, 2005 of early Campanian
age in northern California.
Tegula daileyi new species
(Figures 31-33)
Diagnosis: Tegula with three to four widely spaced,
narrow spiral ribs on penultimate and last whorls.
Description: Shell size medium (height 19 mm, diam-
eter 19 mm, same specimen). Height approximately
same as shell diameter. Turbinate. Phaneromphalous.
Spire unknown. Suture impressed. Penultimate and last
whorls convex with three to four narrow, prominent spi-
ral ribs; widely and subequally spaced, with two
anteriormost ribs slightly closer to each other. Base flat-
tened, apparently smooth. Aperture circular. Peristome
interrupted. Outer lip moderately thin. Inner lip with
single prominent tooth. Umbilicus small. Growth lines
prosoeline, tilted 43° from vertical.
Holotype: LACMIP 13706, height 20.4 mm, diameter
20.7 mm.
Type Locality: LACMIP 24123.
Geologic Age: Late Campanian.
Distribution: jalama Formation, Santa Barbara
County, California (Area 8).
Etymology: The species is named for D.H. Dailey
who worked on the molluscan fauna from the Jalama
Formation.
Discussion: The new species is based on a single spec-
imen, which is crushed and missing its spire. It is most
similar to the extant Tegula mariana (Dali, 1919: 359;
Keen, 1971: fig. 105), known mainly from the Gull oi
California, Mexico, but differs from Dalis species by
having a larger size, higher spire, and a more prominent
columellar tooth.
The new species differs from Tegula jeanae Squires
and Saul (2005: 135-136, figs. 3-5), of early Campanian
age from northern California, by having sculpture, an
open umbilicus, more prominent columella tooth, no
secondary denticles in the columella, and no raised lip
along the basal edge of the interior of the last whorl.
Bandel and Stinnesbeck (2000) reported Tegula ovallei
(Philippi, 1887) from Maastrichtian strata in central
Chile. The new species differs by not having numerous,
closely spaced and beaded spiral ribs. Kiel and Bandel
(2001) reported Tegula? simplex (Quintero and Revilla,
1966) from the Campanian (undifferentiated) strata of
northern Spain. The new species differs by having a
much larger shell, an umbilicus, and an absence of nu-
merous, closely spaced spiral ribs.
Subfamily Margaritinae Stoliczka, 1868
Discussion: This subfamily was previously generally
believed to be a trochid subfamily (e.g., Hickman and
McLean, 1990; Waren and Bouchet in Bouchet and
Rocroi, 2005), but, based on molecular studies of extant
taxa by Williams et al. (2008), it has been provisionally
assigned to the Turbinidae. According to Wiliams et al.
(2009), Margaritinae is not monophyletic.
Page 202
THE NAUTILUS, Vol. 125, No. 4
... i
Figures 31-44. New teguline and new margaritines. Specimens coated with ammonium chloride. 31-33. Teguline Tegula claileiji
new species, holotype LACMIP 13706, LACMIP loc. 24123, height 20.4 mm, diameter 20.7 mm. 31. Apertural view. 32. Right-
lateral view. 33. Umbilical view. 34-37. PupiUaria encina new species, holotype SDSNH 11082, SDSNH loc. 152, height 11.7 mm,
diameter 8.6 mm. 34. Apertural view. 35. Abapertural view. 36. Apical view. 37. Umbilical view. 38-44. PupiUaria lomana new
species, holotype LACMIP 13707, LACMIP loc. 5571, height 12.2 mm, diameter 9.6 mm. 38. Apertural Mew. 39. Abapertural view.
40. Right-lateral view. 41. Apical view. 42. Umbilical view. 43-44. Paratype LACMIP 13708, LACMIP loc. 5571, juvenile, height
6.8 mm, diameter 7 mm. 43. Abapertural view. 44. Left-lateral view.
Genus PupiUaria Dali, 1909
Type Species: Trochus pupillus Gould, 1849, by
original designation; Recent, Bering Sea to southern
California.
Description: Shell size small to moderately small,
thin. Turbiniform to ovate-conical. Phaneromphalous.
Spiral ribs raised but flattened with narrow interspaces.
Peristome discontinuous. Columella smooth. Outer lip
unthickened. Umbilicus slit-like to nearly closed. Inte-
rior nacreous.
Discussion: Workers (e.g., Wenz, 1938; Palmer, 1958;
Keen, 1960) traditionally used PupiUaria as a subgenus
ol Margarites. The narrowness of the umbilicus of
PupiUaria , however, warrants that PupiUaria have
generic standing. According to Wenz (1938) and Keen
(1960), the geologic range of PupiUaria is Miocene to
Recent. The new species PupiUaria encina and
PupiUaria lomana, described below, extend the earliest
record of PupiUaria to the late Campanian.
PupiUaria encina new species
(Figures 34-37)
Calliomphalus? sp. Sundberg and lliney, 1984: table 1.
Diagnosis: PupiUaria with ovate-conic shape and
broad and prominent spiral ribs.
Description: Shell size small (up to height 11.7 mm,
diameter 8.6 mm, same specimen). Height approxi-
mately 1.3 times shell diameter. Ovate conical.
Phaneromphalous. Spire high, approximately two-thirds
of shell height. Pleural angle 52°. Protoconch unknown.
R. L. Squires, 2011
Page 203
Teleoeonch approximately six whorls. Suture impressed.
Shoulder rounded. Sculpture consisting ol many broad
spiral ribs; five on upper spire whorls, seven on penulti-
mate whorl, approximately 13 on last whorl and becom-
ing narrower anteriorward of periphery. Interspaces veiy
narrow and incised. Aperture circular. Peristome discon-
tinuous? Umbilicus slit-like and extremely narrow.
Growth lines prosocline, tilted 20° from vertical.
Holotype: SDSNH 11082, height 11.7 mm, diameter
8.6 mm.
Type Locality: SDSNH 152.
Geologic Age: Late Campanian to possibly early
Maastrichtian.
Distribution: Point Loma Formation, Canon de Las
Encinas, near Carlsbad, San Diego area, San Diego
County, southern California (Area 9).
Etymology: The new species is named (noun in appo-
sition) for its occurrence at Canon de Las Encinas; Span-
ish, encina, meaning “oak.”
Discussion: The new species is based on a single
specimen, which is the non-figured specimen of
Calliomphalus? sp. reported by Sundberg and Riney
(1984) from the Carlsbad Research Center, San Diego
County. This species differs from Pupillaria lomana new
species by having wider and more prominent spiral ribs
and no interrib between the spiral ribs on the posterior
part of the last whorl.
Pupillaria lomana new species
(Figures 38-44)
Diagnosis: Pupillaria with spiral ribs narrow and sin-
gle fine interrib between spiral ribs on posterior part ol
last whorl.
Description: Shell size small (up to height 12 mm,
diameter 9.5 mm, same specimen). Height approxi-
mately 1.3 times shell diameter. Ovate conical.
Phaneromphalous. Spire high, approximately two-thirds
of shell height. Pleural angle 54°. Protoconch unknown.
Teleoeonch approximately six whorls. Suture impressed.
Shoulder rounded. Sculpture consisting ol numerous
closely spaced, narrow spiral ribs; six to seven on spire
whorls, 16 to 18 on last whorl and becoming narrower
anteriorly of periphery. Spiral ribs just posterior of
suture strongest and minutely beaded. Spiral ribs on
shoulder weak, approximately two and widely spaced.
Interspaces between spiral ribs on posterior ol last whorl
with single spiral riblet. Aperture circular. Outer lip thin;
inner lip very slightly thickened anteriorly. Peristome
discontinuous? Umbilicus slit-like, nearly closed.
Growth lines prosocline, tilted 25° from vertical.
Holotype: LACMIP 13707, height 12.2 mm, diameter
9.6 mm.
Paratype: LACMIP 13708.
Type Locality: LACMIP 5571.
Geologic Age: Late Campanian to possibly early
Maastrichtian.
Distribution: Moreno Formation, “Quinto Silt” mem-
ber or possibly “Garzas Sand” member, Los Banos
Creek, Merced County, northern California (Area 6);
Point Loma Formation at the Carlsbad Research Center,
Carlsbad, San Diego County, southern California (Area
9); Cabrillo Formation (in a reworked clast from the
underlying Point Loma Formation), La Jolla, San Diego
County, southern California (Area 10).
Etymology: The new species is named for the Point
Loma Formation.
Discussion: The examined material consisted ol lour
specimens. Preservation is good. The new' species is like
the specimen of the extant Pupillaria papilla (Gould,
1849) illustrated by Hickman and McLean (1990, fig.
48, two figs.), but differs from their specimen by having
much more impressed sutures.
The new species resembles Margarites kasei Kiel and
Bandel (2001:31, pi. 5, figs. 16-17) from the Campanian
(undifferentiated) of northern Spain, but the new spe-
cies differs by having a wader pleural angle, wider spire
whorls, and much stronger spiral sculpture.
ACKNOWLEDGMENTS
Raymond Graham and Joe Haegert (Victoria Palaeon-
tology Society, Victoria, British Columbia) kindly pro-
vided excellent specimens with good locality data from
the Nanaimo Group, Vancouver Island area. LouElla R.
Saul (LACMIP) expertly cleaned the aperture of the
holotype of Agathodonta haegerti. james H. McLean
(LACM, Malacology) shared his vast knowledge of
vetigastropod genera. The following people facilitated
the loan of specimens: Paul Callomon (ANSP), Hariy
Filkorn (LACMIP), Lindsey T. Groves (LACM, Mala-
cology), Jann Thompson (Smithsonian Institution), Mark
Goodwin (UCMP), and Scott Rugh, Pat Don Vito,
and Kesler Krandall (SDSNH). Lindsey T. Groves
(LACM, Malacology) also provided some important
references.
LITERATURE CITED
Abdel-Gawad, G.I. 1986. Maastrichtian non-cephalopod mol-
lusks (Scaphopoda, Gastropoda and Bivalvia) of the mid-
dle Vistula Valley, central Poland. Acta Geologica Polonica
3: 69-224.
Adegoke, O.S. 1977. Stratigraphy and paleontology of the
Ewekkoro Formation (Paleocene) of southwestern Nige-
ria. Bulletins of American Paleontology 71(295): 1-379.
Akers, R.E. and T. J Akers. 1997. Texas Cretaceous gastro-
pods. Paleontology Section, Houston Gem and Mineral
Society, Texas Paleontology Series, Publication 6: 1-340.
Page 204
THE NAUTILUS, Vol. 125, No. 4
Allison, E.C. 1955. Middle Cretaceous Gastropoda from Punta
China, Baja California, Mexico. Journal of Paleontology
29: 400-432.
Bandel, K. and W. Stinnesbeck. 2000. Gastropods of the
Quinquina Formation (Maastrichtian) in central Chile:
Paleobiogeographie relationships and the description of a
few new taxa. Zentralblatt fur Geologie und Palaontologie
1: 757-788.
Beu, A. G. and F. M. Climo. 1974. Mollusea from a Recent coral
community in Palliser Bay, Cook Strait. New Zealand
Journal of Marine and Freshwater Research 8: 307-332.
Bouchet, P. and |.-P. Rocroi. 2005. Classification and nomen-
clator ol gastropod families. Malacologia 47: 1-397.
Brusina, S. 1865. Conehilglie Dalmate inedite. Verhandlungen
der Kaiserlich-Koniglichen Zoologisch-Botanischen Gesell-
schaft in Wien 15: 1—42.
Caleara, P. 1839. Ricerche malacologiche. Palermo, G. Pedone,
16 pp.
Caqtenter, P. P. 1864. Supplementary report on the present
state of our knowledge with regard to the Mollusea of the
west coast of North America. Report of the British Associ-
ation of Advancement of Science, 1863, pp. 517-686.
Cossmann, M. 1918. Essais de Paleoeonehologie Compared.
Tome 11. Privately published, Paris, 388 pp.
Cossmann, M. and A. Peyrot. 1916. Scaphopodes et gastro-
pods. Tome 3. Conchologie Neogenique de l’Aquitaine.
Aetes Soeiete Linneene de Bordeaux 69: 1-709.
Cox, L. R. 1960. Superfamily Trochacea Rafinesque, 1815. In:
Moore, R.C. (ed.) Treatise on Invertebrate Paleontology,
Part I, Mollusea 1. Geological Society of America and
University of Kansas Press, pp. 1246-1262.
Dacque, E. 1936. Uber homoogenetisehe gastropodenform.
Zentralblatt fur Mineralogie, Geologie und Palaontologie
12: 533-546.
Dali, W.H. 1909. Contributions to the Tertiary paleontology of
the Pacific coast I. The Miocene of Astoria and Coos Bay,
Oregon. U. S. Geological Survey Professional Paper 59:
1-278, 23 pis.
Dali, W.H. 1919. Descriptions of new species of Mollusea
from the north Pacific Ocean in the collection of the
United States National Museum. Proceedings of the U.S.
National Museum 56 (2295): 293-371.
Goldfuss, A. 1826-1844. Petrefacta Germaniae. Abbildungen
und beschreibungen der petrefaeten Deutschlands und
der angrenzenden lander. Teil 3. A. Goldfuss, Diisseldorf,
128 pp.
Gould, A. A. 1849. On the shells collected by the United States
Exploring Expedition. Proceedings ol the Boston Society
of Natural History 3: variously paged.
Gradstein, F, |. Ogg, and A. Smith. 2004. A geologic time scale
2004. Cambridge University Press, Cambridge, 589 pp.
Grant, U.S., IV and H.R. Gale. 1931. Catalogue of the marine
Pliocene and Pleistocene Mollusea of California and adja-
cent regions. Memoirs of the San Diego Society of Natural
History, Volume 1, 1036 pp.
Gray, J.E. 1847. On the classification of British Mollusea, by
Dr. W. E. Leach. Annals and Magazine of Natural History,
Series 1, 20: 267-273.
Gray, M.E. 1850. Figures of molluscous animals. Volume 4.
Longman, Brown, Green, and Longmans, London 219 pp.
Hickman, C.S. and J.H. McLean. 1990. Systematic revision
and suprageneric classification of trochacean gastropods.
Natural History Museum of Los Angeles County, Science
Series 35, 169 pp.
Kase. T. 1984. Early Cretaceous marine and brackish-water
Gastropoda from Japan. National Science Museum,
Tokyo, 263 pp.
Keen, A.M. 1960. Superfamily Trochacea Rafinesque, 1815.
In: R. C. Moore (ed.), in Treatise on Invertebrate Paleon-
tology, Part I, Mollusea 1. Geological Society of America
and University of Kansas Press, pp. 1246-1274.
Keen, A.M. 1971. Sea shells of tropical west America. Marine
nollusks from Baja California to Peru. 2nd ed. Stanford
University Press, Stanford, California, 1064 pp.
Kiel, S. and K. Bandel. 2001. Troehidae (Archaeogastropoda)
from the Campanian of Torallola in northern Spain. Acta
Geologica Poloniea 51 : 137—154.
Kollmann, II. A. 1985. Upper Cretaceous gastropods from
excavations for the Highway A10 (Charente, France).
Cretaceous Research 6: 85-111.
Kollmann, H.A. 2005. Revision critique de la paleontology
Frangaise d’Alcide d’Orbigny. Publication dirigee par
J.-C. Fischer incluant la reedition de 1’original. Volume 3.
Gastropodes Cretaees. Baekhuys Publishers, Leiden,
239 pp.
Kuroda, T., T. Habe, and K. Oyama. 1971. The sea shells of
Sagami Bay. Maruzen Co., Ltd., Tokyo, 1281 pp.
Lesson, R.P 1835. Illustrations de zoologie on recueil de fig-
ures d’animaux peintes d’apres. Paris, 17 pis.
Leymerie, A. 1841-1842. Memoire sur le terrain Cretaee du
departement de l’Aube, contenant des considerations
generales sur le terrain Neoeomien. Memoires de la
Soeiete de Geologique de France, Paris, Serie 1, (1841),
4: 291-364; (1842), 5: 1-34.
Matsumoto, T. 1960. Upper Cretaceous ammonites of Califor-
nia. Part 3. Memoirs of the Faculty of Science, Kyushu
University, Series D, Geology, Special Volume 2, 204 pp.
McLean, [.II. 1984. Agathodonta nortoni , new species: Living
member of a Lower Cretaceous trochid genus. The Nau-
tilus 98: 121-123.
McLean, J.H. and S. Kiel. 2007. Cretaceous and living
Colloniidae of the redefined subfamily Petropomatinae,
with two new genera and one new species, with notes on
opercular evolution in turbinoideans, and the fossil record
of Liotiidae (Vetigastropoda: Tubinoidea). Palaonto-
logische Zeitschrift 81 : 254—266.
Monari, S., M.A. Conti, and [. Szabo. 1996. Evolutionary
systematics of Jurassic Trochoidea: the family
Colloniidae and the subfamily Procouulinae. In: f. D.
Taylor (ed.), Origin and Evolutionary Radiation of the
Mollusea. Oxford University Press, Oxford, England,
pp. 199-204.
d’Orbigny, A.D. 1842-1843. Paleontologie frangaise. Terrains
Cretaees. Tome II. Gasteropodes. Arthus Bertrand, Paris,
662 pp.
Palmer, K.V.W. 1958. Type specimens of marine Mollusea
described by P. P. Carpenter from the west coast (San
Diego to British Columbia). The Geological Society of
America Memoir 76, 376 pp.
Philippi, R.A. 1887. Die Tertiaren und Quartaren
versteinerungen Chiles. F. A. Brochkaus, Leipzig, 266 pp.
Popenoe, W. P, R.W. Imlay, and M.A. Murphy. 1960. Correla-
tion of the Cretaceous formations of the Pacific coast
(United States and northwestern Mexico). Bulletin of fhe
Geological Society of America 71 : 1491-1540.
Quintero, I. and |. Revilla. 1966. Algunas especies nuevas
y otra poeo conocidas. Notas y Comunicaciones del
Institute) Geologico y Minero de Espana 82: 27-86.
R.L, Squires, 2011
Page 205
Rafinesque, C.S. 1815. Analyse de la nature ou tableau de
univers et des corps organises. Barravecchia, Palermo,
224 pp.
Salvini-Plawen, L. 1980. A reconsideration ol systematics in
the Mollusca (phylogeny and higher classification).
Malacologia 19: 249-278.
Saul, L. R. and R.L. Squires. 2008. Volutoderminae (Gastropoda:
Volutidae) of Coniacian tli rough Maastrichtian age from the
North American Pacific slope. Journal ol Paleontology 82:
213-237.
Sold, N.F. 1998. Upper Cretaceous troehacean gastropods
from Puerto Rico and Jamaica. Palaeontographica Ameri-
cana 60: 1-109.
Squires, R.L. and J.L. Goedert. 1995. New species ot middle
Eocene gastropods from the northern Doty Hills, south-
western Washington. The Veliger 38: 254—269.
Squires, R.L. and L. R. Saul. 2001. New Late Cretaceous gas-
tropods from the Pacific slope of North America. Journal
of Paleontology 75: 46-65.
Squires, R.L. and L.R. Saul. 2003a. Additions to Late Creta-
ceous shallow-marine gastropods from California. The
Veliger 46: 145-161.
Squires, R.L. and L.R. Saul. 2003b. New Late Cretaceous
(Campanian and Maastrichtian) marine gastropods from
California. Journal of Paleontology 77: 50-63.
Squires, R.L. and L.R. Saul. 2004a. The pseudomelaniid gas-
tropod Paosia from the marine Cretaceous of the Pacific
slope of North America and a review ot the age and
paleobiogeography ol the genus. Journal of Paleontology
78: 484-500.
Squires, R.L. and L.R. Saul. 2004b. Cretaceous corbulid
bivalves of the Pacific slope of NOrth America. The Veli-
ger 47: 103-129.
Squires, R.L. and L.R. Saul. 2005. New Late Cretaceous
(Santonian and Campanian) gastropods from California and
Baja California, Mexico. The Nautilus 1 19(4): 133-138.
Squires, R.L. and L.R. Saul. 2006. Cretaceous Acila
( Tnincacila ) (Bivalvia: Nuculidae) from the Pacific slope
of North America. The Veliger 82: 83-104.
Squires, R.L. and L.R. Saul. 2009. Cretaceous opine bivalves
from the Pacific slope of North America and palaeobio-
geography of subfamily Opinae Chavan, 1969. Palae-
ontology 52: 1311-1347.
Stephenson, L.W. 1941. The larger invertebrate fossils of the
Navarro Group of Texas (exclusive of corals and crustaceans
and exclusive of the fauna of the Escondido Formation).
The University of Texas Publication 4101: 1-641.
Stewart, R.B. 1927. Gabb’s California fossil type gastropods.
Proceedings of the Academy of Natural Sciences of Phila-
delphia 78: 287-447, pis. 20-31.
Stewart, R.B. 1946. Geology of Reef Ridge Coalinga district
California. U. S. Geological Survey Professional Paper
205-C: 81-115, pis. 11, 12, 15-17.
Stoliezka, F. 1867-1868. Cretaceous fauna of southern India, 2.
The Gastropoda. Geological Survey of India, Memoirs,
Palaeontologica Indiea, Series 5, 497 pp.
Sundberg, F. and B. Riney. 1984. Preliminary report on the
Upper Cretaceous macro-invertebrate faunas near Carls-
bad, California. In: P. L. Abbott (ed.) Upper Cretaceous
Depositional Systems, Southern California-Northern Baja
California. Pacific Section, SEPM, Volume and Guide-
book, Book 36, pp. 103-107.
Verrill, A.E. 1884. Second catalogue of Mollusca recently
added to the fauna of the New England coast and the
adjacent part of the Atlantic, consisting mostly of deep-
sea species, with notes on others previously recorded.
Transactions of the Connecticut Academy of Arts and Sci-
ences 6: 139-194.
Wenz, W. 1938-1944. Gastropoda. Teil 1. Allgemeiner teil und
Prosob ranchi a. In: O. LI. Schindewolf (ed.) Handbuch der
Palaozoologie, Band 6. Gebriiber Borntrager, Berlin, pp.
1-1639, [Reprinted 1960-1961],
White, C. A. 1885. New Cretaceous fossils from California. U.S.
Geological Survey Bulletin 22: 1-14.
Williams, S.T. and T. Ozawa. 2006. Molecular phylogeny sug-
gests polyphyly of both the turban shells (family
Turbinidae) and the superfamily Troehoidea (Mollusca:
Vetigastropoda). Molecular Phylogenetics and Evolution
39: 33-51.
Williams, S.T., S. Karube, and T. Ozawa. 2008. Molecular sys-
tematics of Vetigastropoda: Troehidae, Turbinidae and
Troehoidea redefined. Zoologica Scripta 37: 483-506.
Williams, S.T., K.M. Donald, H.G. Spencer, and T. Nakano.
2009. Molecular systematics of the marine gastropod fam-
ilies Troehidae and Calliostornatidae (Mollusca: superfam-
ily Troehoidea). Molecular Phylogenetics and Evolution
54: 783-809.
Wood, W. 1828. Supplement to the Index Testaceologicus; or a
catalogue of shells, British and foreign. Richard Taylor,
London, 59 pp.
APPENDIX 1 - TYPE LOCALITIES OF
THE NEW SPECIES
Listed quadrangle maps are U. S. Geological Survey
maps. Detailed information about the other cited locali-
ties is available via the following: LACMIP website:
<http ://ip.nhm.org/ipdatabase/locality_show>; UC M P
website: <http://ucmpdb.Berkeley.edu/loc.html>; and
CAS: contact the collections manager.
Locality 1. “Lower Quarry,” just west of Nanaimo,
49°11.735' N, 124°6.143' W, at the Moto-cross racetrack-
on Dumont Road, east coast of Vancouver Island, British
Columbia. Haslam Formation, upper part. Age: Latest
Santonian. Collector: Joe Haegert, I9S7.
Locality 2. Gray siltstone, slightly north of “White
House Site,” near ferry terminal, west shore of Denman
Island, 49° 32' 16.2" N,' 124°49'37.7" W, off east coast of
Vancouver Island, British Columbia. Cedar District For-
mation, upper part. Age: Late middle Campanian to
early late Campanian (Metaplacenticeras ef. pacificum
Zone). Collector: B. Graham, March 28, 2005.
LAC VI IP 5571. Elevation 10 ft., gray argillaceous and
coarse sandstone concretion (Point Loma Formation
lithology) on beach, approximately 20 m N of concrete/
gully at W most end of Forward St., La Jolla, La Jolla
Quadrangle (1953, 7.5 minute), San Diego, southern
California. Clast of Point Loma Formation reworked into
the Cabrillo Formation. Age: Late Campanian or possi-
bly early Maastrichtian. Collector: B. Welton, August 16,
1977.
LACMIP 10742. Fine-grained sandstones and sandy
shales on S bank of Little Cow Creek at the approximate
Page 206
O
THE NAUTILUS, Vol. 125, No. 4
S line of the SE 1/4 of the SW 1/4 of section 36, T. 33
N, R. 3 W, Millville Quadrangle (15 minute, 1953),
Shasta County, California. Redding Formation, Frazier
Siltstone Member. Age: Middle to late Turonian. Col-
lectors: W. R Popenoe and G. P. Zebal, August 1 ,
1941.
L ACM IP 10798. Lat. 40°38'00" N, long. 122°04'30"
W. Massive sandstones interbedded with conglomerates
on S side of high E-W trending ridge, 998 m (3275 ft.)
S54°59,W from SE corner of section 10, T. 32 N, R. 2 W,
Millville Quadrangle (15 minute, 1953), south side of
Oak Run Valley, Shasta County, northern California.
Redding Formation, Member V. Age: Early Santonian.
Collectors: W. P. Popenoe and C. W. Ahlroth, July 1,
1936.
LACMIP 24123. Hard, medium to coarse-grained,
gray pebbly arkosic sandstone, near of ridge, 525 ft.
north of Jalama Creek, elevation 625 ft., 2.42 mi. E and
0.68 mi. S of the Jalama Ranch Headquarters, 2.29 mi.
W and 0.42 mi N of the SE corner of the topographic
sheet, Lompoc Hills Quadrangle (1947), Santa Barbara
County, California. Jalama Formation. Age: Late Cam-
panian. Collector: D. Dailey, August, 1958.
LACMIP 28777. From boulder in basal “Chico” con-
glomerate, Elder Creek, Tehama County, northern
California. Collector: P. R. Reinhart.
SDSNH 152. Canon de Las Encinas, Rancho Agua
Hedionda, San Diego County, California. Point Loma
Formation. Age: Late Campanian or possibly early
Maastrichtian. Collector: F. Stephens, March 29, 1929.
THE NAUTILUS 125(4):207-212, 2011
Page 207
Giant fossil Acharax (Bivalvia: Solemyidae) from
the Miocene of Japan
Kazutaka Ainano
Department of Geoscience
Joetsu University of Education
Joetsu 943-8512, JAPAN
[email protected]
Ilisao Ando
Department of Earth Sciences
Faculty of Science
Ibarald University
Mito 310-8512, JAPAN
ando@mx. ibarald . ac . jp
ABSTRACT
Specimens of Acharax yokosukensis recently collected from the
upper lower Miocene Kokozura Formation of the Takaku
Group in Ibarald Prefecture, central Japan, served as the basis
for a re-description of the species. These specimens include a
valve of the largest specimen of this genus known worldwide,
exceeding 295.7 nun in length. The occurrences of the giant
Acharax species in Japan are confined to lower to lower middle
Miocene sediments deposited in tropical shallow and deep
environments.
Additional keywords: Chemosyn thesis, bivalves, deep-sea
INTRODUCTION
Solemyidae is the oldest group ol chemosymbiotic
bivalves, ranging back to the Ordovician (Taylor and
Glover, 2010; Kiel, 2010). Among them, the oldest con-
firmed member of the extant genus Acharax is known
from the early Cretaceous in Hokkaido, northern Japan
(Kiel et ah, 2008), but there are many unidentified
solemyids from the older geological record that may also
belong to Acharax. Two species of Acharax are known to
live in Japanese waters: A. johnsoni (Dali, 1891) and
A. japonicus (Dunker, 1882). The latter species is small
and iives in shallow water (0-20 m depth; Habe, 1977)
and has been found in settling tanks of sea water at a
marine laboratory (Yamanaka et ah, 2008). In contrast,
A. johnsoni has a large shell attaining 150 mm in length
(Kamenev, 2009), similar to other deep-water Acharax
species, and lives in deep water (the depth range of
A. johnsoni is very wide; according to Kamenev (2009)
the species may be found from 100-5379 m. However,
100 m seems to be an exceptional case. Kamenev’s data
and JAMSTEC data show this species usually lives in
deeper than 370 m.) The largest living species of
Acharax is A. bartschii described by Dali (1908b) from
the Philippines, with a shell length of 191 mm.
Notwithstanding problems with their identification,
fossil Acharax in Japan are more diverse than extant
species. Eleven species have been recorded from depos-
its of Cretaceous to Pliocene age (Kanie and Kuramoehi,
2002; Kiel et ah, 2008). The largest known species is
A. gigas from the Miocene Haratajino Formation with a
length reaching 264.1 mm (Kanie et ah, 1999; Kurihara,
2000). Taylor and Clover (2010) cited a specimen of
A. yokosukensis Kanie and Kuramoehi, 1995, from the
Miocene Hayama Group in Kanagawa Prefecture, cen-
tral Honshu, as the largest Acharax in the world, refer-
ring to “a fossil Acharax from the Miocene [that]
measured a massive 300 mm”. However, Kanie and
Kuramoehi (1995) only estimated that, based on a frag-
ment of a shell.
We collected an imperfect specimen of A. yokosukensis
having a length of 295.7 mm from the Miocene Kokozura
Formation of the Takaku Group exposed along Pacific
coast in Kitaibaraki City, in the northern part of Ibarald
Prefecture, central Honshu. So far, this specimen is the
largest Acharax recorded worldwide. In this paper, we
describe A. yokosukensis and speculate about why it could
have evolved to such large size.
MATERIALS AND METHODS
The specimens described herein were collected from
boulders present in the uppermost lower Miocene
Kokozura Formation that may constitute the base layer
under the Iznra Kanlco Hotel (Figure 1). These boulders
with a diameter of around 1 m consist of sandy limestone
or calcareous fine-grained sandstone including many
shells and trace fossils (Figure 2). Ueda et al. (2005)
differentiated these calcareous concretions into six mor-
phological types. Among them, type I concretions (large
irregularly shaped carbonates) show negative 51 ’C value
ranging from -29.4 to -20.9%o. These values indicate
that the carbonates precipitated under the influence of
the oxidation of hydrocarbons such as crude oil or
methane with an influx of marine bicarbonate (Kiel and
Peckmann 2007). The boulders yielding the large
Acharax yokosukensis specimens resemble type I con-
cretions in size and shape.
Page 208
THE NAUTILUS, Vol. 125, No. 4
Figure 1. Locality map. Geological map adapted from Ueda et al. (2005).
Figure 2. Occurrence of Acharax yokosukensis in a calcare-
ous concretion block.
The age of the Kokozura Formation of the Takaku
Group in this area was assigned to the uppermost lower
Miocene Crucidenticula kanayae zone (NPD 3A zone;
NPD = Neogene North Pacific Diatom) by Yanagisawa
(1996), based on diatom fossils. From the sedimentary
facies and the occurrence ol heterotrophic bivalves like
Mizuhopecten kobiyamai (Kamada) and Cylocardia
siogamensis (Nomura), these sediments were considered
to be deposited on the muddy sand shelf (Ueda et ah,
2005).
The fauna associated with Acliarax yokosukensis is a
blend of chemosymbiotic bivalves and predatory gastro-
pods. The chemosymbiotic species include the lucinids
Lucinoma acutilineatum (Conrad) and Nipponothracia ?
sp., the thyasirid Conchocele bisecta (Conrad), and the
vesicomyids Callogonia ? sp. and Adulomya sp. The pred-
atory gastropod species are represented by a few spec-
imens of the naticid Cryptonatica clausa (Broderip and
Sowerby) and the turrid Megasurcula yokoyamai (Otuka).
For comparing the shell proportion ol Acliarax
yokosukensis, some Recent specimens of A. johnsoni
from northern Pacific, stored at National Science
Museum in Tokyo were examined.
Abbreviations used in text: |UE=Joetsu University of
Education; YCM-Gp = Yokosuka City Museum.
SYSTEMATICS
Family Solemyidae
Genus Acharax Dali, 1908
Type Species: Solemya johnsoni Dali, 1891
Acharax yokosukensis Kanie and Kuramochi, 1995
(Figures 3-10)
Acharax aff. tokunagai (Yokoyama). — Ogasawara et ah,
1994: 34-35, figs. 3-la-e.
Acharax n. sp. — Kanie et al., 1995: 57-58, figs. 1, 2-1-3, 3-2-4.
Acharax yokosukensis Kanie and Kuramochi, 1995: 52,
56, figs. 1—4; Kanie and Kuramochi, 2002: 56, figs. 2-13.
Holotype: YCM-Gp Ig36.
Material Examined: Eight specimens including one
almost perfect specimen. |UE nos. I5887-1~8.
K. Amano and II. Ando, 2011
Page 209
Figures 3—10. Acharax yokosukensis (Kanie and Kuramochi). 3—5, 7-10. Specimens from the Kokozura Formation. 3—5. JUE
no. 15887-2, right valve. 3. Rubber cast of hinge of the specimen illustrated in Figure 5, hinge length, 82.9 mm. 4. Rubber cast of
outer shell surface of the specimen illustrated in Figure 5, length 168.4 mm. 5. Inner mold, length 155.1 mm. 7. Rubber cast of
outer shell surface, JUE no. 15887-3, length 195.2+ mm, right valve. Most posterior part and some ventral part are missing.
8. Rubber cast of inner shell surface, JUE no. 15887-4, length 109.9 mm, left valve. 9, 10. JUE no. 15887-1, left valve. 9. Inner
mold, length 244.7 mm. 10. Rubber cast of outer shell surface, length 295.7+ mm. 6. Holotype from the Hayama Group. YCM-Gp
Ig36, length 144.1 mm, right valve.
o o o
Description: Shell exceptionally large for genus,
exceeding 295.7 nun in length (Table 1), elongate quad-
rate, height/length-ratio = 0.40-0.44, equivalve and
inequilateral, moderately inflated. Umbo situated nearly
central or slightly posteriorly (anterior length: AL/ shell
length-ratio = 0.52-0.61). Anterior margin subtruncate;
ventral margin nearly straight; antero-dorsal margin
nearly straight; postero-dorsal margin very broadly
arched, continuing into well-rounded posterior margin.
Hinge edentulous and inner surface of subumbonal part
radially grooved. Nymph opisthodetic. Anterior adductor
muscle scar indistinct; posterior adductor muscle scar
large, quadrate, deeply impressed and crenulated by dis-
tinct radial grooves. Surface sculptured by fourteen
radial ribs; five distinct, low and wide radial ribs in ante-
rior part; five fine and round-topped radial ribs with very
wide interspaces in middle part; four round-topped
radial ribs with narrower interspaces in posterior part.
Remarks: As pointed by Kanie and Kuramochi (1995),
Acharax aff. tokunagai (Yokoyama) described by
Ogasawara et al. (1994), from the lower Miocene
Aokiyama Formation in Chiba Prefecture, is a synonym
of A. yokosukensis. These authors reached this conclu-
sion because of the species centrally situated beak and
similar number of ribs (II in the Aokiyama specimens).
Comparison: Acharax gigas (Kanno, 1960) from the
Miocene Hiranita and Haratajino formations resemble
A. yokosukensis in its huge shell size (264.1 mm in
length). However, A. gigas can be distinguished from
A. yokosukensis in having a smaller height/length-ratio
(more elongate shell, H/L = 0.25-0.34), and a more
posteriorly situated beak (AL= 0.65-0.78) (Figures 11,
12). The Recent species, Acharax jolmsoni (Dali, 1891)
differs from A. yokosukensis by its smaller shell and
more posteriorly situated beak (AL = 0.70-0.77)
(Figures 11, 12).'
Distribution: Lower Miocene Aokiyama Formation
in Chiba Prefecture; upper lower Miocene Kokozura
Formation of Takaku Group in Ibaraki Prefecture;
lower middle Miocene Hayama Group in Kanagawa
Prefecture.
DISCUSSION
The giant specimens of Acharax yokosukensis reported
here were recovered from probable hydrocarbon seep
deposits in the lower to lower middle Miocene sedi-
ments in the northeastern Kanto District, central Hon-
shu (Figure 13). Another giant Acharax species, A. gigas
has also been recorded from ancient seep sites in the
Hiranita and I Iaratajino Formations in the northwestern
Kanto District, correlated with zone N8 of Blow (1969)
(latest early to earliest middle Miocene), based on the
examination of planktonic foraminiferans (Takahashi,
1992; Oishi and Takahashi, 1990). This Miocene age
corresponds to the nrid-Neogene Climatic Optimum
(Tsuchi, 1987). At that time, a tropical climate prevailed
in what is now the Kanto District (Ogasawara, 1994).
Other than the occurrence of the Kokozura specimens,
these giant Acharax were from deep seep sites. Excep-
tionally, the largest specimen of A. yokosukensis was
recovered from the shallow seep deposits ol the
Kokozura Formation. Thus, regardless of depth, the
warm climate and methane seep environment might
affect the size of fossil Acharax.
Like solemyids, lueinid bivalves are chemosymbiotic,
deep burrowers, and geologically old members of the
seep fauna, which first appeared in the Jurassic (Kiel,
2010) . Occurrences of large fossil lueinids were summa-
rized by Taylor and Glover (2009) who described the
largest lueinid, Superlucina megameris (Dali) that
reached 280 mm in length and 311 mm in height.
According to their list, the large lueinids appeared in
geological ages with warm climates like the late Jurassic-
early Cretaceous, middle Eocene, and middle Miocene.
In deposits younger than the early Pliocene, the occur-
rences are mostly confined to tropical areas like the
Philippines and Taiwan. Moreover, large lueinids were
recovered from both shallow and deep sites like the giant
Acharax.
Generally speaking, the maximum size of largest spe-
cies of each guild in the coastal marine tropics correlates
or correlated with the marine productivity (Vermeij,
201 1) . Solemyids are well known to have a reduced gut
or to lack an alimentary tract, and to depend on their
chemoautotrophic symbionts for nutrition (Stewart and
Cavanaugh, 2006; Taylor et al., 2008). It seems thus
plausible that chemosynthetic species need to take up a
lot of sulfide to achieve a large size (Taylor and Glover,
2009). Assuming that warm temperatures facilitate phys-
iological process like sulfide uptake, the warm tem-
peratures of the latest early to earliest middle Miocene
might have played a role in the gigantism of the Acharax
specimens reported here, although the exact mecha-
nisms are unknown. At modern seeps, Acharax often
lives at the periphery away from the highest sidfide con-
centrations (Sahling et ah, 2002). Thus, for obtaining
sulfides, the lack of competition might also play a role.
K. Amano and H. Ando, 201 1
Page 21 I
a>
20
0L
0
50 100 150 200 250 300
11
Length (mm)
12
100 150 200
Length (mm)
250
300
Figures 1 1-12. Ontogenetic changes in Acharax yokosukensis
(t: type material), A. johnsoni , A. gigas, and A. harfschii. The
largest shell of A. yokosukensis is incomplete and excluded from
both graphs. Dimensions of A. yokosukensis and the recent spec-
imens of A. johnsoni were measured by hand. Data for A. gigas
and A. harfschii respectively from Kanie et al. (1999) and Dali
(1908b). 11. Shell length and height. 12. Shell length and ante-
rior length.
ACKNOWLEDGMENTS
We are grateful to Steffen Kiel (University of Gottingen)
for his review and useful comments to this paper. We
thank two anonymous reviewers for their critical review
and many constructive comments. We also thank
Kenichiro Shibata (Yokosuka City Museum) and Hiroshi
Saito (National Museum of Nature and Science) for
examining the fossil and Recent shells of Acharax. We
acknowledge Akiyoshi Yamashita (Izura Kanko Hotel)
for providing some support in the field survey. This
4. Hiranita F.; and 5. Haratajino F.
study was partly supported by a Grant-in-Aid for
Scientific Research from the Japan Society for Promo-
tion ol Science (C, 20540456, 2008-2010).
LITERATURE CITED
Blow, W. H. 1969. Late Middle Eocene to recent planktonic
foraminiferal biostratigraphy. In: Bronnimann, P. and
Renz, 11. II. (eds.). Proceedings of the First International
Conference on Planktonic Microfossils (Geneva, 1967),
vol. 1, E.J. Brill, Leiden, pp. 199-421.
Dali, W. H. 1891. Scientific results of explorations by the U.S.
Fish Commission steamer “Albatross.” XX. On some new
or interesting West American shells obtained from dredg-
ings of the U.S. Fish Commission steamer “Albatross” in
1888. Proceedings of the U.S. National Museum 14 (849):
173-191.
Dali, W.H. 1908a. A revision of the Solenomyacidae. The Nau-
tilus 22: 1-2.
Dali, W.H. 1908b. A gigantic Solemya and a new Vesicomya .
The Nautilus 22: 61-63.
Dunker, W. 1882. Index Molluseorum Maris Japonic! Pub.
Fischer, Cassel, 301 pp.
Habe, T. 1977. Systematic^ of Mollusca in Japan. Bivalvia and
Scaphopoda. Zukan-no-Hokuryukan, Tokyo, 372 pp. [in
Japanese]
Kamenev, G.M. 2009. North Pacific species of the genus
Solemya Lamark, 1818 (Bivalvia: Solemyidae), with
notes on Acharax johnsoni (Dali, 1891). Malacologia 51:
233-261.
Kanie, Y. and T. Kuramochi. 1995. Acharax yokosukensis , n. sp.
(gigantic Bivalve) from the Miocene Hayama Formation
Page 212
THE NAUTILUS, Vol. 125, No. 4
of the Mima Peninsula, south-central Japan. Science
Report of Yokosuka City Museum 43: 51-57.
Kanie, Y. and T. Kuramochi. 2002. Review of the family
Solemyidae (Mollusca: Bivalvia) from Japan, and descrip-
tion of the new species. Science Report of Yokosuka City
Museum 49: 49-60.
Kanie, Y„ T. Kuramochi, T., S. Asami, and S. Kanno. 1995.
Solemyid pelecypod of the Miocene Hayama Group in
the Miura Peninsula. Report of Culture and Natural
Treasures of Yokosuka City 29: 57-61. [in Japanese]
Kanie, Y., T. Kuramochi, S. Kanno, C. Mizota, M. Shimizu, and
Y. Takakuwa. 1999. New occurrence and the shell form of
the Middle Miocene Acharax gigas (Bivalvia: Solemyidae)
in Gunma Prefecture. Bulletin of the Gunma Museum of
Natural History 3: 17-23. [in Japanese]
Kanno, S. 1960. The Tertiary System of the Chiehibu Basin,
Saitama Prefecture, central Japan. Part II. Japan Society
for the Promotion of Science. Palaeontology, pp. 123-396.
Kiel, S. 2010. The fossil record of vent and seep mollusks.
In: Kiel, S. (ed.) The vent and seep biota. - Aspects
from microbes to ecosystems. Springer, Dordrecht,
pp. 255-277.
Kiel, S., K. Amano, R.G. Jenkins. 2008. Bivalves from Creta-
ceous cold-seep deposits on Hokkaido, Japan. Acta
Palaeontologica Polonica 53: 525-537.
Kiel, S. and J. Peckmann. 2007. Chemosymbiotic bivalves and
stable carbon isotopes indicate hydrocarbon seepage at
four unusual Cenozoic fossil localities. Lethaia 40:
345-357.
Kurihara, Y. 2000. Middle Miocene deep-water molluscs of the
Haratajino Formation in the Isobe district, the Annaka-
Tomioka area, Gunma Prefecture, central Japan. Bulletin
of the Gunma Museum of Natural History 4: 1-22.
Ogasawara, K. 1994. Neogene paleogeography and marine
climate of the Japanese Islands based on shallow-marine
molluscs. Palaeogeography, Palaeoelimatology, Palaeo-
eeology 108: 335-351.
Ogasawara, K., K. Hisada, N. and Kitada. 1994. Early Miocene
Calijptogena from the Aokiyama Formation, Hota Group,
Boso Peninsula, Japan. Annual Report of the Institute of
Geoscience, University of Tsukuba 20: 33—37.
Oishi, M. and M. Takahashi. 1990. Miocene formations in the
Takasaki district, central Japan. With special reference to
the developmental process of the Niwaya Unconformity.
Contributions from the Institute of Geology and Paleon-
tology Tohoku University 92: 1-17. [in Japanese with
English abstract]
Sahling, II., D. Riekert, R.W. Lee, P. Linke, and E. Suess.
2002. Macrofaunal community structure and sulfide flux
at gas hydrate deposits from Cascadia convergent
margin, NE Pacific. Marine Ecology Progress Series 231:
121-138.
Stewart F. J. and C.M. Cavanaugh. 2006. Bacterial endosymbi-
oses in Soleim/a (Mollusca: Bivalvia) — model systems
for studies of symbiont-host adaptation. Antonie van
Leeuwenhoeek 90: 343-360.
Takahashi, M. 1992. Geologic setting of the Miocene Chiehibu
Basin in the Neogene Tectonics of central Japan. Bulletin
of the Saitama Museum of Natural History 10: 29-45. [in
Japanese with English abstract]
Taylor, J.D. and E.A. Glover. 2009. A giant lucinid bivalve
from the Eocene of Jamaica - Systematies, life habits
and chemosymbiosis (Mollusca: Bivalvia: Lueinidae).
Palaeontology 52: 95-109.
Taylor, J.D. and E.A. Glover. 2010. Chemosymbiotic bivalves.
In: Kiel, S. (ed.). The vent and seep biota — Aspects from
microbes to ecosystems. Springer, Dordrecht, pp.
107-135.
Taylor J.D., E.A. Glover, S.T. and Williams. 2008. Ancient
shallow water chemosymbiotic bivalves: systematies of
Solemyidae of eastern and southern Australia. Memoirs
of the Queensland Museum - Nature 54: 75-104.
Tsuchi, R. 1987. Mid-Neogene migration of Tethyan tropical
Mollusca and larger Foraminifera into northern Japan. In:
McKenzie (ed.). Shallow Tethys 2, Proceedings of Inter-
national Symposium of Shallow Tethys, Wagga Wagga, pp.
15-17.
Ueda Y., R.G. Jenkins, H. Ando, and Y. Yokoyama. 2005.
Methane-induced calcareous concretions and chemosyn-
thetie community on an outer shelf of the Japan forearc
basin: an example from the Miocene Kokozura Formation,
Takaku Group, north of Ibarald Prefecture, central
Japan. Fossils 78: 47-58. [in Japanese with English
abstract]
Vermeij, G. [. 2011. Shifting sources of productivity in the
coastal marine tropics during the Cenozoic Era. Proceed-
ings of the Royal Society, series B, 278 (1716): 2362-2368
( doi : 10. 1 098/ rspb .201 0. 2362 ) .
Yamanaka, T., C. Mizota, K. Matsuyama-Serisawa, T.
Kakegawa, J.-I. Miyazaki, M. Mampuku, H. Tsutsumi,
and Y. Fujiwara. 2008. Stable isotopic characterization
of carbon, nitrogen and sulfur uptake of Acharax japonica
from central Japan. Plankton N Benthos Research 3:
36-41.
Yanagisawa, Y. 1996. Diatom biostratigraphy of the Neogene
Taga Group in Otsu district, Kitaibaraki City, Ibarald Pre-
fecture, Japan. Memoir of the National Science Museum
29: 41-59. [in Japanese with English abstract]
THE NAUTILUS 125(4) :213-220, 201 I
Page 213
Redescription of the genus Modiomytilus Griffin, 1990 (Bivalvia:
Mytilidae) from Southern Patagonia with remarks on the
paleobiogeography of the genus
Santiago F. Genta-Iturreria
Division Paleozoologia Invertebrados
Museo de La Plata
Paseo del Bosque s/n
1900 La Plata. ARGENTINA
and
Agencia Nacional de Promocion de
Ciencia y Tecnica (ANPCyT)
[email protected]
Miguel Griffin
Division Paleozoologia Invertebrados
Museo de La Plata
Paseo del Bosque s/n
1900 La Plata, ARGENTINA
and
Consejo Nacional de Investigaeiones
Cientificas y Tecnicas (CONIGET)
Martin Rodriguez Raising
Departamento de Geologia
Universidad Nacional del Sur
Bahia Blanca, ARGENTINA
and
Consejo Nacional de Investigaeiones
Cientificas y Tecnicas (CONIGET)
ABSTRACT
Modiomytilus Griffin, 1990, was based on composite molds
collected from Cenozoic rocks in southern Patagonia. The
type species comes from the early Miocene Centinela For-
mation, exposed along the southern shore of Lake Argentino.
An additional species is known from the Eocene Rio Turbio
Formation, which outcrops only at the southwestern corner
of Santa Cruz Province. New material preserved as original
shell was collected recently in beds referred to the Centinela
Formation exposed in the same area as the Rio Turbio For-
mation, about 150 km south of Lake Argentino. Enough
detail is preserved in collected the shells to warrant an
emended diagnosis and a new and more complete descrip-
tion of the genus, as they provide a set of characters not
recorded in the currently known material of any of the spe-
cies described. The shells clearly belong to the type species,
i.e., Modiomytilus argentinensis Griffin, 1990. These charac-
ters, among which are included the ligament, adductor mus-
cle scar, pallial line, and byssal retractor muscle scar allow a
reinterpretation of this genus and confirm its validity. At the
same time these new morphological characters may be
potentially useful for further phylogenetic analyses and a
new interpretation of the currently available material, a pre-
requisite for understanding the palaeobiogeographic history
of this genus.
Additional keywords: Early Miocene, middle Eocene, shell
morphology
INTRODUCTION
The genus Modiomytilus was introduced to include two
species, Modiomytilus argentinesis Griffin (1990: 377-
380), from the early Miocene Centinela Formation, and
Modiomytilus mercerati Griffin (1990: 380-381, fig. 1 , 2)
from the Eocene Rio Turbio Formation, in Santa Cruz
Province. The genus description was based on composite
molds in which no part of the shell was preserved. Also
belonging in this genus are Mytilus aff. chorus hauthali
Molina sensu Ihering (1907: 273-274), from the
“Patagonian” beds in the Nirihuau basin (northern
Patagonia) and Mytilus pseudochorus Doello-Jurado
(1922: 86-90, fig. 1) from the “Patagonian” beds of Sierra
de los Baguales (Santa Cruz), and additional non-figured
specimens from San Julian. Mytilosootus arcuatus
Stilwell and Zinsmeister, (1992: 54-56, pi. 3 fig. a), from
the Eocene La Meseta Formation in Seymour Island,
Antarctica, was based on an internal mold belonging in
Modiomytilus too.
The aim of this contribution is to re-describe this
genus more accurately based on new specimens recently
collected in the Centinela Formation in southwestern
Santa Cruz. This material confirms some of the original
diagnostic characters and reveals the presence of other
particular features that better distinguish this taxon from
other Mytilidae. Among these are shell thickness, the
presence of a well developed and buttressed anterior
adductor muscle scar coalescent with a large byssal
retractor scar, and a pitted resilial ridge, together with a
thickened hinge plate with growth lines only. Biogeo-
graphic and stratigraphic distributions of the species
involved suggest that the genus had an austral origin
and a lifespan ranging from the at least the late Eocene
through the early Miocene. Its ecological requirements
probably played an important role, as it is not common.
However, in the beds where it does occur — deposited in
shallow, possibly restricted marine environments — it is
usually abundant, and sometimes the only mollusk taxon
present.
The specimens studied are deposited at the Division
de Paleozoologia de Invertebrados Collection, Museo de
La Plata, Buenos Aires, Argentina (MLP). The term
ichnospecies is abbreviated “isp.
Page 214
THE NAUTILUS, Vol, 125, No. 4
103m
80m
References
Conglomerates
Sandstones
Limestones
Intercalation of sandtones and lii
Trough cross- stratification
Paleocurrents
+ Modiomytilus argentinensis
Planar tangential cross-stratification
Planar tabular cross- stratifictcion
Herringbone cross- stratification
Low angle planar cross-stratification
Incipient stratifiction
Wavy lamination
Lenticular lamination
Horizontal lamination
2
Figure 1-2. Location map and stratigraphic section. 1. Location map ot the fossil locality in Santa Cruz Province, Argentina.
2. Studied stratigraphic section showing bed with mytilids.
S.F. Genta-Iturrerfa et al., 2011
Page 215
GEOLOGICAL SETTING
(Ligure 2)
Rocks deposited during the Cenozoic Patagonian trans-
gression are included in several units ol slightly variable
lithology and exposed over a wide area of Patagonia.
Located in the southwestern corner of Santa Cruz Prov-
ince, these rocks are known as Centinela Lormation
(Furque and Camacho, 1972). This unit is discontin-
uously exposed along the foothills of the Andes for a
distance of about 500 km, approximately between Lake
Pueyrredon (47°4S/ S, 70°47/ W) and Estancia La
Escondida (51°24' S, 72° 10' W). The new specimens
collected come from this southernmost locality, where
the Centinela Formation overlies the continental
plant and coal-bearing Oligocene Rio Leona Lormation
(Ligure 1).
Marenssi et al. (2005) reported that the Rio Leona
Lormation comprises a fining-upward succession of
facies deposited in high-energy fluvial environments at
the base, giving way to low energy maeandriform and
anastomosed rivers at the top. Such a variation in the
fluvial style of this unit is probably linked to the paleo-
geographic evolution of the southwestern corner of the
Austral Basin. The base probably represents a high
gradient piedmont context, while the top of the unit
reveals the presence of a low coastal plain at the time
the unit was deposited. Approximately 25 to 22 million
years ago this coastal plain was covered by the Patago-
nian transgression. Accordingly, the Rio Leona and
Centinela formations constitute a depositional sequence
of Oligocene to early Miocene age (Marenssi et al.,
2002).'
At the fossil locality studied, the Centinela Lormation
comprises fine to medium sandstones, sometimes with
fossil mollusks, with subordinate eonglomeradic sand-
stones, fine conglomerates, coquinas and mudstones
deposited in a shallow littoral marine environment
(Malumian et al., 2000). Contact with the overlying
Santa Cruz Lormation is masked by Recent deposits.
However, the restricted outcrops of the Centinela
Formation in the area and the fact that the Santa
Cruz Formation in some places directly overlies the
Rio Leona Lormation suggest that there may be an
unconformity separating the two units (Malumian
et al., 2000).
The studied locality lies within land belonging to
Estancia La Escondida, about 20 km to the north of
the mining town of Rio Turbio. Contrary to localities in
the Lake Argentino area, at Estancia La Escondida the
Centinela Lormation is thinner and geographically
restricted, i.e., it is exposed only along a narrow 12 km
N-S stretch between Estancia Las Tres Marias
(51°30/00// S, 72°16,67,/ W) and Estancia La Primavera
(51°27'00" S, 72°13'60" W) (Malumian et al., 2000).
The section is 103 m thick and contact with the under-
lying Rio Leona Formation is transitional, as at other
localities in southwestern Santa Cruz such as Estancia
25 de Mayo and Estancia La Siberia (Casadio et al..
2000; Rodriguez Raising et al., 2006). Because of the
loose and poorly resistant nature ol the pelitic lacies at
the top of the Rio Leona and bottom of the Centinela
formations, the contact itself is not exposed.
The lowermost exposed beds of the Centinel Forma-
tion are about 16 m of medium cross-stratified sand-
stones with pelitic layers bounding the fore-sets. At
the base of some ol the sets there are thin layers of con-
glomerates and coarse sandstones. These beds carry
Ophiomorpha isp. Intercalated among them are medium
to fine sandstones and heterolithic beds.
The overlying 26 m are covered, probably because
they include loose hetherolithic facies that are easily
meteorized, as observed at other localities where the
unit is exposed such as Estancia La Siberia (Rodriguez-
Raising et al., 2006). The section continues upward with
24 m of mudstone and hetherolithic beds with medium-
to coarse-grained sandstone and subordinate conglo-
merates. The coarser facies carry a rich invertebrate
fauna and burrows referred to Thalasinoides isp. and
Ophiomorpha isp.
Overlying these beds are 4.5 m of coarse sandstone
and conglomerates with trough cross-stratification,
followed by 1.5 m of siltstone and 1.25 m of line to
medium muddy sandstone with abundant remains of
bivalves — including the studied mytilids. At the base ol
the sandstone there are bivalve burrows excavated into
the underlying mudstone. This bed carries Valdesia dalli
(Ihering, 1S97); Perissodonta ameghinoi (Ihering, 1897);
Polinices santacruzensis Ihering, 1907; Modiomytilus
argentinensis Griffin, 1990 (disarticulated and bio-
eroded); Gregariella sp.; Modiolus arctus (Feruglio,
1935); “ Ostrea ” liatcheri Ihering, 1902 (right valve);
Cardinal sp. (disarticulated); Tellinidae indet.; Retrotapes
striatolamellata (Ihering, 1907); Panopea hagualesia
Ihering, 1899 (in life position); Panopea nucleus (Ihering,
1899); Latemula sp. Some of the valves are lying convex
down with abundant bioerosion on their inner surface.
Specimens of Panopea in life position are common and
one articulated Latemula was observed.
The next 28 m are heterolithic beds with medium
sandstones with cross-stratification and constituting
cosets up to 5 m thick. Two sandstone beds carry bivalve
shells, some of them (Panopea sp.) in life position, echi-
noderms, gastropods, and —within the bed closest to the
top of the section — crab remains. The top of the section
includes heterolithic beds with leaves and plant debris.
The presence of Panopea in life position suggests that
the bed carrying most of the fossils was deposited in a
subtidal environment. Bioerosion and encrusting of the
shell inner surface suggest that they laid exposed on the
sea floor during a period of low sea level long enough to
allow colonization. The abundance of shells with differ-
ent degrees of weathering also suggests a period with
low sedimentation. According to these observations, the
mytilid-bearing bed was deposited during a low sedi-
mentation period in a subtidal normal marine environ-
ment. This could he linked to a maximum flooding
surface of the Patagonian transgression in the area.
Page 216
THE NAUTILUS, Vol. 125, No. 4
SYSTEMATIC PALEONTOLOGY
Superfamily Mytiloidea Rafinesque, 1815
Family Mytilidae Rafinesque, 1815
Subfamily Modiolinae Keen, 1958
Genus Modiomytilus Griffin, 1990
Type Species: Modiomytilus argentinensis Griffin,
1990; original designation.
Description: Shell modioliform, umbones not ter-
minal; well defined ridge running in a wide curve
from umbones to posterior ventral end; ligament
about one half of total length of shell; anterior part
contained within narrow, deep ligament groove run-
ning along dorsal margin of thickened hinge plate;
resilial ridge not preserved, but regular pits along
posterior part of nymphs suggest that it was pitted
(Figure 4); pits wider dorsally, ventrally narrowing,
and curving forward to join preceding ones into ante-
rior groove; obsolete posterior lateral tooth on right
valve and shallow groove on anterior hinge plate;
anterior adductor muscle scar (AAMS) large, placed
on low buttress, with anterior part encroached by
vertical wall of thick anterior part of shell (Figure 3);
vertical wall with well marked rounded pits and with
short strong irregular ribs near intersection with
AAMS, running perpendicular surface of latter; sur-
face of AAAIS with strong parallel ridges, reflecting
on prismatic layer the underlying ribs on inner shell
surface in this region; anterior retractor muscle scar
large and rounded, placed at dorsal posterior end of
buttress supporting AAMS (Figure 5); pallial line
strongly incised, irregularly pitted, meeting AAMS
(Figure 6); nacreous inner surface; ornamentation of
commarginal undulations (Figure 7).
Species Included: The type species Modiomytilus
argentinensis Griffin, 1990 comes from the early Mio-
cene Centinela Formation exposed along the southern
margin of Lake Argentino, in southwestern Santa Cruz.
The additional material described herein was collected
from rocks referable to this unit as exposed at Estancia
La Escondida approximately 40 kilometers north of Rio
Turbio. The oldest species recorded are the Eocene
Modiomytilus arcuatus (Stilwell and Zinsmeister, 1992)
from the La Meseta Formation in Antarctica (Stilwell
and Zinsmeister, 1992, p. 54-56, pi. 3 fig. a), and
Modiomytilus mercerati Griffin (1990: 380-38 1 , figs 3—4 ),
from the Rio Turbio Formation in southwestern Santa
Cruz. Modiomytilus pseudochorus (Doello-Jurado, 1922,
p. 3-6, fig. 1) is known only by the type specimens, which
come from the early Miocene Monte Leon Formation
exposed at the mouth ol the Santa Cruz River. No addi-
tional material lias ever been reported of this species.
Modiomytilus hauthali (Ihering, 1907) occurs in Ceno-
zoic beds exposed in northwestern Patagonia (Ihering,
1907), probably equivalent to the Monte Leon and
Centinela formations.
Remarks: Species of Modiomytilus could not be
included in any of the currently accepted supraspecific
taxa of Cenozoic Mytilidae. Mytilus Linnaeus (1758: 104)
has a proportionally much more reduced anterior adduc-
tor muscle scar and thinner shells; the external ornamen-
tation is smooth, while in Modiomytilus the shell surface
shows commarginal undulations. Aulacomya Moreh
(1853: 53) differs considerably by its radial ribs, its
lack of an anterior adductor muscle, and its unpitted
resilial ridge. Perna Retzius (1788: 20) show's — as does
Modiomytilus — a pitted resilial ridge and a nacreous
inner surface, but it is missing an anterior adductor mus-
cle scar. The Recent Mytella Soot-Ryen (1955: 47) shares
the pitted resilial ridge but the commarginal ornamenta-
tion of this genus is much weaker and regular. The south-
ern Pacific Notobotula Fleming, (1959: 170), has a quite
large muscle scar very much like that of Modiomytilus
but shows no evidence of the strong parallel ridges, and
it lacks commarginal ornamentation except for growth
lines. The Recent Semimytilus Soot-Ryen (1955: 25),
from the west coast of South America, differs by its com-
pact resilial ridge and smooth surface. The Oligocene-
Recent Crenomytilus Soot-Ryen (1955: 23), show's
a distinct thickened anterior adductor scar like in
Modiomytilus, but without the complexity of the scar
surface of the latter; it also presents terminal umbones, a
compact resilial ridge, and an obliquely striated shell that
is clearly different from Crenomytilus. Choromytilus
Soot-Ryen (1952: 121) is easily distinguishable because
ol its compact resilial ridge, the absence of an anterior
adductor muscle, its typical hinge tooth, and its smooth
surface.
Modiomytilus argentinensis Griffin, 1990
(Figures 2-7)
Modiomytilus argentinensis n. sp.; Griffin, 1990: 379-
380, figs. 1, 2
Description: Shells large (maximum estimated length =
154.5 mm), mytiliform, with subterminal anterior umbo-
nes. Dorsal margin convex and smoothly merging into
narrowly curved posterior margin. Ventral margin con-
cave, maximum concavity just in front of shell midlength.
Shell thickness very variable depending on area of shell.
Shell very thick at umbonal end, reaching 14.47 mm at
the posterior end of the AAMS). Shell thinning out in a
posterodorsal direction, measuring only a few' millime-
ters at posterodorsal end. Anterior margin strongly thick-
ened just below umbones; margin forming a narrow
marginal plate densely packed with growth lines,
reflecting the shell thickness at this sector of the valves.
Hinge without traces of dentition. Ligament running
along approximately 0.6 mm ol dorsal margin, which is
slightly thickened to hold resilial ridge. Anterior part of
preserved ligament groove narrow and curved along
anterior dorsal margin. Ligament groove occupying a
wider strip along margin towards posterior end, ending
abruptly and bounded by a faint ridge weakening even
further towards the dorsal margin, which it does not
S.F. Genta-Iturrena et al., 2011
Page 217
Figures 3-S. ModiomijUlus argentinensis. 3. Specimen witli conjoined valves (anterior end missing), showing remains of inner
layer of shell, MLP-23197. 4. Right valve internal view showing a general view of the anterior adductor muscle scar (AAMS) and-well
developed hinge plate, MLP-23190. 5. Detail of ligament showing marks of pitted resilial ridge along dorsal margin. Specimen
decorticated, MLP-23197. 6. Detail of the AAMS. Note subspherieal protuberance on AAMS surface. Also anterior vertical surface
and strong ridges beneath AAMS surface, MLP-23190. 7. Left valve internal view showing irregulary pitted pallial line, MLP-23182.
8. External mold of right valve showing commarginal folds (posterior half of shell), MLP-23205. Scale bars = 1 cm.
reach in any of the available specimens. Ligament groove
showing clearly pitted nature of resilial ridge at mid-
length, evident in specimens with shell material partly
adhered to internal molds, but not so in specimens in
which shell is missing, including the type specimens.
Area between resilial ridge and dorsal margin of shell
flat, but crossed by very shallow curved depressions
that begin at resilial ridge and widen towards margin
Page 218
THE NAUTILUS, Vol. 125, No. 4
(Figure 5). Internal surface ol shell generally smooth and
uot reflecting external ornamentation, but showing ante-
rior adductor muscle scars, anterior byssal retractor
scars, pallial line and granulations. AAMS placed near
anterior end, large (20.7 mm x 13.3 mm), buttressed
andand kidney-shaped, i.e., scar evenly rounded anteri-
orly and showing a fairly deep concavity at mid-length
posteriorly; anterodorsal half of AAMS more inflated,
posterior half slightly more elongated; AAMS bounded
anteriorly by steeply inclined inner surface of shell
(forming an angle of about 100°), acquiring again
an approximately horizontal position near margin, thus
rendering a reflected appearance to anterior inner
shell surface. Surface of AAMS not smooth, but
covered by straight anteroposteriorly directed rods,
subquadrangular in section and more densely packed
and thicker against anterior boundary of scar, tapering
towards posterior edge of AAMS. Vertical surface of shell
immediately adjacent to anterior outline of AAMS
densely reticulated. AAMS surface with a hemispherical
knob-like structure at mid-width and at base of anterior
half of scar. Muscle pad rapidly sloping down to general
shell surface behind posterior edge of AAMS, but not as
steeply as rising shell surface anterior to scar. Anterior
byssal retractor muscle scar large, rounded, placed just
above AAMS pad as it meets anterodorsal margin of
shell. Pallial line entire, strongly marked, and pitted
throughout its preserved length, especially along ventral
concave margin of shell. Posterior adductor muscle scars
unavailable for observation, because posterior region of
shell was not preserved in examined specimens. Outer
surface of shell strongly ornamented with commarginal
undulations. Intercostal spaces crossed by fine and
barely noticeable radial striations.
Geological Occurrence: All specimens come from
the upper section of the Centinela Formation exposed
at Estancia La Escondida, located about 20 km North of
the mining town of Rio Turbio, Santa Cruz Province
(51°24'21.76" S, 72°10'2.35" W).
Material Examined: MLP -23180: three RV internal
molds partly covered by shell matter; MLP-23182: two
left valve fragments with shell, showing pitted pallial
line; MLP-23186: two fragments of anterior end RV,
shell preserved, showing a pitted resilial ridge and ante-
rior adductor muscle scar; MLP-23190: three anterior
end fragments of RV, internal view,shell preserved,
showing anterior adductor muscle scar; MLP-23195: a
fragment of internal mold of LV, shell preserved on mar-
gins. MLP-23197: one specimen with valves conjoined
without the anterior end, showing remains of inner layer
of shell; MLP-23199: LV internal mold fragment with
preserved shell on ventral margin; MLP-23205: frag-
ment of external mold of RV, showing commarginal folds;
MLP-23212: fragment of anterior RV.
Remarks: The description provided above differs sub-
stantially from the original description of this species and
consequently from the original generic description, as all
previously known specimens consisted of only internal
and composite molds in which many characters now
available were not observed. Thus, a new interpretation
of this taxon strengthens the taxonomic placement
suggested for other species in which the shell still
remains unknown. The muscle scar appears as a strong
pad, more or less oval in outline. Width of pad is about
50% of length. However, the new specimens described
herein show a number of distinct peculiarities of this
muscle scar that cannot be observed in any of the molds
previously available. Among these are the numerous ver-
tical striations on the shell surface that bound the muscle
scar anteriorly. These striations are a conspicuous feature
of the shells, but are not preserved on the molds.
Comparison of this species with the other species
referred to this genus must necessarily be tentative, until
specimens of the latter are found with preserved shells.
However, the original comparisons of Modiomytilus
argentinensis with Modiomytilus mercerati are con-
firmed by the new material described herein. The type
series of M. argentinensis are all composite molds show-
ing no traces of shell. Nevertheless, the size and shape of
the anterior adductor muscle scars agree perfectly with
those in the new shells from Estancia La Escondida. The
shell interior of these appears to be smooth (except for
the muscle scars and granulated texture on some areas).
On the composite molds, this surface is superimposed
onto the outer shell ornamentation, which shows the
same wavy and anastomosing pattern as the shells newly
described herein.
Similarly, all known specimens of Modiomytilus
mercerati , Griffin, 1990 are composite molds. While the
ornamentation in these specimens is also very similar to
that of the type species, the shells appear to be consider-
ably more inflated and the anterior adductor muscle scar
is slightly smaller. These differences are confirmed by
the new specimens described herein, in spite of the fact
that none of them have a complete shell preserved. Yet,
the internal molds in the new specimens, while missing
the external ornamentation, show similar shell inflation
to that of M. argentinensis, and are never as inflated as
the molds of M. mercerati.
All known specimens of M. pseudochorus (Doello
Jurado, L922) are internal molds missing any trace of
shell. However, these molds also show' the large anterior
adductor muscle scar and an outline and shape similar to
those of the new specimens of the type species described
herein. Modiomytilus hauthali (Ihering) from northwest-
ern Clmbut, exhibit a similar shell shape, although they
appear to be slightly more elongate. The outer shell
ornamentation is similar to that of the type species.
Unfortunately, no interiors are well-enough preserved
to show details of the muscle scars.
Biogeography: The geographic and stratigraphic
ranges of the species included in Modiomytilus suggest
that it originated in the Southern realm during the Paleo-
gene, being restricted to shallow marine environments of
Antarctica and along the Atlantic coast of Patagonia. The
S.F. Genta-Iturrerfa et al., 201 1
Page 219
earliest species of Modiomytilus appears to have been
Mijtilosootus arcuatus Stilwell and Zinsmeister, from the
La Meseta Formation in Seymour Island (Antarctica).
While incompletely preserved, the shells fit well in
Modiomytilus . Very little is known about the Antarctic
species as the internal molds have not preserved much of
the internal shell features; however, they do show the
unique large anterior adductor muscle scars. The La
Meseta Formation was deposited during the late early
Eocene (Stilwell and Zinsmeister, 1992), slightly earlier
than the Rio Turbio Formation, the age of which ranges
from middle Eocene to early late Eocene (Malumian and
Carames, 1997). Mytilids in general have planktotrophic
larvae and therefore show considerable dispersal poten-
tial. In addition, their byssate life habits also add to this
capability, as they may raft across considerable distances
attached — in the southern hemisphere — to kelp or
driftwood (Fraser et ah, 2010). Postlarval dispersal may
be also possible by means of byssal threads (Sigurdsson
et ah, 1976; Baker, 1997). The Cenozoic fossil record in
Antarctica is restricted to the Antarctic Peninsula and
McMurdo Sound (GSA, Stilwell and Feldmann, 2000).
It appears that Antarctic-South American dispersal likely
took place during the early Cenozoic, as the Circum
Antarctic Current had not been yet fully established, al-
though surface water may have circulated to some extent
in a West-East direction. This would have enabled the
dispersal of other members of the Cenozoic faunas
which are known to occur in high latitudes during the
Paleogene, but appear in younger rocks in South Amer-
ica (Mancenido and Griffin, 19S8; Ben et al., 1997;
Casadio et al, 2010)
LITERATURE CITED
Baker, P. and R. Mann. 1997. The postlarval phase of bivalve
mollusks: a review of functional ecology and new records
of postlarval drifting of Chesapeake Bay bivalves. Bulletin
of Marine Science 61: 409-430.
Ben, A.G., M. Griffin, and P.A. Maxwell. 1997. Opening
of Drake Passage gateway and Late Miocene to Pleisto-
cene cooling reflected in Southern Ocean molluscan
dispersal: evidence from New Zealand and Argentina.
Tectonophysics 281: 83-97.
Casadio, S., G. Guerstein, S. Marenssi, S. Santillana, R.M.
Feldmann, A. Parras, and C. Montalvo. 2000. Evidencias
para una edad oligocena de la Formaeion Centinela,
suroeste de Santa Cruz, Argentina. Resumenes de
la Reunion Anual de Comunicaciones de la APA,
Ameghiniana 37(4):71 R
Casadio, S., C. Nelson, P. Taylor, M. Griffin, and D. Gordon,
2010. West Antarctic Rift system: A possible New Zealand
Patagonia Oligocene paleobiogeographic link. Ameghiniana
47: 129-132. 1
Doello-Jurado, M. 1922. Un nuevo “Mytilus" fosil del Terciario
de Patagonia. Anales de la Soeiedad Cientifica Argentina
94: 86-90.
Fleming, C.A. 1959. Notes on NewZeland Recent and Tertiary
mussels (Mytilidae). Transaction of the Royal Society of
New Zealand 87:165-178.
Feruglio, E. 1935. Relaciones estratigraficas y faunisticas entre
los estratos cretacicos y terciarios en la region austral del
Lago Argentino y en la del Golfo San Jorge (Patagonia).
Boletin de Informaciones Petroleras 128: 69-93; 130:
65-100.
Ferussac, A.E. de. 1822. Tableaux systematiques des animaux
mollusques classes en families naturelles, .... Bertrand/
Sowerby, Paris/Londres, 111 pp.
Fraser, C.I., R. Nikula, and J.M. Waters. 2010. Oceanic rafting
by a coastal community. Proceedings of the Royal Society,
B, 278: 649-655 (Biological Sciences), [doi: 10.1098/
rspb. 2010.1 1 17]. (Paris and London).
Furque, G. and H.H. Camacho. 1972. El Cretaeieo Superior y
Terciario de la region Austral del lago Argentino
(Provincia de Santa Cruz). Aetas 4° Jornadas Geologicas
Argentina, Buenos Aires, 3: 61-75.
Griffin, M. 1990. Modiomytilus , a new mytilid bivalve from the
Tertiary of Southern Patagonia Journal of Paleontology
64: 377-382.
Ihering von, H. 1897. Os Molluscos dos terrenos terciarios da
Patagonia. Revista do Museo Paulista 2: 217-382.
Ihering von, H. 1899. Die Conchylien der patagonischen For-
mation. Neues Jahrbuch fur Mineralogie, Geologie und
Palaontologie, 1899: 1 — 46.
Ihering von. If. 1902. Ilistoria de las ostras argentinas. Anales
del Museo National de Buenos Aires 7: 109-123.
Ihering, If. von. 1907. Les mollusques fossils du Tertiari et du
Cretace superieur de f Argentine. Anales del Museo
Nacional de Buenos Aires 3(7), 6] 1 pp.
Iredale, T. 1939. Great Barrier Reef Expedition 1928-1929.
British Musuem (Natural History), Science Reports, vol.
5, no. 6 (Mollusea, pt 1), pp. 209-425.
Keen, A.M. 1958. Marine Shells of Tropical West America.
Stanford University Press, 624 pp.
Linnaeus, C. 1758. Systema Naturae. Edition 10, Vol. 1.
Ilolmiae, 823pp.
Malumian, N. and A. Carames. 1997. Upper Campanian-
Paleogene from the Rio Turbio coal measures in southern
Argentina: micropaleontology and the Paleocene/Eocene
boundary. Journal of South American Earth Sciences 10:
189-201'.
Malumian, N.. J.L. Panza, C. Parisi, C. Nafiez, A. Carames, and
E. Torre. 2000. Hoja Geologica 5172-III-Yacimiento Rio
Turbio, provincia Santa Cruz, 1:250.000. Boletin del
Servieio Geologico Minero Argentino 247: 108 pp.
Mancenido, M.O. and M. Griffin, 1988. Distribution and
palaeoenvironmental significance of the genus
Boucliardia (Brachiopoda, Terebratelhdina): its bearing
on the Cenozoic Evolution of South Atlantic. Revista
Brasileira de Geociencias 18: 201-211.
Marenssi, S.A., S. Casadio, and S.N. Santillana. 2002. La
Formaeion Alan Aike al sur de El Calafate (Provincia de
Santa Cruz) y su relation con la discordancia del Eoceno
medio en la cuenca Austral. Revista de la Asociacion
Geologica Argentina 57: 341—344.
Marenssi, S. A., C.O. Limarino, A. Tripaldi, and L.l. Net. 2005.
Fluvial systems variations in the Rio Leona Formation:
Tectonic and eustatic controls on the Oligocene evolution
of the Austral (Magallanes) Basin, southernmost Argen-
tina. Journal of South American Earth Sciences 19: 359—
372.
Morch, O.A.L. 1853. Catalogus Conehyliorum. Catalogus
conehyliorum quae reliquit D. Alphonso d’Aguirra et
Gadea, Comes de Yoldi, regis Daniae cubiculariorum
Page
220
THE NAUTILUS, Vol. 125, No. 4
prineeps, ordinis Danebrogici in prima classe et ordinis
tertii eques. Fasciculus secundus, Acephala. Copenhagen,
74 pp.
Rafmesque, C.S. 1815. Analise de la Nature, ou. Tableau de
l’Univers et des Corps Organises. Palermo, 224pp.
Retzius, A.J. 1788. Dissertatio Historico-Naturalis Nova
Testaceaorum Genera. IV. Lundae. 23 pp.
Rodriguez- Raising, M., S. Casadio, and M. Griffin. 2006. Taph-
onomic and paleoenvironmental features of an Eocene
oyster reef in the Rio Turbio Formation, Patagonia,
Argentina. 9° Congreso Argentino de Paleontologia y
Bioestratigrafia, Resrimenes, p. 267.
Sigurdsson, J.B., C.W. Titman, and PA. Davies. 1976. The
dispersal of young post-larval bivalve molluscs by byssus
threads. Nature 262: 386- 387.
Soot-Ryen, T. 1952. Choromytilus, a new genus in the
Mytilidae. Revista de la Sociedad Malacologica “Carlos
de la Torre” 8: 121-122.
Soot-Ryen, T. 1955. A Report on the family Mytilidae
(Peleeypoda). Alan Hancock Pacific expedition, Vvol. 20,
no. 1, 175pp.
Stilwell, J.D. and R.M. Fedmann. (Eds.). 2000. Paleobiology
and paleoenvironment of Eocene rocks, McMurdo Sound,
East Antarctica. American Geophysical Union, Antarctic
Research Series 76, 372 pp.
Stilwell, J.D. and W.J. Zinsmeister. 1992. Molluscan system-
atic^ and biostratigraphy, Lower Tertiary La Meseta
Formation, Seymour Island, Antarctic Peninsula. Ameri-
can Geophysical Union, Antarctic Research Series, 55,
192 pp.
THE NAUTILUS 125(4):221-227, 201 1
Page 221
Contribution to the biology and ecology of the spongivorous snail
Cerithiopsis g reenii (Gastropoda: Cerithiopsidae) in New
England, USA
Linsey E. Haram
James T. Carlton1
Maritime Studies Program
Williams College - Mystic Seaport
P. O. Box 6000
75 Greenmanville Avenue
Mystic, CT 06355 USA
ABSTRACT
Cerithiopsis g reenii (C. B. Adams, 1839) is a common inter-
tidal snail on rocky shores in southern New England in the
summer and fall, and is also found in estuarine fouling com-
munities. It feeds on the sponge Halichondria bowerhanki and
in the laboratory also fed upon the sponge Clathria prolifera.
Halichondria bowerhanki has expanded north of Cape Cod,
Massachusetts, since the 1950s; we predict that, in concert
with both warming trends and with prey expansion,
Cerithiopsis has already moved, or will move, into northern
New England.
Additional keywords: Cerithiopsis , spongivory, Halichondria ,
Haliclona , Chalinula , Clathria , climate change
INTRODUCTION
Many marine organisms, including invertebrates, fishes,
and turtles, eat sponges either as specialized predators or
opportunistic grazers (McClintock et al., 2005; Peters
et ah, 2009; Todt et ah, 2009). Marine snails, ranging
from limpets and pleurotomariids to opisthobranchs, are
especially well-known sponge predators (Strong and
Harasweych, 1999; Recerro et ah, 2003; McDonald,
2007). Among shelled marine snails, species in the
globally-occurring hypsogastropod family Cerithiopsidae
are widely- recognized as spongivores (for example,
Fretter, 1951, and Marshall, 1978, who reviews anecdotal
records from England, Alaska, California, Australia, and
New Zealand), although actual observations of predation
have been made for only a few species in the family.
Two species of Cerithiopsis occur along the New
England coast of the United States (Emerson and
Jacobson, 1976; Rosenberg, 2009). The most common
of these is Cerithiopsis g reenii (occasionally misspelled
1 Author for Correspondence: [email protected]
g reenei and often misspelled g reeni), described in
Cerithium by C. B. Adams in 1839 from Dartmouth
harbor, Massachusetts, in Buzzards Ray, in southern
New England. Adams (1839) noted that it was “found
clinging to marine plants, a few feet below low water
mark, in company with Cerithium reticulation, Totten,
and Cerithium nigrocinctum , Nob." The latter two spe-
cies are now known as Bittiolum alternation (Say, 1822)
and Marshallora nigrocincta (C. B. Adams, 1839).
Although Emerson and Jacobson (1976) stated that this
species was named after Jacob Green, an American nat-
uralist, this is in error; it was named for Thomas A.
Greene of New Bedford, MA (Adams, 1839: 288), author
of an often-overlooked early checklist ol the marine
shells of the state (Greene, 1833).
Cerithiopsis g reenii is a small snail, the height of adult
shells reported between 3 and 5 mm (Moore, 1961; Emer-
son and Jacobson, 1976; Andrews, 1981), although Pollock
(1998) gave a size of 6 mm without noting a source. The
shell of Cerithiopsis green'd is glossy-brown (amber glass) in
color, with each post-nuclear whorl bearing three beaded
spiral cords. The uppermost cord of each whorl, consisting
of the smallest beads, may also form a black spiral band.
The published range of C. g reenii is large, from the
Gulf of St. Lawrence in Canada to Argentina (Bousfield,
I960; Farinati, 1994). However, as is typical of a number
of marine invertebrates (Whiteaves, 1901), the Gull of St.
Lawrence populations (Winkley, 1888; Bousfield, 1960)
are disjunct from the main populations of C. g reenii,
which are reported from southern Cape Cod and south
(Table 1). Although historically recorded from the Gulf of
Maine (Stimpson, 1851 : Boston Harbor), it is not reported
in modern times from northern New England (Wagner,
1979; Bromley, 1979; Trott, 2004, the latter summarizing
historical records rather than recent surveys), leading us
to suspect that the mid-nineteenth century Boston record
may have been based upon specimens transported north,
as discussed below. We comment below on its potential
range north of Cape Cod.
Records of “Cerithiopsis greenii” in the southeastern
United States and the Gulf of Mexico (Table I, and
Singley, 1893; Maury, 1922) include similar-looking sib-
ling species (Rolan and Espinosa, 1995; Rolan et ah,
2007, Lee, 2009). Cerithiopsis greenii sensu stricto may
occur south to Florida (for example, Krisberg, 2009), but
this requires confirmation (II. G. Lee, personal commu-
nication, September 2010). In more southern waters -
Bermuda, the Caribbean, Cuba, Mexico, Costa Rica,
Panama, Venezuela, and then south to Brazil, Uruguay,
and Argentina, all of which are locations where C.
greenii has been recorded (Verrill and Smith, 1873;
Olsson and McGinty, 1958; Houbrick, 1968; Jensen and
Clark, 1986; Figueiras and Broggi, 1988; Britton and
Morton, 1989; Garcfa-Cubas and Reguero, 1990;
Farinati, 1994; Rodriguez et ah, 2003; Clavijo et ah,
2005; Jensen and Pearse, 2009) - a similar species com-
plex is involved (Rolan and Espinosa, 1995; Rolan et ah,
2007). However, this species complex may not include
the North American C. greenii. Molecular work may be
required to resolve the distribution of the C. greenii-
group in lower latitudes as well as in temperate South
America.
Cerithiopsis greenii has been reported from a wide
range of habitats. We summarize these in Table 1 (we
include all records that we have found, including those in
warmer waters that may well represent sibling species).
Sponges are reported in only one case, but it is probable
that sponges were either present and not recorded, were
nearby, or the records represent dead shells. Rosenberg
(2009) notes that while C. greenii is reported to 75
meters, living populations of C. greenii may occur only
as deep as 15 meters. These small shells can drift both
offshore and to shallower allochthonous habitats, and
their planktotrophic larvae may be carried far afield as
well (Jung [1975] and Thiriot-Quievreux [1980] report
larval shells from the Cariaco Basin off the north coast
of eastern Venezuela, although, as noted above, records
of C. greenii from this region may represent one or more
other species). A number of authors have recorded this
snail alive from both marine and estuarine (brackish)
waters, as we do here.
While a meticulous work on the mollusks of the Long
Island Sound region (Long Island Shell Club, 1988)
reported Cerithiopsis greenii as “uncommon to rare”
(based upon the occurrence of beach drift shells) and
while we have found few modern-day records of this
species in New England, we report here that it is a com-
mon intertidal snail in the summer and fall on the rocky
shores of Rhode Island, and that it occurs in the Mystic
River Estuary (Mystic, Connecticut) in vessel and other
fouling communities. In the first report ol its feeding
L. E. Haram and J.T. Carlton, 2011
Page 223
biology, we detail its predation upon the sponges
Halichondria bowerbanki Burton, 1930 and Clathria
prolifera (Ellis and Solander, 1786).
MATERIALS AND METHODS
Cerithiopsis greenii were collected from the edges of
colonies of the yellow sponge Halichondria bowerbanki,
in October and November 2008, from the underside
of rocks in the low intertidal zone at Weekapaug
Point, Westerly, Rhode Island. Also in November 2008,
C. greenii were collected from a fouling community with
yellow Halichondria bowerbanki on the hull of the
Charles W. Morgan at Mystic Seaport Museum in the
Mystic River Estuary, Mystic; the Morgan is an exhibit
vessel and does not leave the estuary. Temperature and
salinity data were collected at all stations.
In the laboratory, snails were maintained in 65 x 57
mm “tea ball" (tea strainer) plastic containers (mesh size
200 pm) in flowing aquaria at 12°C and 28-30°/oo. The
snails were starved for 10 days prior to observational and
experimental feeding studies.
Sponges for experimental use included Halichondria
bowerbanki (yellow and green colonies) from intertidal
rocks at Weekapaug Point and from Mystic River
subtidal dockside fouling racks, Chalinula loosanoffi
(Hartman, 1958) (= Haliclona loosanoffi), Cliona sp.,
Clathria prolifera (= Microciona prolifera), and
Halichondria bowerbanki (orange colonies, which occur
on the same racks with yellow colonies in the estuary).
We used yellow, orange, and green (which contain zoo-
xanthellae; Hartman, 1958) morphs of Halichondria to
determine whether the apparent restriction of C. greenii
to yellow Halichondria in the field was due to feeding
preference or was a sampling artifact.
Sponges were kept in a temperature-controlled aer-
ated incubator chamber at 5°C in 28-30°/oo water for
24 hours before use. Sponges were identified using the
diagnostic characters of Hartman (1958); sponge nomen-
clature follows that of the World Porifera Database
(http://www.marinespecies.org/porifera/, accessed Sep-
tember 2010).
In the laboratory detailed observations of predation
by C. greeni on sponges were made, and feeding was
recorded through still and video photography, using
a Motie Digital Microscope (DM 143, NTSC system)
supported by Motie Images Plus software, Version 2.0.
To observe feeding behavior, C. greenii were placed in
60 x 15 mm plastic Petri dishes in seawater at room
temperature (21°C) with 2 mm" pieces of H. bowerbanki
(yellow colonies from Weekapaug) for 3 to 4 days. The
dish was later searched for fecal pellets that might fur-
ther demonstrate prey consumption. Fecal pellets were
examined under the compound microscope at 400 x for
the presence of spongin tissue and spicules.
Choice experiments similar to those performed by
Becerro et al. (2003) were used to determine prey pref-
erence. Four snails (two from Weekapaug, and two from
Mystic) were each offered 2 mm2 pieces of six different
sponge colonies, for a total of 4 controls and 20 treat-
ments as follows: H. bowerbanki (Weekapaug, green col-
onies; yellow colonies from Weekapaug served as the
control because Cerithiopsis is commonly associated
with these in the field). It. bowerbanki (Mystic, orange
colonies), Chalinula loosanoffi, Cliona sp., and Clathria
prolifera. The snails were placed in separate 60 x 15 mm
plastic Petri dishes with seawater; these trials were also
conducted at room temperature (21° C). Observations
were made for 10 minutes in order to establish if initial
contact by a snail with the sponge would induce a feed-
ing response (defined as proboscis moving and probing
in a pumping fashion in order to scrape sponge tissue);
if it did, snail behavior and prey consumption were
recorded.
A separate experiment was conducted to examine
potential predation given longer periods of prey avail-
ability. Twelve 2 mm" fragments of Clathria prolifera
were placed in separate 60 x 15 mm Petri dishes filled
with sea water and held at room temperature (21° C). A
single snail was placed directly on top of each sponge
fragment. Because C. prolifera tissue is red, we hypoth-
esized that a snail which consumed the sponge tissue
might produce red fecal pellets. At 24 and 48 hours the
presence or absence, and color, ol fecal pellets were
recorded. At the end of the first 24 hour interval the few
snails which had departed the sponge were placed back
on the sponge fragments.
RESULTS
Our largest specimens of Cerithiopsis greenii from
Weekapaug Point were 5.0 mm in height; our largest
specimen from the Mystic River Estuary was 3.49 mm.
The body is translucent-white, and, when extended
across its sponge prey, can appear almost transparent
against the spongin and spicules of Halichondria. A
pedal gland on the posterior lobe of the foot produces
mucus (Fretter, 1951), which then runs along the lobe’s
longitudinal furrow; the mucus assists the snail’s locomo-
tion (for example, we observed Cerithiopsis gliding on
surface water tension in the laboratory), and may also
play a role in securing the snail to its sponge prey, as
noted by Fretter (1951) for Cerithiopsis tubercidaris
(Montagu, 1803) in England.
Habitat and Phenology: Cerithiopsis greenii was found
in two habitats: the rocky intertidal of Rhode Island
and subtidal fouling communities in Connecticut. At
Weekapaug Point, Rhode Island, the snails were found
under rocks in the low intertidal zone, alone or in
pairs, exclusively associated with the yellow sponge
Halichondria bowerbanki . Sponge colonies in October
were commonly 10 cm in width, but by late November
were 3 to 5 cm in width, with winter regression having
commenced; concomitantly, snail abundance declined.
In the Mystic River, Connecticut, other sponges occur-
ring with yellow Halichondria bowerbanki include
Page 224
THE NAUTILUS, Vol. 125, No. 4
orange-colored H. bowerbanki , Chalinula loosanoffi,
Clathria prolifera, and Cliona sp. Cerithiopsis green i i
was found only on yellow Halichondria.
Although the undersurfaces of rocks at Weekapaug
Point are covered with an encrusting fauna, including
the bryozoans Schizoporella unicornis Johnston, 1874
and Cryptosula pallasiana (Moll, 1803), the ascidians
Botrylloides violaceus (Oka, 1927) and BotnjUus schlosseri
(Pallas, 1766), and the serpulid polychaetes Hijdroides
dianthus (A. E. Verrill, 1873) and Circeis spirillum
(Linnaeus, 1758), no C. greenii were found associated
with these other species. Other gastropods found near
C. greenii under rocks included Astyris lunata
(Say, 1826), Costoanachis translirata (Ravenel, 1861),
Costoanachis avara (Say, 1822), Lacuna vincta (Montagu,
1803), and Littorina littorea (Linnaeus, 1758).
On the Rhode Island rocky shore temperatures ranged
from 14.5° to 6°C in October and November 2008, and
salinities were approximately 30°/oo. In the Mystic River
in November 2008 snails were found in water of 10.9°C
and a salinity of 26.9°/00.
Feeding Biology We observed Cerithiopsis greenii
feeding readily upon yellow Halichondria bowerbanki
collected from both Rhode Island and Connecticut;
unlike Fretters (1951) report that she found C.
tubercularis “reluctant to feed in captivity,” such was
not the case with C. greenii. Within minutes of initial
contact with H. bowerbanki , C. greenii commenced
feeding. In contrast, the other species of sponges
presented to this snail elicited a distinctly different be-
havior: the anterior portion of the snail’s foot would flail
upon initial contact with non -Halichondria sponges, rap-
idly rising off the sponge, and no direct feeding was
observed (but see below).
When feeding upon H. bowerbanki the extension of
the snail’s proboscis into the spongin was clearly visible
(Figure 1). Feeding bouts during which C. greenii
Figure 1. Cerithiopsis greenii feeding on the sponge
Halichondria bowerbanki. The snail’s proboscis is extended
into the sponge tissue.
consumed sponge tissue lasted for up to 15 minutes,
and occasionally somewhat longer. Proboscis movement
alternated between rasping the spongin with a grating
motion, and sucking loose tissue into the mouth with a
strong pumping motion; tissue could be clearly seen
entering through the proboscis. When viewed from
above snails can appear to be almost motionless although
feeding actively. Translucent yellow fecal pellets, approx-
imately 200-300 pm in length, were found in the dishes
with snails that were observed feeding. Pellets contained
spongin only; no spicules were found therein.
After 24 hours in dishes with the red sponge Clathria
prolifera, 3 (of 12 trial snails) had produced red fecal
pellets, and after 48 hours, 7 (of 12) snails had produced
red pellets, suggesting consumption of the red-colored
spongin tissue of this sponge. In addition, one Mystic
River snail was observed, in the 10-minute feeding
bouts, to briefly consume green H. bowerbanki from
Weekapaug.
DISCUSSION
We provide the first observations of the native North-
western Atlantic snail Cerithiopsis greenii feeding upon
the sponge Halichondria bowerbanki. While it has been
proposed that H. bowerbanki is either introduced or
cryptogenic in New England (Pederson et ah, 2005;
Connecticut Sea Grant 2010), the apparent feeding pref-
erence of C. greenii for this sponge, and its common
association with Halichondria in the field, suggest that
the sponge, too, may be native, in agreement with the
conclusions of Vethaak et al. (1982).
Our observations that Cerithiopsis can also feed on
the native sponge Clathria prolifera in the laboratory
suggests, however, a potentially broader dietary range
that may come into play when Halichondria is less avail-
able, or not available, as a food resource. In general, we
observed predation in the laboratory only on yellow
Halicho)}dria and not on other color morphs, with a
single exception of one snail that led briefly on a green
colony. More work needs to be undertaken relative to the
presence of C. greenii in the field on the range of color
morphologies of Halichondria (Hartman, 1958) and the
ability of this snail to utilize non-yellow colonies.
The presence of Cerithiopsis in the Gulf of St. Law-
rence since at least the 1880s (Winkley, 1888), well north
of the known range of Halichondria bowerbanki at that
time, suggests that some populations may rely on other
prey species. Halichondria panicea occurs in the Gull of
St. Lawrence (Whiteaves, 1901), and may function as
an alternative prey, although we note that this species
also occurs in the Gulf of Maine (Hartman, 1958), where
Cerithiopsis has not been reported (save for one 1850s
Boston record, noted above and discussed below).
Mitchell (1999) reports Halichondria bowerbanki from
Northumberland Strait in the Gulf of St. Lawrence,
based upon collections in the 1990s, and it is not impos-
sible that it was historically present (as are a number ol
L. E. Haram and J.T. Carlton, 2011
Page 225
otherwise-southern taxa in the southern Gulf of St. Law-
rence, as noted earlier) but long overlooked.
Our observations are in agreement with those of
Fretter (1951), who reported the European Cerithiopsis
tubercularis feeding on the sponge Hyrneniacidon
sanguined (Grant, 1826) [now known as Hyrneniacidon
perlevis (Montagu, 1818)] in England, and of Collin
(2004), who observed Cerithiopsis gemmulosum (C. B.
Adams, 1850) feeding on the sponge Halichondria
melanadocia de Laubenfels, 1936 in Panama. Fretter
and Graham (1962) later expanded the prey diversity of
C. tubercularis to also include Halichondria sp. and
Grantia sp., and noted that another British species,
Cerithiopsis barleei Jeffreys, 1867 fed on Suberites
domuncula (Olivi, 1792). In the Northeastern Pacific,
Cerithiopsis stejnegeri Dali, 1884 has been observed
feeding on the edges of the sponge Hyrneniacidon
ungodon de Laubenfels, 1932 in the rocky intertidal of
Oregon (J. T. Carlton, unpublished). Through gut con-
tent analysis and direct observation of feeding, Fretter
(1951) found that C. tubercularis used spongin for food
and reviewed earlier observations that C. tubercularis
deposited its eggs in sponge tissue, as does C.
gemmulosum in Panama (Collin, 2004, who further dem-
onstrated that snail larvae metamorphose when exposed
to sponge tissue).
Halichondria becomes dormant (degenerates) in the
winter (Hartman, 1958; Fell et ak, 1984), which our obser-
vations along the Bhode Island rocky shore further con-
firm. Where Cerithiopsis “over winters” is not known;
they are absent from the undersurface of rocks along
Connecticut and Rhode Island winter shores (J. T.
Carlton, L. Haram, personal observations). It is possible
that the snails embed themselves into the gravel-shell
base underneath rocks in the intertidal, as does the snail
Littorina littorea , which bury themselves along boulder
edges in winter (J. T. Carlton, field observations). The
discovery of C. green ii in a hull fouling community on
the Charles W. Morgan (albeit a stationary vessel) is
reminiscent of Verrill and Smith’s (1873) report of it from
“wharf piles” (Table 1). That its occurrence in fouling
communities is likely not uncommon is indicated by our
finding it (2 January 1999) on Halichondria on experimen-
tal fouling panels at Noank (mouth of Mystic River) and
on Halichondria in float (pontoon) fouling at a marina in
the Mystic River (October 2010). We regard the few
reports of it from fouling communities as representing
under-sampling, or simply under-reporting, of small snails
in this habitat [the record of Cerithiopsis terebralis by
Hutchins (1952) from “buoy fouling” refers to another
cerithiopsid now known as Seila adamsii (H. C. Lea,
1845)]. Its widespread occurrence on oyster beds (Table 1,
Canada, New York, North Carolina, and perhaps Florida)
suggests that there are a number of potential human-
mediated dispersal vectors for this snail, including both
vessel fouling and the movement of commercial oysters,
and we suggest that the one-time report of C. greenii in
Boston in the 1850s is likely due to transport by ships or
oyster movements from southern waters.
Finally, we note that changing climatic conditions may
potentially play a role in the distribution of C. greenii. Its
host sponge, Halichondria bowerbanki was not known
north of Cape Cod prior to the 1950s (Sorte et ak, 2010;
J. T. Carlton, unpublished). Halichondria bowerbanki
spread north to the Bay of Fnndy by the 1970s, in con-
cert with a number of other southern taxa whose range
expansions appear to be linked to warming coastal con-
ditions (Sorte et ak, 2010). We predict that, with both
warming trends and with prey expansion, Cerithiopsis
greenii may have already moved, or will move, into
northern New England. In turn, in concert with pre-
dicted patterns of northward retreat of cooler-affinity
taxa (Carlton, 2000; Sorte et ak, 2010), the as yet uncer-
tain southern border of C. greenii may be now shifting
north as well.
ACKNOWLEDGMENTS
Our thanks to Lisa Gilbert, who asked what the tiny snail
under intertidal rocks at Weekapaug might be. We thank
Ryan Dillon and Rachel Rock-Blake for laboratory
assistance, and Rachel Lewis for field assistance. Harry
G. Lee kindly discussed with us the occurrence of this
species along the Florida coast, and Rob van Soest
generously provided a copy of Vethaak et ak (1982).
LITERATURE CITED
Adams, C.B. 1839. Observations on some species of the marine
shells of Massachusetts, with descriptions of five new spe-
cies. Boston Journal of Natural Histoiy 2: 262-288. http://
www.biodiversitylibrary.org/item/100573#page/264/mode/
lup (accessed June 2011)
Andrews, J. 1981. A field guide to shells of the Texas coast. Gulf
Publishing Co., Houston, 176 pp.
Balch, F. N. 1899. List of Marine Mollusca of Coldspring
Harbor, Long Island, with descriptions of one new genus
and two new species of nudibranchs. Proceedings of the
Boston Society of Natural History 29: 133-162.
Beeerro, M.A., X. Turon, M.J. Uriz, and J. Templado. 2003.
Can a sponge feeder be a herbivore? Tylodina perversa
(Gastropoda) feeding on Aphjsina aerophoba (Demo-
spongiae). Biological Journal of the Linnean Society 78:
4294.38.
Bousfield, E.L. 1960. Canadian Atlantic sea shells. National
Museum of Canada, Ottawa, 72 pp.
Britton, J.C. and B. Morton. 1989. Shore ecology of the Gulf
of Mexico. University of Texas Press, Austin, 387 pp.
Bromley, J.E.C. 1979. A preliminary checklist of marine fauna
of Minas Basin and Minas Channel. Proceedings of the
Nova Scotia Institute of Science 29: 517-541.
Carlton, J.T. 2000. Global change and biological invasions in
the oceans, pp. 31—53, in: H.A. Mooney and R.J. Hobbs,
eds.. Invasive Species in a Changing World. Island Press,
Covelo, California, 457 pp.
Clavijo, C., F. Scarabino, A. Rojas, and S. Martinez. 2005. Lista
sistematica de los Moluscos marinos y estuarinos del
Cuaternario de Uruguay. Comunicaciones de la Sociedad
Malaeologica del Uruguay 9: 381-41 1.
Page 226
THE NAUTILUS, Vol. 125, No. 4
Collin, R. 2004. Development of Cerithiopsis gemmulosum
(Gastropoda: Cerithiopsidae) from Bocas del Toro,
Panama. Caribbean Journal of Science 40: 192-197.
Connecticut Sea Grant. 2010. Invasive species ol Long Island
Sound, http://wvwv.seagrant.uconn.edu/whatwedo/ais/listo
ur.php (accessed September 2010)
Conrad, H.S. 1935. The plant associations of central Long
Island. A study in descriptive plant sociology. American
Midland Naturalist 16: 433-516.
Diaz-Merlano, J.M. and M.P. Hegedus. 1994. Moluscos del
Caribe Colombiano. Un Catalago Illustrado. Coleiencias y
Fundacion Natura Colombia, Santafe de Bogota, 291 pp.
Emerson, W. K. and M.K. Jacobson. 1976. The American
Museum of Natural History Guide to Shells. Land, Fresh-
water, and Marine, from Nova Scotia to Florida. Alfred A.
Knopf, New York, 482 pp.
Farinati, E.A. 1994. Mieromoluseos (Gastropoda y Bivalvia) del
Holoeeno del area de Bahia Blanca, Argentina. Ameghiniana
31: 303-315.
Fell, P.E., E.II. Parry, and A.M. Balsamo. 1984. The life histo-
ries of sponges in the Mystic and Thames estuaries (Con-
necticut), with emphasis on larval settlement and
postlarval reproduction. Journal of Experimental Marine
Biology and Ecology 78: 127-141.
Figueiras, A. and J. Broggi. 1988. Nuevas especies de
gastropodos marinos de la Formaeion Camacho (Mioceno
Superior) de Uruguay. II. Comunicaciones de la Sociedad
Malacologica del Uruguay 6: 341-354.
F letter, V. 1951. Observations on the life history and functional
morphology of Cerithiopsis tuhercularis (Montaug) and
Triphora perversa (L. ). Journal of the Marine Biological
Association of the United Kingdom 29: 567—573.
Fretter, V. and A. Graham. 1962. British Prosobranch Molluscs.
The Ray Society, London, 755 pp.
Garcia-Cubas, A. and M. Reguero. 1990. Moluscos del sistema
lagunar Tupileo-Ostion, Tabasco, Mexico: Sistematica y
ecologia. Anales del Instituto de Ciencias del Mar y
Limnologia, Universidad Naeional Autonomia de Mexico
17: 309-343.
Greene, T. A. 1833. V. Testacea or shells. List of the marine
shells of Massachusetts, pp. 554-557, in: E. Hitchcock
[ed.] Report on the geology, mineralogy, and botany of
Massachusetts. Commonwealth of Massachusetts,
Amherst, xii + 700 pp. http://www.biodiversitylibrary.org/
item/57015#page/570/mode/lup, (accessed June 201 1)
Hartman, W.D. 1958. Natural history of the marine sponges
of southern New England. Peabody Museum of Natural
History (Yale University), Bulletin 12, 155 pp.
Houbrick, R. S. 1968. A survey of the littoral marine mollusks of
the Caribbean coast of Costa Rica. The Veliger 11: 4—23.
Hutchins, L.W. 1952. Chapter 10, Species recorded from foul-
ing, pp. 165-207, in: Marine fouling and its prevention.
Woods Hole Oceanographic Institution. United States
Naval Institute, Annapolis, Maryland, 388 pp.
Jacobson, M.K. and W. K. Emerson. 1961. Shells of the New
York City area. Argonaut Books, Inc., Larchmont, New
York, 142 pp.
Jensen, R.H. and K. Clark. 1986. Class Gastropoda (snails,
limpets, and slugs), pp. 397-458, in: W. Sterrer and C.
Schoepfer-Sterrer, eds.. Marine fauna and flora of
Bermuda. John Wiley & Sons, New York, 742 pp.
Jensen, R. PI., and T. A. Pearce, 2009. Marine Mollusks
of Bermuda. Delaware Museum of Natural History,
Wilmington, x + 473 pp.
Jung, P. 1975. Quaternary larval gastropods from Leg 15, Site
147, Deep Sea Drilling Project. Preliminary Report. The
Veliger 18: 109-126.
Krisberg, M. 2009. Cerithiopsis g reenii (C. B. Adams, 1839).
http://zl4.invisionfree.com/Conchologist_Fomm/index.php?
showtopic=1875 (accessed September 2010).
Leathern, W. and D. Maurer. 1975. The distribution and
ecology of common marine and estuarine gastropods in
the Delaware Bay area. The Nautilus 89: 73-79.
Lee, H.G. 2009. Marine shells of northeast Florida. Jackson-
ville Shell Club, Inc., Jacksonville, Florida, 204 pp.
Long Island Shell Club. 1988. Seashells of Long Island,
New York. The Long Island Shell Club, Inc., LOC 87-
82009, 209 pp.
Marshall, B.A. 1978. Cerithiopsidae (Mollusca: Gastropoda) of
New Zealand, and a provisional classification of the family.
New Zealand Journal of Zoology 5: 47-120.
Maury, C.J. 1922. Recent Molluscs of the Gulf of Mexico and
Pleistocene and Pliocene species from the Gulf states.
Bulletin of American Paleontology 9: 119-126.
McClintock, J.B., C.D. Amsler, B.J. Baker, and R.W. M. van
Soest. 2005. Ecology of Antarctic marine sponges:
an overview. Integrative and Comparative Biology 45:
359-368.
McDonald, G.R. 2007. Sacoglossa and Nudibranehia, pp. 788-
807, in: J. T. Carlton, editor. The Light and Smith Manual:
Intertidal Invertebrates from Central California to
Oregon. Fourth Edition. University of California Press,
Berkeley, 1001 pp.
Mikkelsen, P. M., P. S. Mikkelsen, and D.J. Karlen. 1995.
Molluscan biodiversity in the Indian River Lagoon,
Florida. Marine Science 57: 94-127.
Mitchell, S. 1999. St. Georges Bay Ecosystem Project
(GBEP): Research Report III. A Review of Benthic
Fauna/CommunityStudies in Atlantic Canada and North-
eastern American Shallow Waters, http://www.mystfx.ca/
research/gbayesp/BF_lit_cited.htm (accessed September
2010).
Moore, D. R. 1961. The marine and brackish water Mollusca of
the State of Mississippi. Gulf Research Reports 1: 1-58.
Olsson, A. A. and T. L. McGinty. 1958. Recent marine mollusks
from the Caribbean coast of Panama with the description
of some new genera and species. Bulletins of American
Paleontology 39, no. 177, 58 pp.
Pederson, J., R. Bullock, J.T. Carlton, J. Dijkstra, N.
Dobroski, P. Dyrynda, R. Fisher, L. Harris, N. Hobbs,
G. Lambert, E. Lazo-Wasem, A. Mathieson, M.-P.
Miglietta, J. Smith, J. Smith III, and M. Tyrrell.
2005. Marine Invaders in the Northeast. Rapid assess-
ment survey of non-native and native marine species of
float dock communities, August 2003. MIT Sea Grant
College Program Publication No. 05-3, Cambridge
MA, 40 pp.
Peters, K. J , C.D. Amsler, J. B. McClintock, R.W. M. van Soest,
and B.J. Baker. 2009. Palatability and chemical defenses of
sponges from the western Antarctic Peninsula. Marine
Biology 385: 77-85.
Pollock, L.W. 1998. A practical guide to the marine animals of
Northeastern North America. Rutgers University Press,
New Brunswick, New Jersey, 367 pp.
Rodriguez S.L., R. Vargas, and J. Cortes. 2003. Biodiversidad
marina de Costa Rica: Gastropodos (Mollusca:
Gastropoda) de la costa Caribe. Revista de Biologia
Tropical 51 (Supplement 3): 305-399.
L.E. Haram and J.T. Carlton, 2011
Page 227
Rolan, E. and f. Espinosa. 1995. The family Cerithiopsidae
(Mollusca: Gastropoda) in Cuba. 3. The genus Cerithiopsis
s.L, species with brown shells. Iberus 13: 129-147.
Rolan, E., }. Espinosa, and R. Fernandez-Garces. 2007. The
family Cerithiopsidae (Mollusca:
Gastropoda) in Cuba. 4. The genus Cerithiopsis s.l., the
banded and variably-coloured species. Neptunea 6: 1-29.
Rosenberg, G. 2009. Malacolog 4.1.1: A Database of Western
Atlantic Marine Mollusca. [WWW database (version
4.1.1)] URL http://www.malacolog.org/ (accessed Febru-
ary 2011)
Singley, J.A. 1893. Contributions to the natural history of
Texas. Part I. Texas Mollusca. Geological Survey of Texas,
Fourth Annual Report, 1892, pp. 299-343.
Smith, S. 1859. Depth of molluscs of Peconic and Gardiner’s
Bays, Long Island, N.Y. American Journal of Science 27:
281-283.
Sorte, C.J.B., S.L. Williams, and J.T. Carlton. 2010. Marine
range shifts and species introductions: comparative spread
rates and community impacts. Global Ecology and Bioge-
ography 19: 303-316.
Stimpson, W. 1851. Shells of New England. A revision of the
synonymy of the testaceous mollusks of New England,
with notes on their structure, and their geographical
and bathymetrical distribution. Phillips, Sampson & Co.,
Roston, 56 pp.
Strong, E. and M.G. Harasewych. 1999. Anatomy of the
hadal limpet Macleaniella moskalevi (Gastropoda,
Cocculinoidea). Invertebrate Riology 118: 137-148.
Thiriot-Quievreux, C. 1980. Identification of some planktonic
prosobranch larvae present off Beaufort, North Carolina.
The Veliger 23: 1-9.
Todt, C., P. Cardenas, and H.T. Rapp. 2009. The chiton
Hanleija nagelfar (Polyplaeophora, Mollusca) and its asso-
ciation with sponges in the European North Atlantic.
Marine Biology Research 5: 408-411.
Trott, T. J. 2004. Cobseook Bay inventory: a historical checklist
of marine invertebrates spanning 162 years. Northeastern
Naturalist 11 (Special Issue 2): 261-324.
Verrill, A.E. and S.L Smith. 1873. Report on the invertebrate
animals of Vineyard Sound and adjacent waters. First
Annual Report, U. S. Commissioner Fish and Fisheries,
pp. 295-747.
Vethaak, A.D., R.J.A. Cronie, and R.W. M. van Soest. 1982.
Ecology and distribution of two sympatrie, closely related
sponge species, Halichondria panicea (Pallas, 1766) and
H. bowerbanki Burton, 1930 (Porifera, Demospongiae),
with remarks on their speciation. Bijdragen tot de
Dierkunde 52: 82-102.
Vokes, H.E. and E.H. Vokes. “1983” [1984]. Distribution
of shallow-water marine Mollusca, Yucatan Peninsula,
Mexico. Mesoamerican Ecology Institute, Monograph 1.
Middle American Research Institute, Publication 54,
Tulane University, New Orleans, 183 pp.
Wagner, F.J.E. 1979. Distribution of pelecypods and gastro-
pods in the Bay of Fundy and eastern Gulf of Maine.
Proceedings of the Nova Scotia Institute of Science 29:
447-464.
Wells, H.W 1961. The fauna of oyster beds, with special refer-
ence to the salinity factor. Ecological Monographs 31:
239-266.
Whiteaves, J.F. 1901. Catalogue of the marine invertebrates of
Eastern Canada. Geological Survey of Canada, Ottawa,
272 pp.
Winkley, II. W. 1888. Molluscs found in the oyster beds
of Coeagne, N.B., Bedeque and Summerside, PE. I. Bul-
letin of the Natural Histoiy Society of New Brunswick
7: 69-71.
THE NAUTILUS 125(4) :228-233, 201 1
Page 228
Albert R. Mead, 1915-2009, noted American malacologist:
An obituary
A.C. van Bruggen
Netherlands Centre for Biodiversity/National Museum of
Natural History P.O. Box 9517
2300 BA Leiden, THE NETHERLANDS
[email protected]
[email protected]
J.I. Mead
Department of Geosciences
100 CR Drive
East Tennessee State University, Box 70357
Johnson City, TN 37614 USA
[email protected]
INTRODUCTION
Tl le noted American malacologist Albert Raymond Mead
(Figures 1-3) died in Tucson, Arizona, on 13 March
2009. An obituary is presented here by a foreign col-
league, friend and admirer, and Al Meads son, in order
to sketch a more complete picture beyond that published
in various short obituary notices (e.g.. Anonymous,
2009a-c; Bruggen, 2009; also in local newspapers).
Al, as he was affectionally known, was born on 17 July
1915 in San Jose, California. He earned his B.Sc. in
entomology in 1938 at the University of California at
Berkeley. From 1938 to 1940, Mead was at Cornell Uni-
versity (Ithaca, New York) where he was a Schaife
Scholar and a John Henry Comstock Scholar in entomol-
ogy. In 1940-1941, he was a graduate teaching assistant
at the College of Agriculture at Davis (which, in 1959,
became the University of California at Davis) and
worked at the Marine Biological Laboratory, Woods
Hole, Massachusetts. Returning to Cornell University,
Mead earned his Ph.D. in 1942. While at Davis, he met
a fellow student who became the love of his life, Eleanor
Morrow; they married on 8 February 1942, a marriage
that lasted 67 years until Als death.
In 1942, Mead entered the U.S. Army as a 2nd Lieu-
tenant in the Medical Administration Corps and
progressed to the rank of Captain. From 1943 to 1945,
he was Parasitologist for the Western African Service
Command (Inter-Allied Malaria Control Unit) in the
Gold Coast (now Ghana, West Africa) where he was
introduced to, and fascinated by, the study of the
Achatinidae, the giant African snails. During his stay in
Africa, Al befriended the Belgian scientist Dr. Joseph
Charles Bequaert (1886-1982), who was working for the
Belgian government as an entomologist. Following his
work in Africa, Mead was transferred to the South
Pacific theater of World War II where he continued his
work on the pestiferous Giant African Snail ( Achatina
fulica). It was there that he met Dr. Yoshio Kondo
(1910-1990), who later worked at the Bernice P. Bishop
Museum, Honolulu, Hawaii, and was a life-long friend.
After an honorable discharge from the U.S. Army at
the end of World War II, Mead was awarded in 1946 a
Postdoctoral Research Fellowship in Zoology at the Uni-
versity of California at Berkeley. In 1947, he subse-
quently obtained his life-long job as a Professor at the
University of Arizona in Tucson. In 1952, he earned a
Full Professor position and became Head of the Depart-
ment of Zoology in 1956. He stepped down as depart-
ment head in 1967. From 1967 to 1970, he was
Chairman of the University of Arizona Marine Sciences
Committee. From 1976 to 1980, Mead was the Associate
Dean of the College of Liberal Arts. Upon retirement
from the University of Arizona in 1985, Al became Pro-
fessor Emeritus, having served almost 40 years. He was
then able to devote all of his time to research of his
scientific passion, the giant African snails.
Mead served as the Ph.D. thesis chair for a number of
graduate students at the University of Arizona and also
served on the thesis committees for other graduate stu-
dents. Many of those developed into respected scientists,
one even becoming a faculty colleague of Mead at the
University of Arizona (Walter Miller).
Al Mead was a clear proponent of professional socie-
ties and the dissemination of science. He was Chairman
of the Pacific Division and National Vice President of the
American Malacological Union in 1957, and President in
1963. In 1958, he became a Fellow and then President
of the Southwestern and Rocky Mountain Division of the
American Association for the Advancement of Science,
and by 1987 he was honored as an AAAS 50-year
member. Mead was a Charter Member of the Arizona
Academy of Science and its President in 1957. He was
also a Charter Member of the Western Society ol
Malacologists and the Society of Invertebrate Pathology.
Internationally he played a role in the Unitas Mala-
cologica Europaea, later Unitas Malacologica — the world
A.C. van Bruggen and J.I. Mead, 2011
Page 229
Figures 1-3. Albert R. Mead. 1, 2. In action in West Africa, 2"11 lieutenant US Army (1943-1945). 2. As the world-renowned
achatinid specialist at the University of Arizona (1990s).
body of malacologists. This institution organized the
European Malacological Congresses, which evolved into
the International Malacological Congresses. Al and Elea-
nor Mead always attended and Al never failed to lecture
on his favorite achatinids, reason why many of his publi-
cations are abstracts of lectures at various meetings.
Although trained as an entomologist. Mead soon
devoted his attention to the mollusks. Initially he was
fascinated by the giant slugs of California (see his papers
of 1942 and 1943 which derive from his Ph.D. disserta-
tion; also I960) but his professional career blossomed
when he began researching the giant African snail in
Page 230
THE NAUTILUS, Vol. 125, No. 4
Hawaii. Dr. Bequaert encouraged Mead to investigate
the genitalia of the Achatinidae because he himself had
met with difficulties in delimiting the giant African snail
species on their shells alone. I ndeed, the holdings of the
family Achatinidae of most major museums usually were
(and still are) limited to empty shells. Preliminary work
by Henry A. Pilsbry (1862-1957) was the basis for Mead's
1950 work which established his fame as an achatinid
specialist. In subsequent years he worked on the biology
of the pest species Achatina fulica, publishing prolifically
on this subject. His authoritative 1961 book became an
instant best seller, and is now available on the Internet;
an important update was published in 1979 in a
multivolume book entitled “Pnlmonates.” He only
returned to his beloved achatinid genital anatomy in the
late seventies of last century; his 1979 paper was his first
paper in that field after his 1950 anatomical treatise). His
work in “economic malacology” (according to Alan
Kabat, in litt., a term not first coined by Mead, cf.
Bullen, 1905: 313) was published in the form of numer-
ous short papers and reports in sometimes obscure and
even ephemeral journals. At the same time, he also wrote
a very widely distributed article for Reader’s Digest
(1949), with translations in several other languages. We
have attempted to collate all publications and the list
below (partly based on Mead’s own notes) is as complete
and as accurate as possible.
Always searching for material, Al traveled around the
United States and later in western and central Europe,
trying to trace old and new achatinid material, particu-
larly type and preserved specimens. Some of these trips
at that time were quite adventurous, even crossing the
Iron Curtain into East Berlin (then in East Germany,
D.D.R., a communist state). Al, the ‘traveling snailsman'
as he termed himself, always accompanied by Eleanor
(who looked after accomodation and catering), made
prolific notes and subsequently borrowed material to
study and dissect at home. One of the important discov-
eries of those dissections was that the Madagascan genus
Leucotaenius was not an achatinid, but rather belongs to
the family Acavidae (1986). Thus, the Achatinidae are
not indigenous to this island. The museums actively
collecting achatinids (London, Tervuren, Leiden) were
repeatedly visited and the senior author has fond memo-
ries of these sojourns. When in Leiden, the Meads
always bedded down in a little local hotel not far from
our (ACvB) house, Het Witte Huis (The White House)
in Oegstgeest, the name of which appealed to Als sense
of humor.
The significance of Mead’s research in the Achatinidae
not only encompasses his detailed anatomical and sys-
tematic work, but also his recognition ol the conse-
quences of trying to control Achatina (and other
non-native mollusks) when they were introduced into
new regions. At times his views were controversial but
his opinion was always based on the results of careful
research. After Pilsbry, Mead was the first to study the
genital anatomy of the achatinids from a phylogenetic
point ol view. The identity ol the shells ol the giant
African snails is not always easily established and details
of the genitalia are frequently required for conclusive
species identification. Al Mead supplied these data and
put them in context.
Al Mead was a successful taxonomist and in the course
of his studies he introduced 1 1 new taxa in the mollusks
and two in insects. These are enumerated below.
Regarding eponyms, it is surprising that there are only
two (which should be remedied in the near future!):
Archachatina (Tholachatina) meadi Bequaert, 1950,
Bulletin of Museum of Comparative Zoology 105 (1):
204 (Tanzania); Sonorella meadi Miller, 1966, The
Nautilus 80: 50 (Arizona, USA) [anecdotal information
supplied by Mead himsell is that this species is charac-
terized by a small penis!]. Achatina eleanorae Mead,
1995, was named by Mead after his spouse. Much of his
data in the form of notes, drawings, etc., are still
unpublished; these have been deposited in the archives
of the National Museum of Natural History, Leiden, The
Netherlands (now part of NCB/Naturalis — The National
Centre for Biodiversity).
We appreciate the editorial suggestions from Alan
Kabat (Washington, DC) and one anonymous reviewer
for materially contributing to and considerably improv-
ing the manuscript by paying close attention to details.
LITERATURE CITED
Anonymous. 2009a. Obituaries. Cornell Alumni Magazine
112 (1): 106.
Anonymous. 2009b. The late Albert Mead. The Malacologist/
The Bulletin of the Malacological Society of London 53: 2.
Anonymous. 2009c. Albert R. Mead (17 July 1915-13 March
2009). Unitas Malacologica Newsletter 28: 16.
Bruggen, A.C. van. 2009. In memoriam Professor Al Mead,
1913[correct year: 1915]-2009. Spirula 368: 51-52.
Bullen, R.A. 1905. Notes on land and fresh-water shells from
the Alhambra Ditch, Granada, Andalucia, Spain; on
Recent land shells from various localities near Carmona,
Province of Sevilla; and on land, fresh-water, and marine
shells from Holocene deposits, Carmona. Proceedings of
the Malacological Society of London 6: 309-313.
LIST OF NEW MOLLUSK TAXA INTRODUCED
BY A.R. MEAD
(all Gastropoda Pulmonata, one subfamily three genera, six
species, one subspecies)
Bequaertina, 1994, Bulletin of the Natural History Museum,
London, Zoology 60 (1): 18, type species Achatina graueri
Thiele, 1911 (East Central Africa from Zimbabwe to east-
ernmost DR Congo and Uganda) (Achatinidae).
brachi/phallus , Ariolimax califomicus, 1943, American Mid-
land Naturalist 30: 696 (holotype in California Academy
of Sciences, San Francisco) (California) (Arionidae).
Bmggenina, 2004, Zoologisehe Mededelingen Leiden 78 (25):
443, type species Archachatina sandgroundi Bequaert,
1950 (Rift Valley from Zimbabwe to Rwanda and Tanzania)
(Achatinidae).
A.C. van Bruggen and J.I. Mead, 2011
Page 231
Brownisca, 2004, Zoologische Mededelingen Leiden 78 (25):
445, type species Archachatina neumanni Thiele, 1933
(Sudan and Uganda to Somalia) (Achatinidae).
Callistoplepinae , 1994, Bulletin of the Natural History
Museum, London, Zoology 60 (1): 18, type genus
Callistoplepa Ancey, 1888 (Equatorial Guinea to western
DR Congo) (Achatinidae).
dolichophallus, Ariolimax, 1943, American Midland Naturalist
30: 689 (holotype in California Academy of Sciences, San
Francisco) (California) (Arionidae).
eleanorae, Achatina (Lissachatina), 1995, Journal of Molluscan
Studies 61: 265 (holotype in The Natural History
Museum, London, U.K.) (East Africa, offshore islands of
Tanzania) (Achatinidae).
kilbumi , Cochlitoma, 2004, Zoologische Mededelingen Lei-
den 78 (25): 425 (holotype in Natal Museum, Pieter-
maritzburg, South Africa) (South Africa, Pondoland)
(Achatinidae).
pilsbrui Mead and Miles, Pallifera (Pancalyptus), 1960, The
Nautilus 74: 75 (holotype in California Academy of
Sciences, San Francisco) (Arizona) (Philomycidae).
puylaerti , Archachatina ( Calachatina ), 1998, Journal of African
Zoology If 2: 125 (holotype in Zoologisches Museum
Berlin, Germany) (Togo) (Achatinidae).
wigleyi , Cochlitoma , 2004, Zoologische Mededelingen Leiden
78 (25): 439 (holotype in Natal Museum, Pietermaritz-
burg, South Africa) (South Africa, NE. of East London)
(Achatinidae).
LIST OF NEW TAXA OF INSECTS INTRODUCED
BY A.R. MEAD
(all Coleoptera Chrysomelidae, 2 subspecies)
magistrigata, 1938, Donacia subtilis, Pan-Pacific Entomologist
14 (3): 113 (holotype in California Academy of Sciences,
San Francisco) (California).
occcidentalis , 1938, Donacia distincta , Pan-Pacific Ento-
mologist 14 (3): 114 (holotype in California Academy of
Sciences, San Francisco) (California).
LIST OF PUBLICATIONS OF ALBERT
RAYMOND MEAD
1938. New subspecies and notes on Donacia with key to the
species of the Pacific States (Coleoptera, Chryso-
melidae). Pan-Pacific Entomologist 14 (3): 113-120.
1942. The taxonomy, biology and genital physiology of the
giant West Coast land slugs of the genus Ariolimax
Morch (Gastropoda: Pulmonata). Cornell University
Abstracts of Theses 1942: 312-314.
1943. Revision of the giant west coast land slugs of the genus
Ariolimax Morch (Pulmonata: Arionidae). American
Midland Naturalist 30: 675-717.
1949. Selection of islands for experimental biological con-
trol of Achatina fulica in the Pacific. Advance report.
Invertebrate Consultant Committee Micronesia, Pacific
Science Board Natural Resources Council, 4 pp.
(typescript).
1949. The giant snails. Atlantic 184 (2): 38—42.
1949. The giant snails. The Biologist 32 (1/2): 9-15.
1949. The giant snails — on the rampage. Reader's Digest 55
(330): 10-12 (also in the Australian, British, French,
Japanese, Portuguese, and Spanish editions; title varies).
1949. The giant snails. (Repartee) Atlantic 184 (4): 17-19.
1949. (A.R. Mead and Y. Kondo) Giant African snail ( Achatina
fulica) problem in Micronesia. Preliminary report.
Invertebrate Consultant Committee Micronesia, Pacific
Science Board Natural Resources Council, 6 pp. (type-
script).
1950. Comparative genital anatomy of some African
Achatinidae (Pulmonata). Bulletin of the Museum of
Comparative Zoology at Harvard College 105: 219-291.
1950. The giant African snail problem ( Achatina fulica ) in
Micronesia. Final report. Invertebrate Consultant Com-
mittee Micronesia, Pacific Science Board Natural
Resources Council, 55 pp. (typescript).
1950. The problem of the giant African snail (Achatina fulica)
in Micronesia. Final report. Invertebrate Consultant
Committee Micronesia, Pacific Science Board Natural
Resources Council, 30 pp. (mimeographed).
1951. Book Review: Soil and freshwater nematodes; a mono-
graph, by T. Goodey, Methuen & Co., Ltd., London,
XXVI + 390 pp., 190 text figs., 1951. $7.00. Bios 22 (3):
215-216.
1951. Giant snails. In: The story of our time, Encyclopedia
Yearbook 1951, Grolier Society, New York: 120-122.
1952. A course in techniques of biological literature and
nomenclature. Journal of the Colorado-Wyoming Acad-
emy of Sciences 4 (4): 104.
1951. Malacologieal legislation. American Malacological
Union News Bulletin and Annual Report for 1951:
11-12.
1952. Two new records of foreign mollusks in Arizona. Journal
of the Colorado-Wyoming Academy of Sciences 4 (4): 90.
1953. Foreign mollusks in Arizona. American Malacological
Union Annual Report for 1952: 30.
1952. The status quo of the problem of the giant African
snail. American Malacological Union Annual Report tor
1952: 34.
1953. (A.R. Mead and A.R. Kemmerer). Amino acid content of
dehydrated giant African snails (Achatina fulica
Bowdieh). Science 117 (3032): 138-139.
1953. Additional introductions of foreign snails into Arizona.
American Malacological Union Annual Report for 1953:
11-12.
1953. The economic significance of using giant African snail
meal as poultry feed. American Malacological Union
Annual Report for 1953: 5-7.
1955. The giant African (Kalutara) snail in Ceylon. Ceylon
Forester (N.S.) 2(1): 47-50.
1955. The proposed introduction of predatory snails into
California. The Nautilus 69: 37—40.
1955. Biological control of the giant African snail. American
Malacological Union Annual Reports for 1955: 31 [title
only] .
1956. A prognosis in the molluscan control program. American
Malacological Union Annual Reports for 1956: 23 [title
only].
1956. Disease in the giant African snail Achatina fulica
Bowdieh. Science 123 (3208): 1130-1131.
1956. Predators need defending. The Nautilus 70: 65-69.
1958. Disease transmission in terrestrial mollusks. American
Malacological Union Annual Reports for 1957: 26 [dated
1957 but published in 1958].
Page 232
THE NAUTILUS, Vol. 125, No. 4
1958. Recent discoveries in the disease syndrome of the giant
African snail. American Association for the Advance-
ment of Science, Southwestern and Rocky Mountain
Division, Program 34th Annual Meeting: 22.
1959. Increasing complexity in the problems of the giant
African snail. Journal of the Colorado-Wyoming Acad-
emy of Sciences 4 (11): 51-52.
1959. The appearance of the giant African snail in Arizona.
Proceedings of the Hawaiian Entomological Society
17(1): 85-86.
1959. The continuing battle against the giant African snail.
American Malacological Pinion Annual Reports for
1958: 37.
1960. Increasing complexity in the problems of the giant
African snail. American Malacological Union Annual
Reports for 1959: 39.
1960. (A.R. Mead and C.D. Miles) New Pallifera
( Pancalijptus ) from Arizona. The Nautilus 74: 75-78.
1961. A prognosis in the problem of the giant African snail. In:
Symposium: Ecology and Pacific distribution of the
giant African snail with special reference to the mea-
sures that are being taken for its control. Proceedings of
the Ninth Pacific Science Congress, Bangkok 1957 19:
7-10.
1961. An epizootic in the giant African snail. American Mala-
cological Union Annual Reports for 1960: 40-41.
1961. The giant African snail: a problem in economic malacol-
ogy: i-xi, 1-257. University of Chicago Press, Chicago-
London. PDF available at http://www.hear.org/books/
tgas 196 1/pdfs/tgas 196 1 .pdf.
1961. (C.D. Miles and A.R. Mead) Rediscovery of Pilsbry’s
Philomycus (Pallifera) arizonensis . American Malacolog-
ical Union Annual Reports for 1960: 25.
1962. The giant African snail. Midway/A Magazine of Discov-
ery in the Arts and Sciences 11: 20-33.
1963. A flatworm predator of the giant African snail Achatina
fulica in Hawaii. Malacologia 1 (2): 305-311.
1963. A flatworm predator of the giant African snail, Achatina
fulica , in Hawaii. American Association for the Advance-
ment of Science, Southwestern and Rocky Mountain
Division, Program 39th Annual Meeting: 38.
1963. Additional introduction of foreign snails into Arizona.
Sterkiana 9: 27 [reprint of 1953 abstract].
1963. Foreign mollusks in Arizona. Sterkiana 9: 27 [reprint of
1953 abstract],
1963. Giant snail. In: Invertebrate Consultants Committee for
the Pacific Meeting of March 1-2, 1963. Pacific Science
Board, National Academy of Sciences National Research
Council: 6, 7, 25-29 (photo-offset).
1963. Disease, decline and predation in the giant snail
populations of Hawaii. American Malacological Union
Annual Reports for 1963: 22.
1964. Gastropods in scientific research. American Malacologi-
cal Union Annual Reports for 1964: 29-30 [abstract,
“read by title”, author not present],
1966. (A.R. Mead, W.W. Dean, E.S. Kojima, L.Y. Ichinose)
Aeromonas in the pathology of the giant African snail.
Southwestern and Rocky Mountain Division, American
Association for the Advancement of Science and the
New Mexico Academy of Science, Abstracts of Papers: 36.
1966. (A.R. Mead, W.W. Dean, E.S. Kojima, L.Y. Ichinose)
Aeromonas in the pathology of the giant African snail.
American Malacological Union Annual Reports for
1966: 19.
1968. Introduction of foreign land snails into Arizona. Pro-
ceedings Conference Military Importance Mediterra-
nean Snail Complex. US Naval Medical Field Research
Laboratory Entomological Division Camp Lejeune,
N.C., Entomological Division 28 (11): 29-38.
1968. Notaciones del progreso en la eieneias marinas en la
Universidad de Arizona. In: Consejo para el Desarrollo
Pesquero del Golfo de California. IV Reunion regional
para el desarrollo pesquero del Golfo de California,
Los Moehis, Sinaloa, Mexico, Jan. 29-30, 1968,
Memoria, 4 pp.
1968. The third European Malacological Congress. American
Malacological Union Annual Reports for 1968: 61-64.
1969. (D.A. Thomson, A.R. Mead, J.R. Schreiber, J.A. Hunter,
W.F. Savage, and W.W. Rinne) Environmental impact of
brine effluents on the Gulf of California. United States
Department of the Interior, Research and Development
Progress Report 387: viii + 196 pp.
1970. Aeromonas liquefaciens in the leukodermia syndrome
of Achatina fulica. Malacologia 9 (Proceedings of the
Third European Malacological Congress, Vienna,
1968): 43.
1969. The University of Arizona Marine Sciences Program.
American Malacological Union Annual Reports for
1969: 61.
1970. The University of Arizona Marine Sciences Program.
Echo 2: 19.
1970. (W.W. Dean, A.R. Mead and W.T. Northey) Aeromonas
liquefaciens in the giant African snail, Achatina fulica.
Journal of Invertebrate Pathology 16: 346-351.
1970. Symposium: Scientific and popular publication in
malacology. Echo 2: 27-31 [summary of remarks by
Mead edited by J.T. Smith, with additional notes by
Mead].
1971. The spread of the giant African snail to the continental
United States. Echo 3: 29.
1971. Helicid land mollusks introduced into North America.
American Malacological Union Annual reports for
1970: 55.
1971. Status of Achatina and Rumina in the United States.
American Malacological Union Annual reports for
1970: 56.
1971. Helicid land mollusks introduced into North America.
Biologist (Phi Sigma Society) 53: 104-111.
1971. Status of Achatina and Rumina in the United States.
Biologist (Phi Sigma Society) 53: 112-117.
1972. Recent developments in the problem of the giant Afri-
can snail. Journal of the Colorado-Wyoming Academy of
Sciences 7: 67.
1973. A prognosis in the spread of the giant African snail to
continental United States. Malacologia 14 (Proceedings
of the Fourth European Malacological Congress,
Geneva, 1971): 427.
1973. New outbreaks in the Florida giant African snail infesta-
tion. American Malacological Union Bulletin for 1972
(Volume 38): 19.
1976. Comparative anatomical studies in Europe on the Afri-
can Aehatinidae. Western Society of Malaeologists
Annual Report 9: 39.
1977. The giant African snail and economic malacology.
Malacologia 16 (Proceedings of the Fifth European
Malacological Congress, Milan, 1974): 157.
1979. Anatomical studies in the African Aehatinidae — a pre-
liminary report. Malacologia 18 (Proceedings of the
A.C. van Bruggen and J.I. Mead, 201 1
Page
233
Sixth European Malacological Congress, Amsterdam,
1977): 133-138.
1979. Biological control of terrestrial snails (Premier Colloque
International de Pathologie et Parasitologie des
Mollusques, Perpignan, France, 9-12 September 1977).
Haliotis 8: 263-264.
1979. Economic malacology with particular reference to
Achatina fulica . In: V. Fretter and |. Peake, eds., Pulmo-
nates 2B: i-x, 1-150. Academic Press, London.
1980. The giant African snails enter the commercial field.
Abstracts Seventh International Malacalogical Congress,
Perpignan, 1980. Haliotis 10 (2), separate supplemen-
tary abstract.
1982. The giant African snails enter the commercial field.
Malacologia 22 (Proceedings of the Seventh European
Malacological Congress, Perpignan, 1980): 489-493.
1983. New perspectives in the distribution and phylogeny of
the African Aehatinidae (Pulmonata: Sigmurethra).
Abstracts Eighth International Congress of Malacology,
Budapest, 1983: 86.
1986. Anatomical studies transfer Leucotaenius from
Aehatinidae to Acavidae (Pulmonata: Sigmurethra).
Archiv fur Molluskenkunde 116: 137-155.
1986. II ow do land snails succeed in invading new territories?
Abstracts Ninth International Malacological Congress,
Edinburgh, 1986: 52.
1987. (C.V. Haynes and A.B. Mead) Radiocarbon dating
and paleoclimatic significance of subfossil Limicolaria
in northwestern Sudan. Quaternary Research 28:
86-99.
1988. Anatomy of the South African Archachatina ustulata
(Lamarck) (Pulmonata: Aehatinidae). Journal of Mollus-
ean Studies 54: 363-365.
1989. Anatomical criteria in the systematic^ of the Aehatinidae
(Pulmonata). Abstracts Tenth International Malacologi-
cal Congress, Tubingen, 1989: 160.
1992. A new subfamily and genus in Aehatinidae (Pulmonata:
Sigmurethra). Abstracts Eleventh International Malaco-
logical Congress, Siena, 1992: 346.
1992. Anatomical criteria in the systematic^ of the
Aehatinidae (Pulmonata). Proceedings of the Tenth
International Malacological Congress, Tubingen, 1989
[2]: 549-553.
1992. (A.R. Mead and L. Paley) Two giant African land snail
species spread to Martinique, French West Indies. The
Veliger 35: 74-77.
1992. (L. Paley and A.R. Mead) Les deux redoutables escar-
gots geants africains a la Martinique. Phytoma Defense
Vegetale 449: 48-49.
1994. A new subfamily and genus in Aehatinidae (Pulmonata:
Sigmurethra). Bulletin of the Natural History Museum,
London, Zoology 60: 1-37.
1995. Anatomical studies reveal new phylogenetic interpreta-
tions in Lissachatina (Pulmonata: Aehatinidae). Journal
of Molluscan Studies 61: 257-273.
1995. Anatomy, phylogeny, and zoogeography in the African
land snail family Aehatinidae. Abstracts Twelfth Interna-
tional Congress of Malacology, Vigo, 1995: 422-423.
1998. A new species of Archachatina in the Dahomey Gap
of West Africa and its implications in phylogeny
(Pulmonata: Aehatinidae). Journal of African Zoology
1 12: 123-145.
1998. Comparative anatomy establishes correlativity in distri-
butional direction and phylogenetic progression in the
Aehatinidae. Abstracts World Congress of Malacology,
Washington, DC, 1998: 214.
2001. Reproductive anatomy defines phylogeny and interprets
distribution in the African giant land snails. Abstracts
World Congress of Malacology, Vienna, 2001: 215.
2004. Comparative reproductive anatomy in the South African
giant land snails (Gastropoda: Pulmonata: Aehatinidae).
Zoologische Mededelingen Leiden 78: 417-450.
The third meeting of Florida United Malacologists (FUM) wall take place on Saturday, Februaiy 11, 2012, at The Bailey-Matthews
Shell Museum (BMSM) on Sanibel Island, Florida. The one-day gathering is designed to enhance communication among profes-
sional, amateur, and student malacologists, with topics including, but not limited to biology, ecology, paleontology, archaeology, and
conservation.
FUM follows the pattern established by similar informal gatherings such as BAM (Bay Area Malacologists), SCUM (Southern
California United Malacologists), MAM (Mid-Atlantic Malacologists), and OVUM (Ohio (River) Valley United Malacologists). There
is no formal membership and there are no dues, officers, nor publications. However, presenters are required to submit a brief
abstract limited to 150 words or less. Abstracts wall be posted on the Museum web site. The gathering will be free to presenters and
Museum members. Non-members will be asked to donate the Museum admission fee of $9.
Participants are strongly encouraged to ask questions and discuss data, compare notes on methods and problems, and get acquainted
with presenters and members of the audience. Presentations, limited to 15 minutes plus 5 minutes for questions, will be informal
and will cover current research and collection efforts and issues. The Museum will provide projection equipment for PowerPoint
programs, brief videos, and slides.
Due to staffing limitations, use of the library and research area and collection visits will be limited to two days prior to the gathering,
Thursday, February 9, and Friday, February 10. Museum parking is free. Box lunches and dinner at a local restaurant (to be
arranged) wall be available at cost to participants and presenters. An event reservation form for presenters and participants will be
posted soon on the Museum web site (www.shellmuseum.org). Seating is limited, so please return the reservation form prior to
January 15, 2011.
Please send inquiries, reservations, and presentation topic submissions to Jose 11. Leal, Museum Director/Curator at jleal@shellmu
seum.org. The deadline for submission of topics and abstracts is January 31, 2011. The F U M program including abstracts, times, and
sequence of presentations will be posted on the Museum web site, www.shellmuseum.org, shortly after the topic submission
deadline.
Kind regards to all,
Jose H. Leal
Director/Curator
The Bailey-Matthews Shell Museum
THE0NAUTILUS
Volume 125
2011
AUTHOR INDEX
Aldea, C 79
Alves, J 150
Amano, K 29, 207
Ando, II 207
Bennett, K. F 63
Bogan, A. E 41, 171
Bowers-Altman, J 41
Carlton, J. T 221
Coan, E. V. 86
Fallon, P. J Jr 15, 53
Garcia, E. F 167
Geiger, D. L 89
Genta-Iturreri'a, S. F 215
Gillevet, P. M 173
Glover, E. A 75
Griffin, M 215
Groves, L. T 45
Haimovici, M 150
Haram, L. E 221
Harasewych, M. G 72, 159, 173
Hoisaeter, T 89
Jenkins, R. G 29
Kunze, T. 36
Lutz, R. A 63
Mead, J. 1 228
Nakano, T. 1
Olivera, B. M 164
Pearce, T. A 83
Perez, K. E 113
Petit, R.E 72, 86, 159
Porter, K, A 83
Raising, M. R 215
Raley, M. E 41
Reed, A. | 63
Scarabino, F. 127
Scarabino, V. 127
Sellanes, [ 1
Sikaroodi, M 173
Squires, R. L 137, 193
van Brugcen, A. C 228
Taylor, J. D 75
Thompson, F. G 182
Troncoso, J. S 79
Tu, D. V. 171
Tucker, J. K 164
Valentich-Scott, P 75
Waren, A 1
Zelaya, D. G 79, 86
NEW TAXA PROPOSED IN VOLUME 125
GASTROPODA
Aclmete verenae Harasewych and Petit, 2011, new species (Cancellariidae) 159
Afrollonia elderensis Squires, 2011, new species (Turbinidae, fossil) 198
Agathodonta haegerti Squires, 2011, new species (Chilodontidae, fossil) 196
Anatoma schanderi Hoisaeter and Geiger, 2011, new species (Anatomidae) 106
Anatoma schiottei Hoisaeter and Geiger, 2011, new species (Anatomidae) 103
Antillocollonia bos Squires, 2011, new species (Turbinidae, iossil) 200
Bathi/tomo gordonlarki Tucker and Olivera, 2011, new species (Borsoniidae) 164
Benuiya (Bcnmya) squiresi Groves, 2011, new species (Cypraeidae. fossil) 47
Cidarina grahami Squires, 2011, new species (Chilodontidae, fossil) 197
Crassispira ( Crassiclava ) blanqiiilla Fallon, 2011, new species (Turridae) 57
Crassispira ( Crassiclava ) cana Fallon, 2011, new species (Turridae) 60
Crassispira ( Crassiclava ) mackintoshi Fallon, 2011, new species (Turridae) 59
Crassispira ( Crassiclava ) masinoi Fallon, 2011, new species (Turridae) 56
Crassispira ( Crassiclava ) midticostata Fallon, 2011, new species (Turridae) 59
Crassispira (Monilispira) mayaguanaensis Fallon, 2011, new species (Turridae) 16
Dillwynella voightae Kunze, 2011, new species (Turbinidae) 37
Eccliseogyra brasiliensis Garcia, 2011, new species (Nystiellidae) 167
Eocypraea ( Eoct/praea ) batequensis Groves, 2011, new species (Cypraeidae, fossil) 49
Eocypraea ( Eocypraea ) crescentensis Groves, 2011, new species (Cypraeidae, fossil) 49
Eocypraea ( Eocypraea ) takeosnsukii Groves, 2011, new species (Cypraeidae, fossil) 48
Eocypraea ( Eocypraea ) jimgoederti Groves, 2011, new species (Cypraeidae, fossil) 50
Igonoia Squires, 201 1 , new genus (Turbinidae, fossil) 138
lgonoia kieli Squires, 2011, new species (Turbinidae, fossil) 139
Igonoia mniri Squires, 2011, new species (Turbinidae, fossil) 146
Igonoia onoensis Squires, 2011, new species (Turbinidae, fossil) 141
Igonoia shastana Squires, 2011, new species (Turbinidae, fossil) 140
Igonoia vacca Squires, 2011, new species (Turbinidae, fossil) 143
lotlxia emarginuloides Waren, Nakano, and Sellanes, 2011, new species (Lepetidae) 4
Mexistrophia Thompson, 2011, new genus (Cerionidae) 182
Mexistrophia inexpectata Thompson, 2011, new species (Cerionidae) 186
Mexistrophia obsoleta Thompson, 2011, new species (Cerionidae) 186
Mexistrophia reticulata Thompson, 2011, new species (Cerionidae) 1.83
Neadmete ahoi Harasewych and Petit, 2011, new species (Cancellariidae) 161
Praticolella mexicana Perez, 2011, new species (Polygyridae) 119
Pupillaria encina Squires, 2011, new species (Turbinidae?, fossil) 202
Pupillaria lomana Squires, 2011, new species (Turbinidae?, fossil) 203
Sveltia ijoijottei Petit and Harasewych, 2011, new species (Cancellariidae) 72
Tegula daileiji Squires, 2011, new species (Turbinidae?, fossil) 201
Z eidora antarctica Aldea, Zelaya, and Troneoso, 2011, new species (Fissurellidae) 79
BIVALVIA
Bathymodiolus (sensu lato) inouei Amano and Jenkins, 2011, new species (Mytilidae, fossil) 30
SCAPHOPODA
Cadulus unilobatus Scarabino and Scarabino, 2011, new species (Pulsellidae) 132
Chistikovia atlantica Scarabino and Scarabino, 2011, new species (Wemersoniellidae) 134
Gadila celtica Scarabino and Scarabino, 201 1, new species (Pulsellidae) 134
Gadila cretea Scarabino and Scarabino, 2011, new species (Pulsellidae) 133
Laevidentalium abyplaine Scarabino and Scarabino, 2011, new species (Dentaliidae) 128
Pulsellum filiforme Scarabino and Scarabino, 2011, new species (Pulsellidae) 130
Siphonodentalium coronation Scarabino and Scarabino, 2011, new species (Siphonodentaliidae) 135
Striopulsellum atlantis Scarabino and Scarabino, 2011, new species (Pulsellidae) 131
Striopulsellum knorr Scarabino and Scarabino, 2011, new species (Pulsellidae) 131
Striopulsellum sandersi Scarabino and Scarabino, 2011, new species (Pulsellidae) 130
REVIEWERS FOR VOLUME 125
Frank Anderson
Rudiger Bieler
Arthur E. Bogan
Philippe Bouchet
Robert S. Butler
Juan Lucas Cervera
Celia Churchill
Eugene V. Coan
Timothy Collins
Arturo Correa-Sandoval
Rudo Von Cosel
Robert H. Cowie
Susana Damborenea
Robert T. Dillon, Jr.
Diarmaid O Foighil
Emilio F. Garcia
Jeffrey T. Garner
Daniel Geiger
Suzete Gomes
Lindsey Groves
M.G. Harasewych
|un Hashimoto
David Hayes
John M. Healy
Kathe Jensen
Alan Rabat
Gennady Kamenev
Yuri I. Kantor
Steffen Kiel
Harry G. Lee
Bruce A. Marshall
Edna Naranjo-Garcia
Bruce Neville
Sven Nielsen
Marco Oliverio
Guido Pastorino
Rafael La Perna
Richard E. Petit
Charles L. Powell, II
Charles R. Randldev
Bernd Sahlmann
Takenori Sasaki
Tom Schiotte
Peter Stahlsehmidt
John D. Taylor
Jeremy Tiemann
Fred G. Thompson
Andre Verheeken
Janet R. Voight
Chris Wade
Anders Waren
James D. Williams
John D. Zardus
Sponsored in part by the State of
Florida, Department of State,
Division of Cultural Affairs and the
Florida Council on Arts and Culture
CULTURE
BUILDS
FLORIDA
FLORIDA DEPARTMENT of STATE
DIVISION of CULTURAL AFFAIRS
INSTRUCTIONS TO AUTHORS
THE NAUTILUS publishes articles on all aspects of the
biology, paleontology, and systematics of mollusks.
Manuscripts describing original, unpublished research
and review articles will be considered. Brief articles, not
exceeding 1000 words, will be published as notes and do
not require an abstract. Notices of interest to the mala-
cological community will appear in a notices section.
Manuscripts: Each original manuscript and accompa-
nying illustrations should be submitted to the editor pref-
erably via e-mail or as hardcopy in triplicate.
Text must conform to the dimensions of 8V2 x 11-inch
paper, double-spaced, and single-column throughout (in-
cluding literature cited, tables, and figure captions). Au-
thors should follow the general recommendations of Sci-
entific Style and Format — The CSE Manual for Authors,
Editors, and Publishers, available from the Council of
Science Editors at www.councilscienceeditors.org. The
first mention of a scientific name in the text should be
accompanied by the taxonomic authority, including year.
Latinized names and other words to be printed in italics
must be underlined; leave other formatting indications to
the editor. Metric, not English, units are to be used. Geo-
chronologic modifiers should be capitalized only when
units are formally recognized: for instance, use Late Cre-
taceous but early Miocene. Likewise, only modifiers of
formally recognized chronostratigraphic units are capi-
talized: use Lower Jurassic but upper Oligocene.
The sequence of sections should be title page, ab-
stract, introduction, materials and methods, results, dis-
cussion, acknowledgments, literature cited, tables, figure
captions, figures. The title page should include the title,
authors name(s) and address(es). If corresponding au-
thor is not the senior author, please indicate. The ab-
stract should summarize in 250 words or less the scope,
main results, and conclusions of the article. Abstracts
should be followed by a list of additional key words. All
references cited in the text must appear in the Literature
Cited section and vice-versa. Please follow a recent issue
of THE NAUTILUS for bibliographic style, noting that
journal titles must be unabbreviated. Information on
plates and figures should be cited only if not included
within the pagination of cited work. Tables must be num-
bered and each placed on a separate page. If in doubt,
please follow a recent issue of the journal for sequence of
sections and other style requirements.
Illustrations: Illustrations are rendered either at full-
page width (maximum width 17 cm) or column width
(maximum width 8.2 cm). Please take these dimensions
into consideration when preparing illustrations. Page-
width illustrations ideally should span the entire width of
printed page (17 cm). “Tall" page-width illustrations
should be avoided, square or “landscape” formats work
better. Please design plates accordingly, such that there
will be enough space left at the bottom of printed page
for plate caption. (Digital technology has made this task
much easier.)
All line drawings must be in black, clearly detailed,
and completely labeled. Abbreviation definitions must be
included in the caption. Line drawings must be high
resolution files at at least 600 dpi (dots per inch) resolution
at actual size. Standard digital formats for line drawings
include .tif, .bmp, .psd, .eps, and .pdf.
Photographs may be submitted in black-and-white or
color, preferably in RGB mode if in color. Standard digi-
tal formats for photographs include .tif, .psd, .jpg, or .pdf.
Photographs must be high resolution files at least 300 dpi
resolution at actual size.
If more than one figure is included in an illustration,
all figures are to be consecutively numbered (Ligures 1,
2, 3, . . . , NOT Ligures 1A, 1B,1C, . . . , NOR Plate 1,
Ligure 1, . . .). In illustrations with more than one figure,
make sure that blank areas between figures is kept to a
minimum, thereby allowing for more area for each indi-
vidual figure.
Compressed files (e.g., .jpg) may be used to facilitate
transmission of files during original submission, but may
not be acceptable at final submission (see below-').
Voucher Specimens: Deposition of the holotype in a
recognized institutional, public collection is a require-
ment for publication of articles in which new species-
level taxa are described. Deposition of paratypes in in-
stitutional collections is strongly encouraged, as is the
deposition of representative voucher specimens for all
other types of research work.
The Editorial Process: Upon receipt, all manuscripts are
assigned a number and acknowledged. The editor reserves
the right to return manuscripts that are substandard or
not appropriate in scope for THE NAUTILUS. Manu-
scripts deemed appropriate for the journal will be sent
for critical review to at least two reviewers. The review-
ers’ recommendations wall serve as basis for rejection or
continuation of the editorial process. Reviewed manu-
scripts wall be sent back to authors for consideration of
the reviewers’ comments. The revised version of the
manuscript may at this point be considered accepted for
publication by the journal.
Final Submission: Authors of accepted manuscripts are
required to submit a final version via e-mail to the editor
at [email protected]. Please do not send low- resolu-
tion or compressed illustration files at this stage. Send any
files larger than 20 Mb on a CD or DVD to the editor.
Proofs: After typesetting, proofs wall be sent to the au-
thor. Author should read proofs carefully and send cor-
rections to the editor wdthin 48 hours. Changes other than
typesetting errors will be charged to the author at cost.
Offprints: An order form for offprints will accompany
the proofs. Offprints will be ordered through the editor.
Authors with institutional, grant, or other research sup-
port wall be asked to pay for page charges at tire rate of
$60 per page.
0 This paper meets the requirements of ANSI/NISO Z39. 48-1 992 (Permanence of Paper)
SMITHSONIAN INSTITUTION LIBRARIES